current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15895079|ref|NP_348428.1| ribosome-binding factor A (CA_C1803) [Clostridium acetobutylicum ATCC 824] (Range: 1-121), from C.acetobutylicum

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MAKYRAGRINEEVKKAISSIIQNDIRDPRLTSMISVIKVDVTKDLRYAKAYVSILGDEAKKKETMDILKKSESFIRKELGYAVKLRYTPEVIIELDTSIEKGMHIDAILEKIKGSDKNDNRLast
1 -40.500sp|Q8N0V3|RBFAL_HUMAN Putative ribosome-binding factor A, mitochondrial OS=Homo sapiens GN=C18orf22 PE=1 SV=3  ali follow..  17  88EDHARLRALNGLLYKALTDLLCTPEVSQELYDLVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERD 209
2 -6.380sp|Q5JRX3|PREP_HUMAN Presequence protease, mitochondrial OS=Homo sapiens GN=PITRM1 PE=1 SV=2 (Range: 301-600)  ali follow..  96IVEKDIETVRSLIDRTIDEVVEKGFEDDRIEALLHKIEIQMKHQSTSFGLMLELLKLGNQLAKFRQCLQENPKFLQEKVKQKLTLSMRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQ.. 236
3 -5.870sp|Q9Y2L5|TPPC8_HUMAN Trafficking protein particle complex subunit 8 OS=Homo sapiens GN=TRAPPC8 PE=1 SV=2 (Range: 151-450)  ali follow..  190LTLTDHDRIRQFIQEFTFRGLL-----PHIEKTIRQLNDQLISRKGLSRSLFSAFSGSKVPEKSINDLKNTSGLLYPPEAPELQIRKMADLCFLVQH-YDLAYSCYHTAKK.......... 298
4 -5.810sp|O75923|DYSF_HUMAN Dysferlin OS=Homo sapiens GN=DYSF PE=1 SV=1 (Range: 1201-1500)  ali follow..  14  123......QNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVEC----------GGQTVQSCVIRNLRKNPNFDICTLFMEVMLLYCPPITVKVIDNRQFGRR................. 214
5 -5.790sp|Q9UDX5|MTP18_HUMAN Mitochondrial fission protein MTP18 OS=Homo sapiens GN=MTP18 PE=1 SV=1  ali follow..  14  67.PSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAAS-------------------LYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFL--LDSSLRKLYPTVGKPSS 165
6 -5.650sp|Q9Y2T1|AXN2_HUMAN Axin-2 OS=Homo sapiens GN=AXIN2 PE=1 SV=1 (Range: 451-750)  ali follow..  122..GSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGETPRAHLFTQDPAMNTLAQLEEACRRLAEVSKPPKQ 263
7 -5.620sp|P52732|KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens GN=KIF11 PE=1 SV=2 (Range: 901-1056)  ali follow..  13  7....................................................................TKLNCFLEQDLKLDIPTGTTPQ-SYLYPSTLVRTEPREHLLDQLKRKQPELL. 59
8 -5.520sp|P12259|FA5_HUMAN(removed signalp:1-28) Coagulation factor V OS=Homo sapiens GN=F5 PE=1 SV=4 (Range: 1951-2196)  ali follow..  146.......EIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQ---GVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFI................................. 223
9 -5.350sp|Q9HCE6|ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens GN=ARHGEF10L PE=1 SV=3 (Range: 1-300)  ali follow..  14  208.....LTRLKERYARTKRDILALRVGGRDMQELKHKYDCKMTQLMKAAK------GTKDGLEKTRMAVMRKVSFLHRK........................................... 275
10 -5.330sp|Q3LI66|KRA62_HUMAN Keratin-associated protein 6-2 OS=Homo sapiens GN=KRTAP6-2 PE=2 SV=1  ali follow..  10  3...............................................GSYYGNYYGDHGYGCCGYEGLGYGYGSLRCGYSSCCGYGHGYGSRFFCGCGYGCGS.................. 58

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 9 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.