current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15896898|ref|NP_350247.1| alpha/beta fold family hydrolase (CA_C3665) [Clostridium acetobutylicum ATCC 824] (Range: 1-265), from C.acetobutylicum

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MWGKIIMQKSVEIKSKSLTLRGVLHMPLEAREKLPIVVIYHGFCGNKMGPHFIFVKLARELEKLGIATIRFDFAGTGESDGEFVDMTFSNEVYDANVILDYVKTLEFVDKDRISILGFSMGGAIASVIAGDRKDEINTLCLWAPAGNMEQIILSDTYIGDKYDEIMEKGIYDVEGLLLGKKFLEDIKKVNIFDRASAYNKQSLIIHGTSDEIVPLSTSERYLEMYGENTSLELVEGANHIFEKNSWENRVIDLTKKYFSGKLVKFLast
1 -62.500sp|Q9NUJ1|ABHDA_HUMAN(removed signalp:1-21) Abhydrolase domain-containing protein 10, mitochondrial OS=Homo sapiens GN=ABHD10 PE=1 SV=1  ali follow..  18  13LLARIPQRAPRWLPARQKTSLSFLNRPDLPNGKSPGIIFIPGYLSYMNGTK--ALAIEEFCKSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDL------ADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDDIVPWHTSMQVADRVSTDVDVILRKHSDHRMREKADIQLLVYTIDDLIDK..... 279
2 -48.700sp|Q5JUR7|CM027_HUMAN Uncharacterized protein C13orf27 OS=Homo sapiens GN=C13orf27 PE=2 SV=1  ali follow..  15  1...MSHTEVKLKIPFGNKLLDAVCLVPNKSLT--YGIILTHGASGDMN--LPHLMSLASHLASHGFFCLRFTCKGLNIVHR----------IKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEDFVRGLICISYPLHHPKQ-----------------------------------QHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMSTNDVFKEINTQILFWIQEITEM. 222
3 -41.600sp|Q5VST6|F108B_HUMAN Abhydrolase domain-containing protein FAM108B1 OS=Homo sapiens GN=FAM108B1 PE=2 SV=1  ali follow..  19  73.............TSKGNRIACMFVRCSPNAK--YTLLFSHGNAVDLGQMSSFYIGLGSRI---NCNIFSYDYSGYGASSGKPTEKNL---YADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYE--SAAVILHSPLTSGMRVAFP-----------------------TKKTYCFD--AFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGH--NDVELYGQYLERLKQFVSQELVNL 288
4 -40.400sp|Q7L211|ABHDD_HUMAN(removed signalp:1-36) Abhydrolase domain-containing protein 13 OS=Homo sapiens GN=ABHD13 PE=1 SV=1  ali follow..  18  48.....IPHENIFIRTDGIRLNLLIRYTGDNSPYSPTIIYFHGNAGN----GHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGL---YLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMAST---------------LFSFFPMRYLPLWCYK-NKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSSRTKRLAIFPDGTH--NDTWQCQGYFTALEQFIKEVVKS. 285
5 -40.400sp|Q96GS6|F18A1_HUMAN Abhydrolase domain-containing protein FAM108A1 OS=Homo sapiens GN=FAM108A1 PE=2 SV=1  ali follow..  18  93.............SARGNRVSCMY---RCVPGARYTVLFSHGNAVDLGQMSSFYIGLGSRL---HCNIFSYDYSGYGASSGRPSERNL---YADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYE--CAAVVLHSPLTSGMRVAFP-----------------------TKKTYCFD--AFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGH--NDIELYSQYLERLRRFISQELPS. 307
6 -40.000sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 (Range: 451-732)  ali follow..  16  15IRVLQPPPEQENVQYAGLDFEAILLQPGSDKTQVPMVVMPHG--GPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNDVKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEA---GFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTPVRLLLYPKSTHALSEVEVESDSFMNAVLWLRTHLG.. 281
7 -39.900sp|Q6PCB6|F108C_HUMAN Abhydrolase domain-containing protein FAM108C1 OS=Homo sapiens GN=FAM108C1 PE=2 SV=2  ali follow..  19  114.............TARDNRLGCMFVRCAPSSR--YTLLFSHGNAVDLGQMCSFYIGLGSRI---NCNIFSYDYSGYGVSSGKPSEKNL---YADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYE--CAAVILHSPLMSGLRVAFPD----------------------TRKTYCFD--AFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWVEGAGH--NDIELYAQYLERLKQFISHELPN. 328
8 -38.200sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2  ali follow..  18  12.QSIPYQDLPHLVNADGQYLFCRYWKPTG--TPKALIFVSHGAG----EHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVDFHVFVRDVLQHVDSMQKDY--PGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKQDKTLKIYEGAYHVLHKEEVTNSVFHEINMWVSQRTAT. 296
9 -37.900sp|Q7Z5M8|AB12B_HUMAN Abhydrolase domain-containing protein 12B OS=Homo sapiens GN=ABHD12B PE=2 SV=1  ali follow..  17  94.....PHTVNFYLRVPGVMLGIWHTVPSCLRDGNPIIVYLHGSAEHRAASHR--LKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGL---TTDAICVYEWTKAR--SGITPVCLWGHSLGTGVATNAAKVLEEKVDAIVLEAPFTNMWVAS-------INYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRVIFPPGFQH--NLLCKSPTLLITVRDFLSKQWS.. 362
10 -37.200sp|Q86WA6|BPHL_HUMAN(removed signalp:1-25) Valacyclovir hydrolase OS=Homo sapiens GN=BPHL PE=1 SV=1  ali follow..  18  13...........SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGS---GETDFGPQLKNLNKKLFTVVAWDPRGYGHSDRDFPADFFERDAKDAVDLMKALK-------KKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHV-KGSRLHLMPEGKH-NLHLRFADEFNKLAEDFLQ...... 266
11 -35.900sp|Q8N2K0|ABD12_HUMAN Monoacylglycerol lipase ABHD12 OS=Homo sapiens GN=ABHD12 PE=2 SV=2  ali follow..  17  125.......TCNYYLQPEDVTIGVWHTVPAVLASSHPIILYLHGNAGTRGGDHR--VELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGM---TYDALHVFDWIKAR--SGDNPVYIWGHSLGTGVATNLVRRLCERPDALILESPFTNIREEA-------KSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKGYRH--KYIYKSPELPRILREFLGKSEPE. 395
12 -34.800sp|Q9BV23|ABHD6_HUMAN(removed signalp:1-34) Monoacylglycerol lipase ABHD6 OS=Homo sapiens GN=ABHD6 PE=2 SV=1  ali follow..  17  7YWRRTLGMQVRYVHHEDYQFC---YSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPK-----NLHLVCVDMPGHEGTTRS-DDLSIDGQVKRIHQFVECLK----LNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGEMSEMLQLCSYVRFKVPQQILQGLVDVR--KLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSI-ANCQVELLENCGH-SVVMERPRKTAKLIIDFLAS..... 292
13 -34.600sp|Q96I13|ABHD8_HUMAN Abhydrolase domain-containing protein 8 OS=Homo sapiens GN=ABHD8 PE=2 SV=1  ali follow..  15  144...SGGRRRRARRPKRTIHIDCERITSCKGAQADVVLFFIHGVGGSLA----IWKEQLDFFVRLGYEVVAPDLAGHGASSAVAAAYTFYALAEDMRAIFKRY------AKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEIL-LLAFLKLIDEGSH-MVMLECPETVNTLLHEFLLWE.... 419
14 -34.500sp|Q86TI2|DPP9_HUMAN Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3 (Range: 601-863)  ali follow..  17  15.............TRSDVRLYGMIYKPHQPGKKHPTVLFVYGGPQVQNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQEIEDQVEGLQFVEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHG-------------YEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLGKPYQLQIYPNERHSIRCPESGEHYEVTLLHFLQEYL... 263
15 -33.800sp|Q9H3Z7|CT135_HUMAN(removed signalp:1-20) Uncharacterized protein C20orf135 OS=Homo sapiens GN=C20orf135 PE=2 SV=1  ali follow..  13  121........RRAKLVADGNEIDTMFQHPGSHVHGPRLVICCEGNAGFYE------MGCLSAPLEAGYSVLGWNHPGFGSSTGVPFPQHD---ANAMDVVVEYALHRLHFPPAHLVVYGWSVGGFTATWATMTYPE-LGALVLDATFDDLVPLALK---------------VMPHSWKGLVVRTVREHFNLNVAEQLCCYPGPVLLLRRTQDDVVSTSGRLRPLSPGDVEGN-ELLLRLLEHRYPVVMAREGRAVVTRWLRAGSLA. 358
16 -33.800sp|O95870|BAT5_HUMAN Protein BAT5 OS=Homo sapiens GN=BAT5 PE=1 SV=3  ali follow..  14  251........RRAKLLADGNEIDTMFRRGTAEPQGQKLVICCEGNAGFYE------VGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNE---ANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPD-VSAMILDASFDDLVPLALK---------------VMPDSWRGLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRV----MAEEGLRVVRQWLEA..... 476
17 -33.400sp|Q6V1X1|DPP8_HUMAN Dipeptidyl peptidase 8 OS=Homo sapiens GN=DPP8 PE=1 SV=1 (Range: 601-898)  ali follow..  18  41..............TTGFTLYGMLYKPHQPGKKYPTVLFIYGGPQVQLVNNRFKGVKLNTLASLGYVVVVIDNRGSCHRGLKFEGAFKYKEIDDQVEGLQYLASRDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQG-------------YYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAHTSILLSFLGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGS. 290
18 -32.300sp|P27487|DPP4_HUMAN(removed signalp:1-28) Dipeptidyl peptidase 4 OS=Homo sapiens GN=DPP4 PE=1 SV=2 (Range: 451-738)  ali follow..  15  33......SKKLDFIILNETKFWYQMILPPDKSKKYPLLLDVYAGPCSQKADTVFRLNWATYLSTENIIVASFDGRGSGYQGDKIMHAINRREVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSR-----------WEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVE--YLLIHGTADDNVHFQQSAQISKALVDVGQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCF... 285
19 -32.200sp|Q5EB52|MEST_HUMAN(removed signalp:1-26) Mesoderm-specific transcript homolog protein OS=Homo sapiens GN=MEST PE=1 SV=2  ali follow..  14  15...HSWKSSGKFFTYKGLRIF--YQDSVGVVGSPEIVVLLHGFPTS----SYDWYKIWEGLTLRFHRVIALDFLGFGFSDKP-HHYSIFEQASIVEALLRHL----GLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDSLLQYINQRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTLPRSTVSILDHISH-YPQLEDPMGFLNAYMGFINS..... 308
20 -31.500sp|P42658|DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens GN=DPP6 PE=1 SV=2 (Range: 601-865)  ali follow..  15  2...............DDYNLPMQILKPATDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMSSHGAVVVKCDGRGSGFQGTKLLHEVRRREEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYIGENQGQTFTCGSALSPITDFK----------------LYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEQQFLIIHPTADEKIHFQHTAELITQLKANYSLQIYPDESHYFTSSSLKQHLYRSIINFFVECFR.. 248
21 -31.300sp|Q12884|SEPR_HUMAN(removed signalp:1-23) Seprase OS=Homo sapiens GN=FAP PE=1 SV=5 (Range: 451-737)  ali follow..  16  32......KEEIKKLEVDEITLWYKMILPPDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLSKEGMVIALVDGRGTAFQGDKLLYAVYRKEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSS-----------WEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVD--YLLIHGTADDNVHFQNSAQIAKALVNAQQAMWYSDQNHGLSGLS-TNHLYTHMTHFLKQCFS.. 284
22 -30.200sp|Q8TB40|ABHD4_HUMAN Abhydrolase domain-containing protein 4 OS=Homo sapiens GN=ABHD4 PE=2 SV=1  ali follow..  13  36LQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDR-TPLVMVHGFGGGVGLWILNMDSLSA-----RRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRET--MGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARLIRKDVPITMIYGSDT--IDTSTGKKVKMQRDSYVRDMEIKGASH-HVYADQPHIFNAVVEEICDS..... 340
23 -29.900sp|Q8WTS1|ABHD5_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Homo sapiens GN=ABHD5 PE=1 SV=1  ali follow..  14  48...CTYKKEPVRI-SNGNKIWTLKFSHNISNK--TPLVLLHGFGGGLGLWALNFGDLCT-----NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCA--LGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGH-YVYADQPEEFNQKVKEICDT..... 347
24 -29.400sp|Q9BUJ0|ABHEA_HUMAN(removed signalp:1-15) Abhydrolase domain-containing protein 14A OS=Homo sapiens GN=ABHD14A PE=2 SV=2  ali follow..  14  47LWGDPNVTVLAGLTPGNSPIF-YREVLPLNQAHRVEVVLLHGKAFNSHT-----LGTLQLLSQRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALRDL------EVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTS----------------------------------------TQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHL--PNHSVVKLRNAGHA-CYLHKPQDFHLVLLAFLDH..... 254
25 -29.400sp|Q9NZD8|SPG21_HUMAN Maspardin OS=Homo sapiens GN=SPG21 PE=1 SV=1  ali follow..  10  1MGEIKVSPDYNWFRGDSKIWS---LYDAGPRSIRCPLIFLPPVSGTAD----VFFRQILALTGWGYRVIALQYPVYW---------DHLEFCDGFRKLLDHL------QLDKVHLFGASLGGFLAQKFAEHKSPRVHSLILCNSFSDTSIFLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLY-PNARRAHLKTGGN-FPYLCRSAEVNLYVQIHLLQ..... 275
26 -29.200sp|Q9H6V9|CB043_HUMAN UPF0554 protein C2orf43 OS=Homo sapiens GN=C2orf43 PE=1 SV=1  ali follow..  10  6.......KEEIPVHEEFILCGGALFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSLT-NRRFPVWTISHAGHALAPKD-DIYGLNGQIEHKLAFLRTHVP----KDMKLVLIGHSIGSYFTLQMLKRVPEPVIRAFLLFPTIEIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRD-DETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAF--THFNQEMADMIADSLKDDLSKM 325
27 -29.000sp|Q9ULP0|NDRG4_HUMAN Protein NDRG4 OS=Homo sapiens GN=NDRG4 PE=2 SV=2  ali follow..  11  1MPECWDGEHDIETPYGLLHV----VIRGSPKGNRPAILTYHDVGLNHKFNTFFNFEDMQEITKH-FVVCHVDAPGQQVGAQGYQFPSMEQLAAMLPSVVQHFG-------KYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSVNNTELVQSYRQQIGNVGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDP-TTTTFLKMADSGG-LPQVTQPGKLTEAFKYFLQG..... 285
28 -28.600sp|Q9Y570|PPME1_HUMAN Protein phosphatase methylesterase 1 OS=Homo sapiens GN=PPME1 PE=1 SV=3  ali follow..  12  51...ESMEDVEVENETGKDTFRVY-----KSGSEGPVLLLLHGGGHSALSWAVFTAAIIS---RVQCRIVALDLRSHGETKVK-EDLSAETMAKDVGNVVEAMYGD---LPPPIMLIGHSMGGAIAVHTASSNLVPSLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESAGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQ----GKFQMQVLPQCGH-AVHEDAPDKVAEAVATFLIRH.... 370
29 -28.300sp|Q8N9L9|ACOT4_HUMAN Acyl-coenzyme A thioesterase 4 OS=Homo sapiens GN=ACOT4 PE=1 SV=2  ali follow..  14  125HERHFLPPGVRRQSVRAGRVRATLFLPPG-PGPFPGIIDIFGIGGGLLEYR------ASLLAGHGFATLALAYYNFEDLPNNMDNISL----EYFEEAVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPSIEKAQGPILLIVGQDDHNWRSELSERLQAHGKEKPQIICYPGTGHYIAHSKAQEDAWKQILAFFCKHLGG. 412
30 -28.200sp|P49753|ACOT2_HUMAN Acyl-coenzyme A thioesterase 2, mitochondrial OS=Homo sapiens GN=ACOT2 PE=1 SV=6  ali follow..  13  206...................VRGTLFLPPE-PGPFPGIVDMFGTGGG------LLEYRASLLAGKGFAVMALAYYNYEDLPKTMETL----HLEYFEEAMNYLLSHPEVKGPGVGLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLHYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSVERAESTFLFLVGQDDHNWKSEFCKRLQAHGRRKPQIICYPETGHYIAHAMAQVDAWKQLQTFFHKHL... 472
31 -28.100sp|Q9UGV2|NDRG3_HUMAN Protein NDRG3 OS=Homo sapiens GN=NDRG3 PE=1 SV=2  ali follow..  11  23RNFQDFDCQEHDIETTHGVVHVTIRGLPKGNR--PVILTYHDIGLNHKFNAFFNFEDMQEITQH-FAVCHVDAPGQQEGATGYQYPTMDELAEMLPPVLTHLS-------KSIIGIGVGAGAYILSRFALNHPELVEGLVLINVDPCAKDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNP-INTTLLKMADCGG-LPQVVQPGKLTEAFKYFLQG..... 312
32 -28.000sp|Q3I5F7|ACOT6_HUMAN Putative acyl-coenzyme A thioesterase 6 OS=Homo sapiens GN=ACOT6 PE=1 SV=1  ali follow..  15  1.....................................................................................................MLQHPKVKGPSIALLGFSKGGDLCLSMASFLKGITATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASERKERPQIICYPETGHCIDHSKAQVDAWQQIQTFFHKHLNG. 198
33 -28.000sp|Q9H4I8|SEHL2_HUMAN Serine hydrolase-like protein 2 OS=Homo sapiens GN=SERHL2 PE=2 SV=1  ali follow..  14  1MSENAAPGSELKLAVPWGHIAAK----AWGSLQGPPVLCLHGWLDN----ASSFDRLIPLLPQ-DFYYVAMDFGGHGLSSSPGVPYYLQTFVSEIRRVVAALK-------NRFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTPFSLKQLLQRLLKSNSHLSEECGELLLQRGTTKVATGLVDFISRELCAHSIRKLQAHVLLIKAVHGYFDSRQNYSEMKSTLKEQFQFVEVPGNHCV--HMSEPQHVASIISSFLQCT.... 307
34 -28.000sp|Q9UN36|NDRG2_HUMAN Protein NDRG2 OS=Homo sapiens GN=NDRG2 PE=1 SV=2  ali follow..  11  39........QTHSVETPYGSVT--FTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFMQEIIQN-FVRVHVDAPGMEEGALGYQYPSLDQLADMIPCVLQYLN-------STIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDP-TQTSFLKMADSGG-QPQLTQPGKLTEAFKYFLQG..... 313
35 -27.900sp|Q8N608|DPP10_HUMAN Inactive dipeptidyl peptidase 10 OS=Homo sapiens GN=DPP10 PE=1 SV=2 (Range: 451-750)  ali follow..  18  82......KPEIKILHIDDYELPLQLSLPKMDRNQYALLLIMDEEPGGQLVTDKFHIDWDSVLDMDNVIVARFDGRGSGFQGLKILQEIHRREVKDQITAVKFLLKLPYIDSKRLSIFGKGYGGYIASMILKSDEKLFKCGSVVAPITDLK----------------LYASAFSERYLGMPSKEESTYQAASVLHNVHGLKENILIIHGTADTKVHFQHSAELIKHLIKA..................................... 295
36 -27.800sp|Q96IU4|ABHEB_HUMAN Abhydrolase domain-containing protein 14B OS=Homo sapiens GN=ABHD14B PE=1 SV=1  ali follow..  13  2..AASVEQREGTIQVQGQALF-FREALPGSGQARFSVLLLHGIRFSSET-----LGTLHRLAQAGYRAVAIDLPGLGHSKAAPAPIGELAPGSFLAAVVDAL------ELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPIC----------------------------------------TDKINAANYASVKTPALIVYGDQDPMGQTSFEH----KQLPNHRVLIMKGAGHP-CYLDKPEEWHTGLLDFLQG..... 208
37 -27.800sp|Q8IUS5|EPHX4_HUMAN(removed signalp:1-26) Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2  ali follow..  15  46........CYVRIKDSGLRF----HYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKS-----EYRVVALDLRGYGETDIHRQNYKLDCLITDIKDILDSL------GYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIVINFPSHSTGIGRKGCQLTTEDLEAYIYVFSQPGALSGPINHYRNIFSCLPLKH-HMVTTPTLLLWGENDAFMEVEMAEVTKIYVKNYFRLTILSEASH-WLQQDQPDIVNKLIWTFLKEETRK. 334
38 -27.600sp|Q92597|NDRG1_HUMAN Protein NDRG1 OS=Homo sapiens GN=NDRG1 PE=1 SV=1  ali follow..  11  33........QEQDIETLHGSVH--VTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYMQEITQH-FAVCHVDAPGQQDGAAGYMYPSMDQLAEMLPGVLQQF------GLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDP-TKTTLLKMADCGG-LPQISQPAKLAEAFKYFVQG..... 311
39 -27.100sp|Q86TX2|ACOT1_HUMAN Acyl-coenzyme A thioesterase 1 OS=Homo sapiens GN=ACOT1 PE=1 SV=1  ali follow..  13  144...................VRGTLFLPPE-PGPFPGIVDMFGTGGG------LLEYRASLLAGKGFAVMALAYYNYEDLPKTMETLHL----EYFEEAVNYLLSHPEVKGPGVGLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSVERAESTFLFLVGQDDHNWKSEFCKRLQAHGRRKPQIICYPETGHYIEHAMAQVDAWKQLQTFFHKHL... 410
40 -26.600sp|Q9P2N6|K1310_HUMAN Uncharacterized protein KIAA1310 OS=Homo sapiens GN=KIAA1310 PE=1 SV=2 (Range: 151-450)  ali follow..  11  116............................SKLPGSPLILIASS-SSSVFPTSRRHRFWQSQLSCLGVIPVATHLLNNGSGVGVLQ--CLEHMIGAVRSKVLEIHSH--FPHKPIILIGWNTGALVACHVSVM--EYVTAVVCLGFPLLTVD------------------------------------PRGDVDDPLLDMKTPVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKS............... 298
41 -26.600sp|Q9H6B9|EPHX3_HUMAN(removed signalp:1-36) Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1  ali follow..  13  40........GFLNLKSSGLRL----HYVSAGRGNGPLMLFLHGFPENWFSWRYQLREFQS-----RFHVVAVDLRGYGPSDRDVDCYTIDLLLVDIKDVILGL------GYSKCILVAHDWGALLAWHFSIYYPSLVERMVVVSGAPMLTHRKTGIPCLTPSELEAFLYNFSQPGGLTGPLNYYRNLFR-NFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSFVPGRLEAHILPGIGH-WIPQSNPQEMHQYMWAFLQDLL... 323
42 -26.300sp|Q96DG6|CMBL_HUMAN Carboxymethylenebutenolidase homolog OS=Homo sapiens GN=CMBL PE=1 SV=1  ali follow..  13  30...................IKAYVTKSPVDAG--KAVIVIQDIFGWQLPN---TRYIADMISGNGYTTIVPDFVGQEPWDPSLKTRNAQKIDREISAILKYLKQQCHA--QKIGIVGFCWGGTAVHHLMMKYSEFRAGVSVYGIVKDSED--------------------------------------------IYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEEYQIKTFSGQTHGFVDKPYIDEARRNLIEWLNKYM... 245
43 -26.200sp|Q9P2N6|K1310_HUMAN Uncharacterized protein KIAA1310 OS=Homo sapiens GN=KIAA1310 PE=1 SV=2 (Range: 301-600)  ali follow..  11  5.................................................................VIPVATHLLNNGSGVGVLQ--CLEHMIGAVRSKVLEIHSH--FPHKPIILIGWNTGALVACHVSVMEY--VTAVVCLGFPLLTV-----------------------------------DGPRGDVDDPLLDMKTPVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLTQSMVDRCIQDEIVDFLTGVLTR. 174
44 -26.100sp|Q8N608|DPP10_HUMAN Inactive dipeptidyl peptidase 10 OS=Homo sapiens GN=DPP10 PE=1 SV=2 (Range: 601-796)  ali follow..  20  2.........................................................................RGSGFQGLKILQEIHRREVKDQITAVKFLLKLPYIDSKRLSIFGKGYGGYIASMILKSDEKLFKCGSVVAPITDLK----------------LYASAFSERYLGMPSKEESTYQAASVLHNVHGLKENILIIHGTADTKVHFQHSAELIKHLGVNYTMQVYPDEGHNVSEKS-KYHLYSTILKFFSDCLKE. 183
45 -26.000sp|Q8NFV4|ABHDB_HUMAN(removed signalp:1-16) Abhydrolase domain-containing protein 11 OS=Homo sapiens GN=ABHD11 PE=1 SV=1  ali follow..  18  45............................DGEAALPAVVFLHGLFGSKTN----FNSIAKILAQQGRRVLTVDARNHGDSPHS-PDMSYEIMSQDLQDLLP------QLGLVPCVVVGHSMGGKTAMLLALQRPELVERLIAISPVESTGVNIADELPRSRARKLADEQLSSVIQDMAVRQHLLTNLVEVD--QRQESYLGPTLFLLGGNSQFVHPSHHPEIMRLF-PRAQMQTVPNAGH-WIHADRPQDFIAAIRGFL....... 298
46 -25.200sp|Q14032|BAAT_HUMAN Bile acid-CoA:amino acid N-acyltransferase OS=Homo sapiens GN=BAAT PE=1 SV=1  ali follow..  14  128LERWYVAPGVTRIKVREGRLRGALFLPPG-EGLFPGVIDLFGGLGGLLE------FRASLLASRGFASLALAYHNYEDLPRKPEVTDL----EYFEEAANFLLRHPKVFGSGVGVVSVCQGVQIGLSMAIYLKQVTATVLINGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFEEAQGQFLFIVGEGDKTINSKAIGQLKRHGKNNWTLLSYPGAGHLIPHAAAQEHAWKEIQRFLRKHL... 410
47 -25.100sp|O95372|LYPA2_HUMAN Acyl-protein thioesterase 2 OS=Homo sapiens GN=LYPLA2 PE=1 SV=1  ali follow..  14  1..........MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHS----WADALSTIRLPHVKYI-FDLMGLSPDAPE-DEAGIKKAAENIKALIEHEMKNG-IPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSC-------------------------------------WLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSRVQFKTYPGVMHSSCPQE-----MAAVKEFLEKLL... 228
48 -24.800sp|Q9NQF3|SERHL_HUMAN Serine hydrolase-like protein OS=Homo sapiens GN=SERHL PE=2 SV=1  ali follow..  20  1MAENAAPGSELKLAVPWGHIAAK----AWGSLQGPPVLCLHGWLDN----ASSFDRLIPLLPQ-DFYYVAMDFGGHGLSSSPGVPYYLQTFVSEIRRVVAALK-------NRFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTP........................................................................................................................ 134
49 -24.700sp|Q63HM1|AFMID_HUMAN Probable arylformamidase OS=Homo sapiens GN=AFMID PE=2 SV=2  ali follow..  14  78.......................IYFPDESSEALPFFLFFHG----QSGSKDESAFMVHPLTAQGVAVVIVAYG--------APKGTLDHMVDQVTRSVAFVQKRYP-SNKGIYLCGHSAGAHLAAMMLLADTPNLRGFFLVSGVFDLEPIVYTSQNVALQLTL-------------------EDAQRNSPQLKVAQ-TCRVLVVVGQFDSPEFHRQSWEFYQTLCQKASFEELHDVDH-FEIVENLTQKDNVLTQIILKTIFQ. 303
50 -24.700sp|O75608|LYPA1_HUMAN Acyl-protein thioesterase 1 OS=Homo sapiens GN=LYPLA1 PE=1 SV=1  ali follow..  17  15...........................PAARKATAAVIFLHGLGDTGHG----WAEAFAGIRSSHIKYI-FDIIGLSPDSQE-DESGIKQAAENIKALIDQEVKNG-IPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDI------------------------------------SILQCHGDCDPLVPLMFGSLTVEKLKTNVTFKTYEGMMHSSCQQE-----MMDVKQFIDKLL... 226
51 -24.400sp|Q5VWZ2|LYPL1_HUMAN Lysophospholipase-like protein 1 OS=Homo sapiens GN=LYPLAL1 PE=1 SV=3  ali follow..  17  15...........................SPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQTPMKGGIS--FDRFKITNDCPE-HLESIDVMCQVLTDLIDEEVKSG-IKKNRILIGGFSMGGCMAIHLAYRNHQDVAGVFALSSFLNKASAVYQA------------------------------------LQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSTTKFHSFPNVYHELSKTE-----LDILKLWILTKL... 229
52 -24.300sp|Q13093|PAFA_HUMAN(removed signalp:1-21) Platelet-activating factor acetylhydrolase OS=Homo sapiens GN=PLA2G7 PE=1 SV=1  ali follow..  12  105...............GSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRT----LYSAIGIDLASHGFIVAAVEHRDRSEEETHIRNEQVRQRAKECSQALSLILDKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVY------------------------------------------SRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHDIDSNVAIDLSNKASLAFLQKHLG.. 376
53 -24.100sp|Q0P651|CD029_HUMAN(removed signalp:1-24) Uncharacterized protein C4orf29 OS=Homo sapiens GN=C4orf29 PE=1 SV=1  ali follow..  10  61............MPIESVIARFQFIVPKENSKYRPVCIHLAGTGDHHYWRRRTLM-ARPMIKEARMASLLLENPYYGCRKPKDQVVMGGALVLESAALLHWLERE---GYGPLGMTGISMGGHMASLAVS-NWPKPMPLIPCLSWSTASGVFTTTDSFKMGPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPIIVVQAKEDAYIPRTGVRSLQEIW-PGCEIRYLEG-GH--------------ISAYLFKQ.... 386
54 -24.100sp|P10768|ESTD_HUMAN S-formylglutathione hydrolase OS=Homo sapiens GN=ESD PE=1 SV=2  ali follow..  14  11CFGGLQKVFEHDSVELNCKMKFAVYLPPKETGKCPALYWLSGLTCTEQN--ISKSGYHQSASEHGLVVIAPDTSDFGTGAGFYVDATEDPWKTNTEELPQLINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGT--------------DQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLIAACTEKKIPVVFRLQEGYDHSYY-----ATFITDHIRHHAKYLNA. 282
55 -23.500sp|P34913|HYES_HUMAN(removed signalp:1-24) Epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2  ali follow..  11  207......SCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFP----ESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAEIEEYCMEVLCKEMVTFLDKL------GLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFFYVQQFKKSGFRGPLNWYRNMEKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWI-PHLKRGHIEDCGH-WTQMDKPTEVNQILIKWLDSDARN. 524
56 -23.300sp|Q8WU67|ABHD3_HUMAN Abhydrolase domain-containing protein 3 OS=Homo sapiens GN=ABHD3 PE=2 SV=2  ali follow..  12  106....QYRNELIKTADGGQ-FDNDNSTCYMDASTRPTILLLPGLTGTSKESY--ILHMIHLSEELGYRCVVFNNRGVAGENLLTPRTYCCANTEDLETVIHHVHSL--YPSAPFLAAGVSMGGMLLLNYLGKIGSKLMAAATFSVGWNTFACSEDHVMKAKSIREFDKRFTSVMFGYQTIDDYYTDA---SPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAKQNPNVALVLTSYGGHI----GFLEGIWPRQSTYMDRVFKQF 397
57 -23.200sp|Q6UXT9|ABH15_HUMAN(removed signalp:1-23) Abhydrolase domain-containing protein 15 OS=Homo sapiens GN=ABHD15 PE=2 SV=2  ali follow..  10  98....ELAREYLQLADDGLVALDWVVGPCTSAGGLPAVLLVIPNAWGRLTRN--VLGLCLLALERGYYPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFR---PAAPLFAVSEGSGSALLLSYLGECGSSVTGAACISPVLRCREWFESRLFRSRSLREFEEALFCHTKSFPISWDTY--WDRNDPLRDVDEAAVPVLCICSADDPVCGPPDHTLTTELFHSNPYFFLLRHGGHCLRQEPLPAWSHEVILESFRALTE.. 394
58 -23.100sp|Q96SE0|ABHD1_HUMAN(removed signalp:1-34) Abhydrolase domain-containing protein 1 OS=Homo sapiens GN=ABHD1 PE=2 SV=2  ali follow..  11  55....LYQSDILQTPDGGQLLLDWAKQPDSSQTTQPIVLLLPGITGSSQDTY--VLHLVNQALRDGYQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHR--YPQAPLLAVGISFGGILVLNHLAQARQALVAALTLSACWDSFETTRDFVLQARTIRQFDERYTSVAFGYQDCVTYYKAA---SPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVALLITARGGHI----GFLEGLLPWQHWYMSRLLHQY 346
59 -22.300sp|Q9UMR5|PPT2_HUMAN(removed signalp:1-27) Lysosomal thioesterase PPT2 OS=Homo sapiens GN=PPT2 PE=1 SV=4  ali follow..  12  2..........................PAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHP--GTVVTVLDLFDGRES--------LRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDNVDSFISLSSPRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFVLIGGPDDGVITPWQSSFFLKTLLARGAIVRMAGISH-TAWHSNRTLYETCIEPWLS...... 275
60 -21.900sp|P08910|ABHD2_HUMAN Abhydrolase domain-containing protein 2 OS=Homo sapiens GN=ABHD2 PE=2 SV=1  ali follow..  11  95....YGHRKFITMSDGASTFDLFEPLAEHCVGDDITMVICPGIANHSEKQY--IRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFYGCTWEFGAMVNYIKKT--YPLTQLVVVGFSLGGNIVCKYLGETQANVLCCVSVCQGYSALRAQESRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEE---SCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLHGGHL-----EGSVLFPEPLTWMDKLVVEY 400
61 -21.800sp|Q99487|PAFA2_HUMAN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Homo sapiens GN=PAFAH2 PE=1 SV=1  ali follow..  11  95...........................KTKDSGYPLIIFSHGLGAFRT----LYSAFCMELASRGFVVAVPEHRDRSEKEFHVRNPQVHQRVSECLRVLKILQEKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFY------------------------------------------PKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHSLDPYEGQEVMVRAMLAFLQKHLD.. 362
62 -21.600sp|Q6P2H8|TMM53_HUMAN Transmembrane protein 53 OS=Homo sapiens GN=TMEM53 PE=2 SV=1  ali follow..  11  1MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKN---LAKYSAIYHKRGCIVIRYTAPWHM-----FSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLYRYVLELRLRVVGTIFDSAPGDSNLVGALRALAAILERRAAMLRLLLLVAFALVVVLFHVLLAPITALFHTHFRWPELYLYSRADEVVLARDIERMVEARLALARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC. 277
63 -21.500sp|Q4J6C6|PPCEL_HUMAN Prolyl endopeptidase-like OS=Homo sapiens GN=PREPL PE=1 SV=1 (Range: 451-727)  ali follow..  16  1..............KDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKMNFRPERRVLVDDGWILAYCHVRGGGELGLQWHATKKLNGLADLEACIKTLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTL------PLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPIHITAYENDERVPLKGIVSYTEKLKEAIALDIQPGGNHVIEDSHKK---ITAQIKFLYEEL... 260
64 -21.400sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 (Range: 301-600)  ali follow..  20  172.......PEQENVQYAGLDFEAILLQPGSDKTQVPMVVMPHG--GPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNDVKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQY..................................................................................................................................... 300
65 -20.200sp|O75884|RBBP9_HUMAN Putative hydrolase RBBP9 OS=Homo sapiens GN=RBBP9 PE=1 SV=2  ali follow..  15  2...............................ASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKPGFQCLAKNMP-------DPITARESIWLPFMETELHC--------DEKTIIIGHSSGAIAAMRYAETHR--VYAIVLVSAYTSDLGDENERASGYFTRP----------------------------WEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLE--TKLHKFTDCGH---QNTEFHELITVVKSLLKV..... 184
66 -20.200sp|P42658|DPP6_HUMAN Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens GN=DPP6 PE=1 SV=2 (Range: 451-750)  ali follow..  14  143......KVEYRDIEIDDYNLPMQILKPATDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMSSHGAVVVKCDGRGSGFQGTKLLHEVRRREEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGENQGQTSALSPITD...................................................................................................................... 294
67 -19.400sp|Q8WZ82|OVCA2_HUMAN Ovarian cancer-associated gene 2 protein OS=Homo sapiens GN=OVCA2 PE=1 SV=1  ali follow..  11  2.............................AAQRPLRVLCLAGFRQSERGFREKTGALRKALRGR----AELVCLSG-QEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQ-------------------------------RPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAI--TLTHSGGHFI---PAAAPQRQAYLKFLDQFAE.. 227
68 -19.200sp|Q86TI2|DPP9_HUMAN Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3 (Range: 451-750)  ali follow..  21  165.............TRSDVRLYGMIYKPHAPGKKHPTVLFVYGGPQVQNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQEIEDQVEGLQFVEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKV............................................................................................................................... 299
69 -18.600sp|P48147|PPCE_HUMAN Prolyl endopeptidase OS=Homo sapiens GN=PREP PE=1 SV=2 (Range: 451-710)  ali follow..  14  13..............................DGSHPAFLYGYGGFNISITPNYSVSRLI--VRHMGGILAVANIRGGGEYGETWHKGGIQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTD-----------GCSDSKQHFEWLVKYSPLHNVKLPEADMLLLTADHDDRVVPLHSLKFIATLQYIVGIHVDTKAGHGAGKPTAKVEEVSDMFAFIARCL... 254
70 -17.400sp|Q05469|LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens GN=LIPE PE=1 SV=4 (Range: 601-900)  ali follow..  10  14....QDSEELSSLIKSNGQRSLELWPRQQAPRSRSLIVHFHG-GGFVAQTSRSHEPYLKSWAQEGAPIISIDYS----------EAPFPRALEECFFAYCWAIKHCASTGERICLAGDSAGGNLCFTVALRAAAYPDGIMAAYPATMLQPAASPSRLLSLMDPLLPLSVLSKCVSAYAGAKTEDHSNSDQKALGMMGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQKMSEPIAEPMRSEAALAQPQGPLGTDSLKNLTLR. 277
71 -17.100sp|Q6P093|ADCL2_HUMAN(removed signalp:1-18) Arylacetamide deacetylase-like 2 OS=Homo sapiens GN=AADACL2 PE=2 SV=3  ali follow..  16  58......DEYITVTDTTFVDIPVRLYLPKRSETRRRAVIYFHG-----SSKQRAFDFLNRWTANTDAVVVGVDYR----------QHHFPAQFEDGLAAVKFFLLEKIVDPTRICIAGDSSGGNLATAVTQQVQNDIKMQVLLYPGLQITDSYLPSHRENEHGIVLTRDVAIKLVSLYFTKDGLTDSRALPLLANDSQLQNLTYILTCQHDLL-GLMYVTRL-RNVGVQVVHEHIEDGIHGAFYLRLGLRIRDMYVSWLDKNL... 383
72 -16.600sp|Q5VXI9|LIPN_HUMAN(removed signalp:1-18) Lipase member N OS=Homo sapiens GN=LIPN PE=2 SV=2  ali follow..  14  22IIYNGYPSEEYEVTTEDGYILLVNRIPARSTGPRPVVYMQHALFADNAYENYANGSLGFLLADAGYDVWMGNSRGNTWSDEKFWAFSFDE-KYDLPGVIDFIVNK--TGQEKLYFIGHSLGTTIGFVAFSTMPERIKMNFALGPTISFKYVYMSHAPTGSSVHNILHIKQLYHSDEFRAYDWGNDADNMKHYNQLTAMKVPTAIWAGGHDVLVTPQDVARILPQIKSLHYFKLLPDWNHFVWGLDAPQRMYSEIIALMKAY.... 379
73 -16.500sp|Q5W064|LIPJ_HUMAN Lipase member J OS=Homo sapiens GN=LIPJ PE=2 SV=3  ali follow..  14  7ISYWGYPDEEYDIVTEDGYILGLYRIPNKNLAQRVVVYLQHGLLTSASSSNLPNNSLGFILADAGYDVWMGNSRGNTWSSKEFWAFSFDE-KYDLPASIDFTVKQ--TRQEEIFYVGHSQGTTIGFITFSTISKRIKIFFALAPVFSTKYLYFSHNPAGTSVQNMLHWSQLLNSTHLKAYDWGSPDLNLVHYNQMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHILFGLDVYDQVYHEIIDIIQDNL... 366
74 -16.200sp|Q6PIU2|NCEH1_HUMAN(removed signalp:1-15) Neutral cholesterol ester hydrolase 1 OS=Homo sapiens GN=NCEH1 PE=1 SV=3  ali follow..  13  63.......AQVKVTDTDFDGVEVRVFEGPPEEPLKRSVVYIHG-----SAKIRYYDELCTAMAEENAVIVSIEYR----------KVYFPEQIHDVVRATKYFLKPEVVDPGRICISGDSAGGNLAAALGQQFTQDLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNMIVNNHTSLDVEEAAAVRAKTYILTCEHDVL-GIMYAKRL-ESAGVEVTLDHFEDGFHGCTNFSVGIRTRNSYIKWLDQNL... 393
75 -16.200sp|P07098|LIPG_HUMAN(removed signalp:1-19) Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1  ali follow..  15  20ITYWGYPNEEYEVVTEDGYILEVNRIPSGNTGQRPVVFLQHGLLASATNSNLPNNSLAFILADAGYDVWLGNSRGNTWASVEFWAFSFDE-KYDLPATIDFIVKK--TGQKQLHYVGHSQGTTIGFIAFSTNPSRIKTFYALAPVATVKYVYLSHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLIWAMDAPQEVYNDIVSMISED.... 377

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 9 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.