current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MFLTYISFPVYSYVRFILTVEAVMARTMTVDLGDELREFIESLIESGDYRTQSEVIRESLRLLREKQAESRLQALRELLAEGLNSGEPQAWEKDAFLRKVKTGMIKPDENGKINAKGQLast
1 -60.700[K] COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain  ali  100  1MFLTYISFPVYSYVRFILTVEAVMARTMTVDLGDELREFIESLIESGDYRTQSEVIRESLRLLREKQAESRLQALRELLAEGLNSGEPQAWEKDAFLRKVKTGMIKPDENGKINAKGQ 118
2 -10.500[K] COG0864 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain  ali follow..  24  1...................MEEGITR-IGVSLPKNLLDEFDRIISTRGYSSRSEAIRDAIRITEYRWLESEKGEIVGVLV...................................... 62
3 -6.910[K] COG3905 Predicted transcriptional regulator  ali follow..  15  39.....................VAIMTAFTVRLPDEVAEKLDQ-LAEKLDRSRSYMAVQAIEDFVARE-EWQLAEIEAGLAEADRGEFGTPEDLANIVGRYVKTAR............. 120
4 -6.740[R] COG4710 Predicted DNA-binding protein with an HTH domain  ali follow..  12  18...................LSEGFDMATSIRLSPEMEQRLNYLASHTG-RTKAYYLREIIE--HGIEEMEDYYLAADVLER-VRHGQEQVHSAADVRKTL.................. 94
5 -6.140[S] COG5500 Predicted integral membrane protein  ali follow..  18  1.......................MATVDNLFSILELFAVLGCGLMAGVFFAFSTFVMNALARLQPTQGIAAMQSINITVINPL................................... 60
6 -6.130[K] COG1329 Transcriptional regulators, similar to M. xanthus CarD  ali follow..  18  107........................................DAKINSGDLISISEVVRDLYRADNQPEQSYSERQLEIAAVNRMSETEAVRLIEVNLNKGPKRGAKADNEEAEQEEAA. 193
7 -5.700[S] COG4423 Uncharacterized protein conserved in bacteria  ali follow..  12  1...........................MALNIKDPEVDRLAAELADRLHTSKTAAIRHALSAQLAFLESRAGDREAQLLDI..................................... 54
8 -5.580[L] COG3935 Putative primosome component and related proteins  ali follow..  12  129...............LYSLFEAEFGRPLSPMEAEMLSAWVDQ------DRTSPDLIKEALKEA---SQKLNFRYIDRILLNWSKQGVKTIDDAKRVAEEFHQNGRTSQTINQSEVKKS 224
9 -5.570[S] KOG3024 Uncharacterized conserved protein  ali follow..  10  8..................PIASGSAVSTGQRGVSRVLAKLSQSLAGGEFYEAHMMYRTLYRYTAQKRYQDCLELLFDGAQQLIAKEQ............................... 77
10 -5.470[S] KOG2890 Predicted membrane protein  ali follow..  11  230.FTWASLFPSRTQLFFTLIGKVCFRTLARMGVCKRQVRHVDLHSLQSGSVGINLPALENSAKDSERRRQKALKELNDRLNKTRTAEVASYGNWDDGDDDEPTEVTVVAPPPVSNVHSS 346

FFAS is supported by the NIH grant R01-GM087218-01
1 2 2 3 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.