current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15894664|ref|NP_348013.1| Alpha-ribazole-5`-phosphate phosphatase, CobC (CA_C1385) [Clostridium acetobutylicum ATCC 824] (Range: 1-191), from C.acetobutylicum

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MLRITLVRHGETDSNRNKKYLGWTDVELNEKGIAEAEMVRDKLRDTKFDFVISSPLKRAKATAKIIRDTNIIYEDALKEINFGLWDNLSYKEIKDKYPDECEKWSSDWKSFVFPQGEGPKEMYTRVSNFMNKLKGMEGSILIVTHGGIIRSTIAYLLEMGIEGAWHFATNNCGITVIEVRDSYAVLKSLNDLast
1 -76.600sp|Q8N0Y7|PGAM4_HUMAN Probable phosphoglycerate mutase 4 OS=Homo sapiens GN=PGAM4 PE=1 SV=1  ali follow..  22  3AYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRGYEFDICLTSVQKRVIRTLWTVLDLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPSYESPKDTIARALPFWNEEIKEGKRVLIAAHGNSLQGIAKHVEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQF 232
2 -75.200sp|P07738|PMGE_HUMAN Bisphosphoglycerate mutase OS=Homo sapiens GN=BPGM PE=1 SV=2  ali follow..  21  3KYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKAFEFDLVFTSVLNRSIHTAWLILEVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPRSESLKDVLERLLPYWNERVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQ. 233
3 -74.800sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens GN=PGAM2 PE=1 SV=3  ali follow..  28  3THRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDMEFDICYTSVLKRAIRTLWAILDLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPTCESLKDTIARALPFWNEEIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKFLGD 235
4 -74.700sp|P18669|PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens GN=PGAM1 PE=1 SV=2  ali follow..  24  3AYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRGYEFDICFTSVQKRAIRTLWTVLDLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPSCESLKDTIARALPFWNEEIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQ. 231
5 -69.100sp|Q9NQ88|TIGAR_HUMAN Probable fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens GN=TIGAR PE=1 SV=1  ali follow..  24  3RFALTVVRHGETRFNKEKIIQGQVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGIKDMTVKYDSRLRERKYGVVEGKALSELRAMAKA----AREECPVFTPPGGETLDQVKMRGIDFFEFLLKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAY 201
6 -61.700sp|Q96HS1|PGAM5_HUMAN(removed signalp:1-19) Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2  ali follow..  19  78TRHIFLIRHSQYHVDG----SLEKDRTLTPLGREQAELTGLRLAGLKFNKIVHSSMTRAIETTDIISPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDG--------ARIEAAFRNYIHRADAR----QEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRNGRVALRTLGD 258
7 -56.900sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6  ali follow..  23  249PRSIYLCRHGESELNLKGRIGG--DPGLSPRGREFAKSLAQFISDQNIKKVWTSQMKRTIQTAEAL-GVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMEL-ERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTVLKLTPVAYGCKVESIF. 436
8 -55.500sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2  ali follow..  22  249PRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESL-GVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMEL-ERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIK. 436
9 -55.200sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3  ali follow..  22  251PRSIYLCRHGESELNIRGRIGG--DSGLSVRGKQYAYALANFIQSQGISKVWTSHMKRTIQTAEAL-GVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMEL-ERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCKVESIY. 438
10 -55.200sp|Q8TF42|UBS3B_HUMAN Ubiquitin-associated and SH3 domain-containing protein B OS=Homo sapiens GN=UBASH3B PE=1 SV=2 (Range: 301-600)  ali follow..  19  83KRCLFVCRHGERPQRSGGFRDYEKDAPITVFGCMQARLVGEALLNTIIDHVYCSPSLRCVQTAHNILKLKIRVEPGLFEWTKWVAGSIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFV....................... 299
11 -54.300sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1  ali follow..  23  246PRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEAL-RLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMEL-ERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIY. 433
12 -52.500sp|P57075|UBS3A_HUMAN Ubiquitin-associated and SH3 domain-containing protein A OS=Homo sapiens GN=UBASH3A PE=1 SV=1 (Range: 451-661)  ali follow..  22  2..........................PLSSCGIFQSRIAGDALLGIRISSVFASPALRCVQTAKLILEIKIRVEPGIFEWTKWEAGKMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFKIPSLGMCFCEENKEEGKWELVNP 189
13 -50.200sp|P57075|UBS3A_HUMAN Ubiquitin-associated and SH3 domain-containing protein A OS=Homo sapiens GN=UBASH3A PE=1 SV=1 (Range: 301-600)  ali follow..  24  95RKSVLVVRHGERPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLGIRISSVFASPALRCVQTAKLILEKKIKIRVEPGIFEWTKWEAMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIPQDTGVILIVSHGSTLDSCTRPLL.................................. 300
14 -43.200sp|Q8TF42|UBS3B_HUMAN Ubiquitin-associated and SH3 domain-containing protein B OS=Homo sapiens GN=UBASH3B PE=1 SV=2 (Range: 451-649)  ali follow..  17  5.......................................ALLESNTIIDHVYCSPSLRCVQTAHNILKLKIRVEPGLFEWTKWVAGSIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFKIPYLGFCSCEELGETGIWQLTDP 177

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 9 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.