current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15894369|ref|NP_347718.1| Beta-glucosidase family protein (CA_C1084) [Clostridium acetobutylicum ATCC 824] (Range: 1-474), from C.acetobutylicum

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470
# Score Template Links and tools%idFirst MLSEFPKNFLWGASSAAYQVEGAWKEDGKGESVWDNFSKIPGKTFEGTNGDVAVDHYHRFKEDVALMAEMGLKAYRFSVSWSRIYPKGRGKVNLKGLEFYKNLVDELLKYNIEPVLTLYHWDLPQALQDLYGGFESRNVISDFENYCITLFKNFKDKVKYWITFNEQNVFTNLGYRCAVHPPGIKDIKKYYLANHIVNLANASAIKAFRKYVPNGKIGPSFGMGPVYSFDCKPENVLAGDEAEEYFNHWWLDVYCFGKYPTITLNRLEKLKVMPEITKEDLQLLREAKPDFIGLNYYHGGTVMANDNVIRENLDKKDPYLVENSEEDKGFKYISNPFLKKTEWNWEIDPQGLRIALRRLTNRYNLPILITENGIGAVDRLEEDERINDDYRIEYLKAHVLACKEAIDDGVQLIGYLPWSFTDLLSWLNGYKKRYGFVYINRDEHSQKDLRRIKKKSFYWYKDVIEKNSDNIYGRLast
1 -148.000PF00232.18; BGLC_BACSU/5-475; Glycosyl hydrolase family 1  ali follow..  61  2.PESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGEIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFYDSLIDELLSHHIEPVLTLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIGPSFAYSPAYPLSSHPEDILAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIEAGDMDLLAKGKPDFVGVNYYQTITYERNPLDGVSEGKMNTTGQKGTNQEPGVFKTKKNPHLTTSNWDWTIDPIGLRIGLRRITSRYQLPVFITENGLGEFDKVE-DGTVQDDYRIDYLRSHLEQCRQAISDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRLKKKSFYWYQDVIKTNGE..... 471
2 -14.500PF12876.7; W0IW86_9BACT/13-359; Sugar-binding cellulase-like  ali follow..  10  2...............................TMWD---------FSWLERRWPGAGYEDRDKALDGLVERGYDAVRIDAYPHLVAADPHREVHVRVMPALTEFICKCRERGLRVALSTWFQNDTTERRLGIAS--ARVHAAIWIATLEQIERGLLDAVLYVDICNEWPGRSWAPFFPEQGNDWRTPASFDWM---------RECCRLLRERYPALPLTT---------------------------------------------------SFSTFLSGEDLRDANPDFLDFLEPHRWMSFATDFYERVGYHFERFESIGYENVVARAERLYRSDPEYWKGLFARE--------DALVDWSRATGKPLVTTEGWAIV------DYKDWPGLDWGWVKELNAWAVER-------VASGRWAAIRDVDWHRNLTRKI........................................ 346
3 -13.700PF02449.15; Q5WC61_BACSK/18-400; Beta-galactosidase  ali follow..  12  1......................................................DYNEIIEEDFRLMPLAHCNTFSINIGWSAIEPEE----GVYTFAWLDDIMDRLAEKGYHAILATPSGARPAWLSKAY--LTSPVYRQKVKQINRKLAERYKGHLKMWHISNEYGGACHCDYCQDAFRAWLKRRYDNRLDKLNAAWWTGFWSHTYTD----EQIESPAPHGESMIHGHNLDWKRFVTDQTIDFYRNEIEPLRELTPEIKITTNFMGNYPHMRPFLGLNYRKFADELDVISWDSYPGWHGEKQSTEALASDVAFVHDIYRSLKG-------------------------------------GQPFLLMESTPSLVNWHDVNRAKKPGM---------LSSLQAVAHGADAILYFQWR-----KSRGSSEKFHGAV-VDHVGHEHTRVFQEVAQLGRTLEQL........... 383
4 -13.600PF01229.17; IDUA_MOUSE/13-533; Glycosyl hydrolases family 39  ali follow..  11  1..........LALAESPYLVRDAARPLRPLLPFWRSTGFCPPLPHDQADQYDLSWDQQLNLAYIGAVPHSGIEQVRIH-----LLDLITARKSPGQGLMYNAFLDLLMENQLLPGFELMG--SPSGYFTDFD---DKQQVFEWKDLVSLLARRYIGRYGNFETWNEPDHHDFDNV---------SMTTQGFLNYYD------ACSEGLRIASPTLKLG-------------GPGDSFHPLPRSPMCWSLL------GHCANGTNFFTGEVGV---------------RLDYISLHKKGA............................................................................................................................................................................... 244
5 -12.200PF07745.13; Q9KBA5_BACHD/222-585; Glycosyl hydrolase family 53  ali follow..  14...............................................QSGVTFYDDHGNVQDIFQTLQEAGVNYIRIRIWNDPYDTNENGGGGNNDLEKAIEIGKRATKNGMRVLANFHYSDFKQKPPKAWETLSFEDKKQALYEFTKESVKTMGIDIGMVQVGNETTNAFVGETNWEKMS--------------ELFNEGSRAV---REVDETILV------------------LHFTNPETPGRYETIAQRLYE----------------------------YNVDYDVFASSYYP----------------------------------------------WHGTLNNLTTVLSHVADTYDKLVMVAETSYTPSSGQTLNYPITVQGQGTAVRDVIEAVVNVGKSGM---GVFYWPAWIPVGPPESIEQNKQLWERDGSGWATSYAAAYDPEDAGEWYGGSAVDNQALFD. 352
6 -10.200PF14587.6; C6XV55_PEDHD/39-400; O-Glycosyl hydrolase family 30  ali follow..  10  1.....PQSIRISLTEEKQTIHS-------GASDCWSAKYVGKWSDLQKKNRIADLLFSTDTTSDGKPKGIGLSLWRFNIG-EECFLNENGTYNWEKQNGQQWFLKAAKQRGVAYTLG-FSLTPPAFMSGN-NLNIKAGMTNAYAAFMSAVSAHF--KFDFLSPVNEPQW-------------FWGRDRISQEGSQATNAEIADLVKVLSVQLPSKSPGTQVVIG---EAGQWDFLYGKNTDGRGDQISEFFSPASAHYIADR-----------------------PNVKRIISGHSYFTTCPDNNLIHVREQVAAKAKQTDP-----------------------------------------LLEVWQTEFGILGNICNQYNGGPRNTG-IDYGLYVAKVIHHDLTIA-NVTSWQWWLSISPYNYSD------ALVY.................................... 362
7 -9.930PF03198.14; GAS5_YEAST/19-331; Glucanosyltransferase  ali follow..  15  17......NAFFNSESGERFYIRGVDYQPGGSSNLTDPLADA-----------------SVCDRDVPVLKDLGINTVRVY--------------TVDNSQDHSHCMKLLQENGIYLILDVNTPTSAISRYDPACSYNAFATIDTFADYDNVLG---------FFAGNEV------------------INSVNTTNTATYVKAVVRDMKKYIKARKYRQIPVGYSAADIVANRQLAAEYFNCGDE------------------------------------------ADARIDMFGVNDYSWCGESSFVVSG-------------------------------------------YSTKMKLYQDYSVPVFLSEFGCNQVKSSRPFTEIEAIYSTQMSSV--------------FSGGLVYEYSNETN-------NYGLVQIDGDKVT-------KLTDFENLKNEYSK........ 311
8 -9.790PF01373.17; C3ALM3_BACMY/28-425; Glycosyl hydrolase family 14  ali follow..  16.........................................................ETFENDLRWAKQNGFYAITVDFWWGDMEKNGDQQFD---FSYAQRFAQSVKNAGMKMIPIISNVPIPSWVWNQKSDLASDVIRKEYGELYTAFAAAMKPYKDVIAKI-----YLSGGPAGELRYPSYTTSDGTGYPSRGKFQAYTEFAKSKFRLWVLNKYGSLNEVNKAWGTKLISELAILPPSDGEQFLMNGYLSMYGKDYLEWYQGILENHTKLIGELAHNATFQVPIGAKIAGVHWQYNNPTIPHGAEKPAGYNDYSHLLDAFKSAKLDVTFTCLEMTDKGSYPEYSMPKTLVQNIATLANEKGIVL-NGENALSIGNEEEYKRVAEMAFNYNFAGFTLLRYQDVMYNNSLMGKF........................................................... 398
9 -9.700PF11790.8; Q7S276_NEUCR/147-396; Glycosyl hydrolase catalytic core  ali follow..  14  1...........................................................FPDDAYIWTAPPTDL-TWYYNYKPLPSQIYSNVSQSDFEFV-------------PML----------------GAPSDISDKSFYNTIKTLIDDRGVNVTHILTFNEPDGPGQYGGSD-----DPEVAAQVWVNNIVPLQEDYKALRVGLPACTGAPAGMEWTQKFLEACSGLISEDEKT---------------------------------------------KNCTFDFVPIHWYGN------------------------------------------------FEGLASHMGEYSAAFPNKSMWITEYNLANANLQET-------------QAFYTTSAEYLDRLDFVERYSLFGAFRSMLNRDGELTDIGAWY.................................... 250
10 -8.390PF00331.20; A0A0C4DHX2_FUSO4/85-383; Glycosyl hydrolase family 10  ali follow..  21  8......GKQYFGTEIDHYHLNNNPLIN--------------------------------------VKAQFGQVTCENSMKWDAIEPS-----NSFTFSNADKVVDFATQNGIRGHTLLWHSQLPQWVQNIND---RSTLTAVIENHVKTMVTRYKGKILQWDVVNEI-----------FAEDGNLRDSVFSRVLGEDFVG--IAFRAARAADPAAKL-------------------------------------YINDYNLDKSDYAKLTRGMVAHVNKWIA--AGIPIDGIGSQGHLAAPSGWNPAS------------------------------------------GVPAALRALAASDAKEIAITE-------------DISGASANDY-----LTVMNACLAVPKCVGITVWGVSDKDSWRPG............................................. 277

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24