current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] KOG4795 Protein associated with transcriptional elongation factor ELL, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDDLast
1 -95.400[K] KOG4795 Protein associated with transcriptional elongation factor ELL  ali  100  1MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD 260
2 -8.060[TV] KOG3966 p53-mediated apoptosis protein EI24/PIG8  ali follow..  10  256.............................SLYSFEYKWFNMGWEHRRLTYIEFGFGIPLTVLTNLSSSVIVSSCIFS-----------IFF-VDTTEVSLRLFSPVVFISNLCFGGNPWSKANRLSAMQRQQYELQQRQRLLQRDEQLLKQRKQQYVQQQRLQQEQLMRRDRSHSRSQTPQLGHPHRYAQAPVFDAGRVRDSSASSTHSSNAPSINSHRPPPYYGSSLRGAAPLVPTPVPGAPRAPLTPPVIRQESGPDD 494
3 -7.470[A] KOG2242 Scaffold/matrix specific factor hnRNP-U/SAF-A, contains SPRY domain  ali follow..  1.......................MDVRRLKVNELREELQRRGLDT-------------------------------RGLKT------ELA----------ERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDR 190
4 -6.530[E] COG0347 Nitrogen regulatory protein PII  ali follow..  14  8.....................................IKPFKLDEVREALSQVGVSGITVTEVKGFGRQKGHTELYRGAEYIVKVKIEVAVPDDVLERAVEAIEKSARTGK..................................................................................................................................................... 85
5 -6.450[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  10  615................................NLYRNFILHMCSLFDYGLIAAETVYKTVQKLQGLLSKYAAGQELMQRQREEQL---------------KYWLDVGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPAHLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDVEQAADAPEVLTHSDNAVDV.. 825
6 -6.140[S] KOG2890 Predicted membrane protein  ali follow..  214..............YKPHETDEIYGDGSEHF-----SLFPSRTQLRTLARMGVCKRQVRHVDLHSLQSGSVGINLPALENSAKDSE-------RRRQKALKELNDRLNKTRTAEVASYGNWDDGDDDEPTEVTVVAPPPVSNVHSSKPAMDKESMA........................................................................................................ 356
7 -6.080[S] COG5353 Uncharacterized protein conserved in bacteria  ali follow..  11  28..............................SLFFWKSLNPYHSVRAQAIDIATEKTDLVKATGFDIAATDTVTYSIVGLNKANQEIGILIPKKSGKIKEVKLSQGVSPASLTTKD................................................................................................................................................. 112
8 -6.020[A] KOG3392 Exon-exon junction complex, Magoh component  ali follow..  16  18.................KFGHEFLESEFQLDGKLRYNYKNDVM--RKEAYVHKSLMEELKRIIDDNEITKEDDGLWPPPDRAGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEG............................................................................................................................................... 120
9 -5.980[R] KOG2295 C2H2 Zn-finger protein  ali follow..  13  189.................QLNEFFVAHKDEEWFKNKYH--PEDSVKRSE-LLENGTIGSVKVDSSQADALIRVLDTCVIKLEGGTDEDLKVLDEKPKD---RKAEQMQSVKEVEKTINSPKEEMSEADPVSTQRKPVRPVNSDGENWDDDDAENSAPKKELAEDSKDSDSKPEDKQLNKKKTKKRKRNSSDDDSSSSESSSSSDEEKLKEKYDVEDGLRAEQKTEAEKDRQEATKAKQGPQSPKLDEDEGNENTEPKGLDS 445
10 -5.880[K] KOG2473 RNA polymerase III transcription factor (TF)IIIC subunit  ali follow..  10  293.................................IKRGYDPRKDPESRDSNATNKSKPSWDDICAFKVFPFKCQTFLQ-RKPPKQTTC----NYKTGWFLLDNLRLRVAVRFVSVFPEPGFEDVFKSIQEEFERSEKTRIQKDALQPSQRNH--QETTKDMKKCKNTNKEKDDDVNADEDSEDLDDEYEEAANDDDISISSHGYGDMENNSRTYLQGLFNRFPSSASALYGSANDDNDSDGEYPIYEQESNALDDDEEDDE 545

FFAS is supported by the NIH grant R01-GM087218-01
1 2 2 2 5 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.