current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] COG3140 Uncharacterized protein conserved in bacteria, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .
# Score Template Links and tools%idFirst MFAGLPSLTHEQQQKAVERIQELMAQGMSSGQAIALVAEELRANHSGERIVARFEDEDELast
1 -40.600[S] COG3140 Uncharacterized protein conserved in bacteria  ali  100  1MFAGLPSLTHEQQQKAVERIQELMAQGMSSGQAIALVAEELRANHSGERIVARFEDEDE 59
2 -8.320[S] COG4876 Uncharacterized protein conserved in bacteria  ali follow..  21  10..ASLKNLEKPVRKKAIDIANAMIDEGYEEGRAIPIATSKAKE................ 50
3 -5.660[L] COG0776 Bacterial nucleoid DNA-binding protein  ali follow..  18  12LVDKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISG..................... 49
4 -5.390[I] COG3239 Fatty acid desaturase  ali follow..  68VTFVMFTVVHDASHYAISSVNGLFGRLAWLFVGPVVAFPAFGYIHIQHHRHSNDDEQDP 129
5 -4.760[K] COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain  ali follow..  21  58..ESLRLLREKQAESRLQALRELLAEGLNSGEPQAWEKDAFLRKVKTG........... 103
6 -4.720[G] COG1925 Phosphotransferase system, HPr-related proteins  ali follow..  21  155....VQNLDRNSQLVSAKSLMKIVALGVVKGTRLRFVATGEEAQQAIDGIGAVIES... 206
7 -4.580[S] COG2454 Uncharacterized conserved protein  ali follow..  18  2..........ARLKEAYMDLKFLLNRGYRKKVALNFVCNHYRLPSLYRHFLAR...... 44
8 -4.540[G] COG0120 Ribose 5-phosphate isomerase  ali follow..  20  18.............IAAAGLVSSGMLVGLGTGSTVAYTIKELGRRVREEGLDIL...... 57
9 -4.390[S] COG1297 Predicted membrane protein  ali follow..  18  602........DEEAYAEEPKRRGVLLASGLIVGESLMGILLAG.................. 634
10 -4.350[J] KOG1416 tRNA(1-methyladenosine) methyltransferase, subunit GCD10  ali follow..  20  88........CRGNQLMTQEEIDELRANIKAGGLRAEEAIKQLTNSSKTFEQKTLFAQEK. 137

FFAS is supported by the NIH grant R01-GM087218-01
1 2 2 3 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.