current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|29345419|ref|NP_808922.1|(removed signal:1-26) phosphate-binding periplasmic protein precursor, putative ABC transporter BT_0009 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst AATLFTSGKPVEELSENAAVGRKSVITAAGATLPLPFYSEAFKMYWEKNDIPVTYAGIGTERGFRSLKNQQIDFAGVDVPPTKAELDSLPVKSILVPTCMGAVTIAYNLEGVDNLRLTGELIADIYMGKILKWNDARIAAVNAGKQLPDKEIYPVFRLDGSGTTYIFSDYLTKVSTDWKAKIGTGKALTFPRGVAATGNTGVAGLVGKVPGAIGYVASEYAASFNTQSAWLKNAAGNFVQPTSESVTAVASVGDATGMITDSEVADAYPISCFTWVVLYKEQNYAGRSRSEAEETVKLLEWLISPEAQTITTQVQCSPLPEKAVEYAKNMLKEVTYDGKALRKLast
1 -98.300[P] COG0226 ABC-type phosphate transport system, periplasmic component  ali follow..  29  42DGSSGTAKDATASSPAKLDLGGNVSLTGAGASFPAPLYASWFTDLNKYPNLQINYQSVGSGAGVEQFIQGTVDFGASDVAMKDEEIQKVQRGVLLLPVTAGGIVLAYNLPGVTELNLPRVVYTDILLGKIKTWDAPEIKAANPNVNLPSQPITVVYRSDGSGTTGVFTKHLAAVSPEWKSKVGEGKSVSWPVGVGGKGNEGVTAQIKQTQGAIGYIEYGYAKQNNISYATLENKAGKFVKYNDESASQTLAAIQLPEFVPDPDGDGSYPIVSFSWIMAYKNYP----DPVKAKAMEAAIEYALT-EGQKISGELGYIPLPQAVVQKTATVADQISPEYKISVS 384
2 -20.000[H] COG2998 ABC-type tungstate transport system, permease component  ali follow..  11  10.FTLAAASLILVSYSASSADDARIRLATTTSTYDSGLLDYLLPKFEQDTGYKVDVIATGTGKALKMGENGDVDLVMTHAPKAEASFVEAGFGVLPRKLMYNDFVVV-DPAKIADEKNIAKVFENIAKSGAV----------------------FISRGDDSGTHKK--------------------------------ELGIWAQNKIEPNFGGYRSIGQGMGPTLNMAS--EMQAYTLTDRGTWLAYNNKLALKILFEGDEQLFNPYQVIIVN---------PERYPTTQYHAAKVFSDWLVNPKGQQLINEFKFVANADK..................... 274
3 -18.800[P] COG1613 ABC-type sulfate transport system, periplasmic component  ali follow..  10  8GIVKLALVVGSLQLGSIGLALADTTILNVSYDPTRELYKEFNAAFAEKETVTIQTSHGGSGKQARSVIDGEADVVTLALEADIDAIAKESG---NSAPYTSTIVFLVRKGNPK---------------AIKDWGD---------LVREDVQVITPNPKTSGGARWNFLAAWAWARAANNGDDAKAQLFKHVPVLDTGARGATTTFVQRGLGDVL---LAWENEAYLSLEELGPDNFDIVTPSISIKAEP-------------------PVALVDGNV---------DSKGTRKVAEAYLDYLYSDVGQKIAAKHYYRPFKPELAD.................. 298
4 -16.200[P] COG4150 ABC-type sulfate transport system, periplasmic component  ali follow..  10  10ARNGLTHIALFSALILSGVTASATELLNSSYDVSRELFTALNPGFQAQDKLTIKQSHAGSSKQALAILQGKADVVTYNQITDVQILHDRG----NSSPFYSTMAFLVRKGNPK---------------NIRNWDD---------LVREDVKLVF--KTSGNGRYTYLATQLADGGDEAKTRDWMKRFLKNVEVFDTGGRGATTTFVERGLGDVLIS---FESEVNNIRKEYGSDQYEVIVPPVDILAE-------------------FPVAWVD---------KNVEKNGTEKAAKAYLNYLYSPPAQQVITRFNYRVYDKAAMEAAKSQFPDTK........ 311
5 -14.400[P] COG1840 ABC-type Fe3+ transport system, periplasmic component  ali follow..  12  21RLTIISSLLLAGTTLLGVPAHAAGDLN---CAADVVICEQMKGDFEKTHDIKVNMVRMSSGEAYAKIRNPKTDLWWAGLEYKSKMLDQLQDWA--VGVYAGALGWGYNTDIFKKKGYKEP----------KCWADLLAPELKGEIQIAN--------PNSSGTAYTALASLVQIMGEDQA-----KKLNGNISQYTKSGSAPVKAAARGETAVGIVFMHDATAEGFPVKSVAPCEGTGYEIGSMSIVK---------------------------------------GARNLENAKTWYDWALQPDVQSRMKDAKSFQLPSNKTAEIPKEAPRFE........ 326
6 -13.400[H] COG4143 ABC-type thiamine transport system, periplasmic component  ali follow..  11  1.MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNEAATQTKLFAVPFDYGYFAFVYDKSKLKNPPKSLKELVE-QKWRV--------IYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTV-----------------TKGWSEAYGLFLKGESDLVLSAYHIIEEKKDNYAAANFSEGHYLQVEVAARTV---------------------------------------ASKQPELAEKFLKFMVSPAFQNAIPTGNWYPVADVAL................... 289
7 -13.300[R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain  ali follow..  13  1....MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVKPLYFREAIILTQKGNPL---------------KIKGLKD-----------LANKKVRIVVP-EGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKE----------------------------------------GASKETQDFIAYLSSKEAKEIFKKYGW........................... 248
8 -11.700[R] COG4134 ABC-type uncharacterized transport system, periplasmic component  ali follow..  10  11LLSLFSLATHASDWQEIKNEAKGQTVW-GGDTAINRYLDWVSGEMKTHYAINLKIVRLADAADAVKRIGGSVDLLWVNGENFRTLKEAVPTEGAESPWGGAQLTFIARRDVTPQPPQTPQALLE--------FAKA-----NPG------TVTYPRPPDFTGTAFLEQLLIMLTPDPAALNEAPNDATF------ARVTAPLWQYLDALHPYLWREGKDFPPSPARMDALLKAGTFRLSLTFNPAHAQQKIASGDLPASSYSFGFREGMIGNVHFVTIPA-------NANASAAXKVVANFLLSPDAQLRKADLDPQKLPDGQRETLQSRMPQ.......... 361
9 -10.500[P] COG0725 ABC-type molybdate transport system, periplasmic component  ali follow..  10  5.WLRLVAGATLSFVIAGHALADEGKITVFAAASLTNAMQDIAAEYKKEKNVDVVSSFASSSTLARQIEAGA---------------------------------------------------ADLFISADQKWADKKAVDTTTRETLLGNSLVVVAPKASEQKPFTIDNKTDWIRLLNGGRLAVGDPQHVPAGIYAKEALQKLGAWQTLEPKLAPGE----VRGALALVERNEAPLGIVYGSDAVASKGVN------VVATFPEDSHKKVEYPIAIV----------EGHKNATVSAFYDYLKGPQASAIFKRYGFT.......................... 255
10 -10.200[P] COG1910 Periplasmic molybdate-binding protein/domain  ali follow..  13  94.........................................SKHLENAIQETPLRKYKGSLNSLIDMYQGKCDIVSLH--LYDAETGQYNAPYVKRILTGEPFCLI--------------NVVLRKAGLYVQKGNP--KNIQGWKDLKRADIRIINREKGSGARVLLDEQLGLLGVNPADVVGYGDI--------VTDHYAAASQVSSGQADAGIGAQHAAHMGSVDFI---------------------------------------PLIDEQYDIVVLK--------KNEQLLKAVKEILNSEDYKANLSHLGY----------------ETKLTGKVILE 307

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhi D, Krishna SS, Cao H, Pevzner P, Godzik A. Representing and comparing protein structures as paths in three-dimensionalspace. BMC Bioinformatics. 2006 Oct 20;7:460.