current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] COG4710 Predicted DNA-binding protein with an HTH domain, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MEMPIGRSHLRYYEYMHLSEGFDMATSIRLSPEMEQRLNYLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDDLast
1 -52.700[R] COG4710 Predicted DNA-binding protein with an HTH domain  ali  100  1MEMPIGRSHLRYYEYMHLSEGFDMATSIRLSPEMEQRLNYLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD 98
2 -23.600[K] COG3905 Predicted transcriptional regulator  ali follow..  21  40....................AIMTAFTVRLPDEVAEKLDQLAEKLDRSRSYMAVQAIEDFVAREEWLAEIEAGLAEADRG--EFGTPEDLANIVG... 113
3 -11.500[S] COG4423 Uncharacterized protein conserved in bacteria  ali follow..  24  1.......................MALNIK-DPEVDRLAAELADRLHTSKTAAIRHALSAQLAFLE................................. 41
4 -11.100[S] COG4226 Uncharacterized protein encoded in hypervariable junctions of pilus gene clusters  ali follow..  20  82........................KFNARISPELHALASEAAAAQGISLNQFVEQAIQHEVHT................................... 120
5 -11.000[S] COG4453 Uncharacterized protein conserved in bacteria  ali follow..  17  9.................PEATARGRITARLSADKQELLQLAADLSGSTLNQFVLQSALRAAEQ................................... 54
6 -10.800[R] COG4691 Plasmid stability protein  ali follow..  24  1......................MASMTIRLDDGLKKRLRIRAAAHGRSMEDEARDILRAALST................................... 42
7 -10.700[S] COG5304 Uncharacterized protein conserved in bacteria  ali follow..  29  95......................DKSITLRLSSELLTAVKNTASAQGMNYQKYIREVLEQSVLR................................... 135
8 -8.870[L] COG3077 DNA-damage-inducible protein J  ali follow..  14  2....................AANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREK---QLTIQSIKNSEAGVHKAKDADDLFDKLGV.. 86
9 -8.090[K] COG0864 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain  ali follow..  17  2...................EEGITRIGVSLPKNLLDEFDRIISTRGSSRSEAIRDAIRTYITEYR................................. 48
10 -7.780[S] COG4877 Uncharacterized protein conserved in bacteria  ali follow..  12  3......................RKQVPLRLDPAVYDAIAKWAADEARSTNAQIEMMLREQLRK................................... 43

FFAS is supported by the NIH grant R01-GM087218-01
1 2 2 3 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.