current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|29345429|ref|NP_808932.1| hypothetical protein BT_0019 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MEKENTNGGSVYVTVDGHFKPVHVSMKGTGEKGFLEFMLEDVEKALKETEMPVIGMMYYNVPDMGIVPHLWEGNNDDYLQRLEKAMDGHGIKLHRYLRLSEVVYCLLast
1 -7.540[C] COG3052 Citrate lyase, gamma subunit  ali follow..  17  1MKINQLESGDVMIRIAPDTQDIDLQINSSVEKQFGEAIRATILEVLSRYDVRG---VQLNVDDKGALDCILRARLETLLARA........................ 86
2 -6.760[E] COG2755 Lysophospholipase L1 and related esterases  ali follow..  12  17LSDQPVTNRTIYVGGDSDKHTFQVRNMASGGQIARGFRNDQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATD.. 145
3 -6.310[B] KOG3844 Predicted component of NuA3 histone acetyltransferase complex  ali follow..  12  581...ADDSGDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSS------------RWDVKMKWDVKSCDEDGQED............................. 642
4 -5.690[S] COG5447 Uncharacterized conserved protein  ali follow..  53EKKGAEAAGAIFVRQRLRDGRENLRLAGVEGEEIAALLERERRF-------SDLWVVEIETDEIGTLLTLVDQPQA.............................. 145
5 -5.670[S] COG2257 Uncharacterized homolog of the cytoplasmic domain of flagellar protein FhlB  ali follow..  16  13........................................................VRYN-REKEKAPRIIGKGKGLVADELIKRAEEAKVPIQKDPSLVELLGQL 61
6 -5.220[U] COG4792 Type III secretory pathway, component EscU  ali follow..  10  214LKMSHDEVKREYKDSNGDPH-IKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYPEETPLPIVIEKGHDEQAALIVSLAEQSGIPVVENIALARALH.. 317
7 -5.040[I] COG5379 S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase  ali follow..  12  226......SRKSSLFGLGIPPQQFDELASLSREKSVAAVLRNRLEKLTCHFPLRDNYFARYPRPDEGELPPYLQASRYEAIRDFTELLAGKPAASVDRYVLLDAQ... 339
8 -4.900[S] COG3171 Uncharacterized protein conserved in bacteria  ali follow..  11  1MAKNRSRRLRKKMHIDEFQEVAWRFPEGTSEEQVDKTVDDFINDVIEPNKLAFDGSGYLAWEGLICMQEIGKCTEEH-QAIVRKWLEARNLEEVRTSELFDVWW.. 107
9 -4.870[NU] COG1377 Flagellar biosynthesis pathway, component FlhB  ali follow..  10  220LKMTKQEVKDEYKDTEGKPE-VKGRIRMLQREAAQRRMMAALPQADVIITNPEHFSVALRYQNTDKAPVVIAKGVDHMALKIREIAREYDIAIVPAPPLARALY.. 323
10 -4.510[J] KOG3445 Mitochondrial/chloroplast ribosomal protein 36a  ali follow..  11  32....................TLKFCKNNGSSRGMRDFIENHLLDFAKEN--PGIVVYEYLNGEREWM-SCRNSTQEEISKWIDLLKTQNG................ 111

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhi D, Krishna SS, Cao H, Pevzner P, Godzik A. Representing and comparing protein structures as paths in three-dimensionalspace. BMC Bioinformatics. 2006 Oct 20;7:460.