current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [H] COG0001 Glutamate-1-semialdehyde aminotransferase, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MPGGVSSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPDVIGALHDALEKGTSFGAPSFLENVLAEMVIAAVPSIEMVRFVNSGTEACMAVLRLMRAFTNREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKSATSSTLTAPYNDLEAVKALFEENRDQIAGVILEPVVGNAGFITPDAGFLEGLRELTHEHGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRRDIMSMIAPAGPVYQAGTLSGNPLAMTAGIKTLELLQKPGAYEYLERITKKLADGLLQVALETGHAACGGHISAMFGLFFTSGPVHNYEDAKNSDTAKFGRFHRGMLERGVYLAPSQFEAGFTSLAHTDEDIDQTIAIAREVLSSILast
1 -134.0002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  84  1MPGGVSSPVRAFKSVGGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKATTAATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPVYQAGTLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTEADIERTIAAARTVLSQL 411
2 -133.0003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model follow..  58  18MPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVAYNCGQGYYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQL-TPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIFFTDEPVINYDAAKSSNLQFFAAYYREMVEQGVFLPPSQFEGLFLSTVHSDADIEATIAAAEIAMSKL 427
3 -133.0002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  82  22MPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAARTVMSAL 432
4 -132.0005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  54  17IPGGVNSPVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPTALEVEMADLVCSMVPSMEMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLPFNDIEAVRKTLGEVGKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGFRVALGGAQAYYGVTPDLSTFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPGFHDELTAYTTRMLDGLQQRADAAGIPFVTTQAGGMFGLYFSGAAIVTFEDVMASDVERFKRFFHLMLDGGVYLAPSAFEAGFTSIAHGDKELEITLNAAEKAFAAL 428
5 -131.0004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  55  18IPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVALAGAQDYYHVIPDLTCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGVYETLTELTDSLATGLRHAAKEENIPLVVNHVGGMFGLFFTNDTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL 429
6 -131.0003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  58  20MPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLETLKQL-TPDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNRAGSMIGFFFTNEPVINYETAKASDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTIQAAEKVFAEI 429
7 -131.0002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  54  17IPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYIVKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAIIFEPVVGNAGVLVPTEDFLKALHE-AKAYGVLLIADEVMTGFRLAFGGATELLGLKPDLVTLGKILGGGLPAAAYAGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLATLELLEEPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMITVFFTEGPVVTFQDARRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHREEDVEKTLEALRKAL... 424
8 -128.0003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  48  19IVGGVNSPSRSFKAVGGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAAL 430
9 -128.0002epj_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  43  23FPGGVNSPVRA--AVKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAAAHYGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPRREFLAALQRLSRESGALLILDEVVTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVESMMQLFIGVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAVEGLRSSLKTV 431
10 -126.0004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  37  36IAGGVSSSMRAA--AVPLPLVVRSAGGCLLRDVEDGEIIDLNMGYGPHLFGYADREVLDAVADQFAKGHMTGLPHELDARAGALIAELVPGVEQVRFANSGTEAVASALRLARATTGRTLVVTFEGHYHGWSETVLRAGKTALHMEGVPGALGMIPEALAHTVQLGWNDPDALRELFARDGDRIAAVIVEPVLANAGVIPPAPGFLQLLRELTGRSGAMLVFDEVITGFRVARGGAQERYGVEPDLTVLSKVMGGGFPVAAFGGRRHAMRMLAS-NEAHHAGVYAGNHAALRAVVAMLGKISLPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVGTLMSVALLKGSAEPRQLAALVDFPRHRRLQTLAQKEGVYFHPNALEPWFLSTAHTRDVIDKVAGALQRSLVGL 457
11 -114.0002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  31  25MPDGVTADTRAFDPH---GLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRFEGHYHGWHD--FSASGYNSHFDGQP-APGVLPETTANTLLIRPDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGSKVLHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMTTDTGSITRAEVARPDVKMIAAMRMALILEGVDIGGR--GSVFLSAQHEREHVEHLVTTFDRVLDRL 435
12 -101.0002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  34  62MPGGNTRSILFHRPF---PLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAVGLNLSTQTENEALFAEAVCDRFPSIDLVRFTNSGTEANLMALATATAITGRKTVLAFDGGYHGG----LLNFASG----------HAPTNAPYHVVLGVYNDVEGTADLLKRHGHDCAAILVEPMLGAGGCVPAERAFLDLLRAEASRCGALLIFDEVMTS-RLSGGGAQEMLGISADLTTLGKYIGGGMSFGAFGGRRDLMERFDPAGAFAHAGTFNNNILTMSAGHAALTQIYTRQAASDLSASGDRFRANLNRIAVENQAPLQFTGLGSLGTIHFSRAPIRSAGDVRAADQQLKELFFFHMLRKGIYLAPRGMYALSLEIADA--GRDAFAEALADFIGEQ 454
13 -97.9004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  35  49MPGANSRSVLFYAPF---PLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMALTAALHFTGRRKIVVFSGGYHG-----------GVLGFGARPSPTT---VPFDFLVLPYNDAQTARAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS-RLAPHGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPTGPLAHSGTFNNNVMTMAAGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRSSEDLAAVDGRLRQLLFFHLLNEDIYSSPRGFV--VLSLPLTDADIDRYVAAIGSFIGGH 440
14 -44.8003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  23  20.....GAAIGNLQKLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANPAGATASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGVIAFAGAYHGCTVGSMAFSGHSVQADA-AKADGLPDPYRPYRNDPTGDAILTLLTEKLAAAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCA----SAFAMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDR-----QSREPARAETAKLIYRAYQLGLVVYYVGMNGNVLEFT-TETDIHKALDLLDRAFSEL 432
15 -44.8001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PY  ali model follow..  21  26..................PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK-LFSGMLSRPVVDLATRLANITPGLDRALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFAIPAPFTYRPRFEELDYAFDLIDRQSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELGYLF-YTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKDR-----RTKEPADGLGAKITRECMNLGLSMNIVQLPGMAPPLTVSEDEIDLGLSLLGQAIERA 432
16 -44.8001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferas  ali model follow..  29  21...........SGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAET-MPQTLPTPMRGEFYRTLTAILPPLNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFPLVEPVE---------IPYNDVEALKRAVD---EETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGG---HGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPK---REVRGMGLMVGLELKEKAAPYIARLE--------------KEHRVLALQAGPTVIRFPLVIEKEDLERVVEAVRAVLA.. 395
17 -44.3004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  24  27.....NKYYARSARINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTFHHVPGMELSEKLAKIAPG-KMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSVVHVPYPDSYRTYPGETEHDVSLRY--FNEFKKPFESFADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLRTGKMWAIQQFDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPA---HLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKDP-----KTKEPDSDAATKVIYYAFAHGVVIITLAGNI-QPPLVIPREQLDQALQVLDDAFTAV 446
18 -44.1004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate amino  ali model follow..  28  34..................DFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGET-TSNVFTNEPALRLGRKLIDAT--AERVLFMNSGTEANETAFKLARHYPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFPKPADIIH--------VPFNDLHAVKAVMD---DHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHV-----HGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGA-----------ELKPKYKGRARDFLYAGAEAGVMVLNAGADVMRFSLVVEEADIHEGMQRFAQAVGKV 412
19 -44.0004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  25  22FPGPKSQALAERRSAVGVPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTH--TPYEGYVAVTEQLNRLTPG-KRTVLFNSGAEAVENAVKVARLATGRDAVVAFDHAYHGRTNLTMAKTNFGPFAPEVYRMPMSYPFREENPEITGAEAAKRAITMIEKQGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFRTGEWFAVDHEGVVPDIITMAKGIAGGLPLSAITGRADLLDAVHPGG----GGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAELSAGGGIRGRGAMLAIELVQ------PGSKEPNAELTKAVAAACLKEGVIILTCGTYGNVIPLVISDELLIDGLEVLAAAIKAH 455
20 -43.7004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  27  22..................PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASK-TGNGYTNEPVLRLAKKLIDA-TFADRVFFCNSGAEANEAALKLARKFSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFPLPADIRH--------AAYNDINSASALID---DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTV-----HGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGC-----------VLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFALNVSEEEVTTGLDRFAAACEHF 400
21 -43.3004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  27  47NPGFLEYRKSVTAGGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAK-HSQELLDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRKPFPLLPGF--------RHVPFGNIEAMRTALNECGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLF-DNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIG-------------YNFASEMFRQRVLVAGTLNNAKTIRIE-TIEQCELVIKAARKALAAM 452
22 -42.6002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  27  10...........MNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEK-CSNLFWNRPQMELAELLSKN-TFGGKVFFANTGTEANEAAIKIARKYEKKYRILSAHNSFHGRTLGSLTATGQPKYQKPFPLVPGFEY--------FEFNNVEDLRRKMS---EDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAV-----VNERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSN-------------REVATKCFENKLLVVPAGNNTIRFPLTVEYGEIDLAVETLKKVLQGI 391
23 -42.4001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  27  15IPRGVGQ---------IHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSH--LAYEPYLELCEIMNQKVPG-KKTLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGR--THYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGIASIHRIFKNDPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGG----GGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDG-----DHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLPLTIEDAQIRQGLEIISQCFDEA 424
24 -41.9004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  24  22LPGPRSGALAERRRAATAPVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHFTH--TPYEQYVQVAELLNALTPG-KRTALFNSGAEAVENAIKVARLATGRPAVVAFDNAYHGRTNLTMAKSQFGPFAPEVYRMP-ASYPLRDEPGLTGEEAARRAISRIETQAQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFRTGAWFASEHEGIVPDIVTMAKGIAGGMPLSAVTGRAELMDAVYAGG----GGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSALAEEVDIIGEVRGRGAMLAIEIVK------PGTLEPDAALTKSIAAEALSQGVLILTCGTFGNVIPLVIGDDLLDEGITALSDIIRAK 449
25 -41.7003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  24  12...........IPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDK-TSNLYYNENIAAAAKNLAKA-SALERVFFTNSGTESIEGAMKTARKYVKGGQFIAFKHSFHGRTLGALSLTANEKYQKPFPLISGVKF--------AKYNDISSVEKLVN---EKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMRSGKFFAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSLEAGD--HGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDKS-------------VKVAKVIQKCQENALLLISCGENDLRFPLILQKEHIDEMSEKLRKALKSF 395
26 -41.6003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  25  19IPGPRSQALIDRKGTATMPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDFTH--TPYEGYVAVCEQLNRLTPV-KRSALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMAKDGFGPFAPEIYRAP---AEFGKELATDGELAAKRAITVIDKQADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFRTGAMFACEHEGIDPDLIVTAKGIAGGLPLSAVTGRAEIMDSPHVSG----GGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRLQAEDDRIGDVRGRGAMIAMELVK------AGTTEPDADLTKALCAGAHAAGVIVLSCGTYGNVVPLSIGDDLLNEGLDVLEEVLRG. 450
27 -41.6003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  25  26IPGPISQELQARKQSATLPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTH--TPYEGYVKVAEHLNRLTPG-KRTALFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGRTNLTMAKHGFGPFANEVYRVP---SYPFRDGETDGAAAAAHALDLINKQADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFRTGALFACEHENVVPDLIVTAKGIAGGLPLSAVTGRAEIMDGPQSGG----GGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGALAAADPRIGEVRGRGAMIAVELVK------PGTTEPDADLTKRVAAAAHAQGLVVLTCGTYGNVLPLSMPDHLLDEGLDILAAVFAEV 452
28 -41.3004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  22  402....INPMMVDFLKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDA-IQYISIPEQTAKLAEVLCRLAPGMGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLRNSYHGKTLGALSITGRDKHRRYFPLLDAM--------VEVPFGDLAALREALNR--EDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLRTGKLFACEWDGIEPDVLMLSKSLSGGIPIGATLCRADLWQKATADRFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEIAARYPFVSEVRGRGLMLGIQFDQAFTGAVNAS--------------AREFATRLPGDWHTTWKFLPDPVQAHLRAAMDRMEQALGEM 794
29 -41.1003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  25  30IPGPASLELNKRRAAATLPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQFTH--TPYEQYVAVAEQLNRITPG-KRTVLFNSGAEAVENSIKVARAHTRKQAVVAFDYAYHGRTNLTMAKSGFGPFAPEIYRAP--DNLLDKDIATDGELAAERAINLIDKQAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFRTGAMFACDHENVEPDLIVTAKGIADGFPLSAVTGRAEIMDAPHTSG----GGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRLQAADDRLGDVRGRGAMIAMELVK------SGTAEPDAALTQKLAAAAHAAGVIVLTCGMFGNVIPLTISDELLSEGLDILCQILAD. 461
30 -39.9002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  28  4...........MNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEK-VSNLYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYKNKWKFISFENSFHGRTYGSLSATGQPKFHKGFPLVPGF--------SYAKLNDIDSVYKLLD---EETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIRTGEFYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEVAQSFTPGS---HGSTFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKEKLKELGKGK-----VKGRGLMLGLELEREC---------------KDYVLKALEKGLLINCTAGKVLRFPLIIQKEHIDRAISVLREIL... 375
31 -39.6003dod_A mol:protein length:448 Adenosylmethionine-8-amino-7-oxononanoate ami  ali model follow..  24  16.......PFTQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGK-TLLGMTNVPATQLAETLIDISPKLTRVFYSDSGAEAMEIALKMAIGKPEKQKFIAMKNGYHGDTIGAVSVGSIELFH--KAPIPYVYRSESGDPDECRDQCLRELAQLLEEHHEEIAALSIESVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFRTGKMFACEHENVQPDLMAAGKGITGGLPIAVTFATEDIYKAFENLKTFFHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHALPHVG-DIRQLGFMCGAELVRS--KETKEPYPADRRIGYKVSLKMRELGMLTRPLGDVIAFLPLASTAEELSEMVAIMKQAIHEV 443
32 -39.0002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  26  16.........TSTRDPELFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQKLAHAAFYNIPQLELAKKLVTYSPG-KKVFFSNSGTEAIEASIKVVK-NTGRKYIIAFLGGFHGRTFGSISLTASKAV----PFMPGVGYENPSELVNRVIEFIEDYIFVNLVPPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLRTGKLFAIENFNTVPDVITLAKALGGGMPIGATIFRKDLDFKPGMHS-----NTFGGNALACAIGSKVIDIVKD--LLPHVNEIGKIFAEELQGLADD------VRGIGLAWGLEYNEKKVRD-------------RIIGESFKRGLLLLPAGRSA-IPPLVISEEEAKQGLDILKKVIKVV 418
33 -37.2003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate ami  ali model follow..  22  31.................STTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQTLSYFPMSQSHEIKLAEKLNEWLGGEYVIFFSNSGSEANETAFKIARGEPHRYKFMSRYRGYHGNTMATMAATGSGFLHVTPPDCYRMPGIERENIYDVECVK-EVDRVMTWELSETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFRTGKAFGFMNYDVKPDIITMAKGITSALPLSATAVKREIYEAFGEYEFFRHINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEIGEHPLVGDIRGKGLLVGI----ELVNDKETKEPIDNDKIASVVNACKEKGLIIGRNGMTTAGYNLVISSEEIAFVIGTLKTAMERI 452
34 -37.2003i4j_A mol:protein length:430 Aminotransferase, class III  ali model follow..  21  15.....................AVRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAAR--GSQFSSDVLEEYAGRLARFVGPTFRFWAVSGGSEATESAVKLARQYPGRFKVITRVPSYHGASLGSLAASGMGARRMRPEAWPKLPKPDPARNGAEDAEGLR--ALLEREGPETVAAFMAEPVVGSDAALAPAPGYYERVRDICDEAGIIFIADEVMSGM--SPLALSRWSGVTPDIAVLGKGLAAGAPLAGLLAAPQVYETVMGGSGAFMHGTYAGHPVSVAAGLSVLDIVEREDLTGAAKERGAQLLAGLQALQARFPQMMQVRGTGLLLGVVLGDLA----TGQAFETPGIASRIGAAALKRGLITYPGSGAEPNGRGDHTAAEVDGLLALLAGALEDV 428
35 -36.7003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  28  19..................PIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANR-TSRAFHSDQLGPWYEKVAKLT-NKEMVLPMNTGAEAVETAIKTARRWANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFPMLPGI--------IVIPYGDLEALKAAITP---NTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLRTGKVFACDWDNVTPDMYILGKALGGGVPISCAAANRDILGVFEP-----HGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPA---------------RPYCEQLKAAGLLCKETHENVIRIALVISEEDLEWAFQKIKAVLS.. 392
36 -36.6002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  20  10LAGRPTTPDRVHEVLGRSVLDLTRSGGSYLVDITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAADVYSVAMARFVETFARVLPALPHLFFVEGGALAVENALKAAFDWKSRHQVLHLRGAFHGRSGYTLSLTNTPKFDWPRIDAPYMRPGLDEPAMALEAEALRQARAAFETRPHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCLTGTAWAYQQLDVAPDIVAFGKKTQCGVMAGRRVDEVADNVFAVPS----LNSTWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFAVVLDPRGRGLMCAFSLPTTADRD-------------ELIRQLWQRAVIVLPAGADTVRFPLTVSTAEIDAAIAAVRSALPVV 448
37 -36.5003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  23  29..................PVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKK-CSRAFFSDSLGVCERYLTNLF-GYDKVLMMNTGAEASETAYKLCRKWENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFPFVPNF--------LKVPYDDLEALEKELQ--DPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLRTGKLLCTHHYGVKPDVILLGKALSGGHPISAILANDDVMLVLKPGE---HGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKNDLVNVWDICLK------------FKENGLITRSVHDKTVRLTLCITKEQLDECTEIIVKTVKFF 410
38 -36.3004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochon  ali model follow..  23  38..................PVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAER-TLRAFGNDVTGPACRFMAEMF-GYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALK--DPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKP-----HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNAVEVDS-----------DAIDPNDVVMKLKENGILSKPTRGRVMRFILVITDEEHRDATTRIIKSFLAV 420
39 -35.9004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  23  37.......PFSANRNFHKDPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGTSPGFQYGHPLSFQLAEKIAQMTPTLDHVFFTGSGSECADTSIKMARAYAQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGPLMDVDHLPHTLQPGMAFTKANELLKLIELHDSNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFRMGKATGAEYFGVTPDIMNVAKVTNGAVPMGAVIASSEIYDTFMNQNLPEYAVTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHGLKGTKNV-IDIRNCGLAGAIQIAARDGDAIVRPFEASMKLWKEFYVRFGGDTLQFGPT--------FNAKPEDLDRLFDAVGEALNGV 461
40 -35.9001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  22  42..................PVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKN-CSRAFFSVPLGICERYLTNLL-GYDKVLMMNTGAEANETAYKLCRKWENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFPFAPQF--------SKVPYDDLEALEEELK--DPNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLRTGKLLCVHHYNVKPDVILLGKALSGGHPISAVLANDDIMLVIKPGE---HGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVNVLDICLK------------LKENGLITRDVHDKTIRLTLCITKEQLDECTEIIVKTVKFF 423
41 -35.8003a8u_X mol:protein length:449 Omega-amino acid--pyruvate aminotransferase  ali model follow..  23  22.......PYTANRNFLRDPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLSTSPGFQYGHPLSFQLAEKITDLTPNLNHVFFTDSGSECALTAVKMVRAYATKTKMIGRARGYHGVNIAGTSLGGQDVDHLPHTLLASNAYSRGMPKEGGIALADELLKLIELHDASNIAAVFVEPLAGSAGVLVPPEGYLKRNREICNQHNILLVFDEVITGFRTGSMFGADSFGVTPDLMCIAKVTNGAIPMGAVIASTEIYQTFMNAVEFPHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHGIKGAKNV-IDIRNFGLAGAIQIAPRDGDAIVRPFEAGMALWKAFYVRFGGDTLQFGPT--------FNSKPQDLDRLFDAVGEVLNKL 447
42 -35.8004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  22  23.......PFSANRNFQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTSPGFQYGHPLSFQLAEKIAGLLPELNHVFFTGSGSECADTSIKMARAYPQKTKLIGRARGYHG-------------VNVAGTSLGGIGGNRKMFGQLMDVDHLPHTKLIELHDASNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFRLGTYSGAEYFGVTPDLMNVAKVTNGAVPMGAVIASSEIYDTFMNQALPEHAVTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGLQGAKNV-IDIRNCGLAGAIQIAPRDGDPTVRPFEAGMKLWQQFYVRFGGDTLQFGPT--------FNARPEELDRLFDAVGEALNGI 447
43 -35.7004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, pu  ali model follow..  23  53..................PVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAER-TLRAFGNDVTGPACRFMAEMF-GYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALK--DPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKP-----HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNAVEVDS-----------DAIDPNDVVMKLKENGILSKPTRGRVMRFILVITDEEHRDATTRIIKSFLAV 435
44 -35.7005DJ9 Entity 1(prereleased)  ali follow..  23  53..................PVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAER-TLRAFGNDVTGPACRFMAEMF-GYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALK--DPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKP-----HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNAVEVDS-----------DAIDPNDVVMKLKENGILSKPTRGRVMRFILVITDEEHRDATTRIIKSFLAV 435
45 -35.7001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  25  59..................PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDK-TSRAFYNNVLGEYEEYITKLF-NYHKVLPMNTGVEAGETACKLARKWKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFPFMPGF--------DIIPYNDLPALERALQ--DPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLRTGRWLAVDYENVRPDIVLLGKALSGGLPVSAVLCDDDIMLTIKP-----HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKL--PSDVVTAVRGKGLLNAIVIKETKDWDAWK-----------VCLRLRDNGLLAKPTHGDIIRFALVIKEDELRESIEIINKTILSF 439
46 -34.9001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  16  22VPGPRSRELMKQLNI-HFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPANFVEKLRESLLSVAPGMSQLITMACGSCSNENAFKTIFMWYRSKEILSFMGAFHGRTMGCL-KIDIPSFDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGSTGKFWAHEHWGLDADVMTFSKKMMTGGFFHK--------EEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYQFISRVRGRGTFCSFDTPDESIRN-------------KLISIARNKGVMLGGCGDKSIRFTLVFRDHHAHLFLNIFSDILADF 471
47 -33.1003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  21  37..................QPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMV-SPWYMATSPAARLAEKIATLTPDLNRIFFTTGGSTAVDSALRFVLGRPQKKRIIVRYDGYHGSTALTAACTGDRISFLSSPNPRHAGNRSQEAFLDDLVQEFE--DRIESLGPDTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFRCGE-ASEKVFGVVPDIITFAKGVTSGVPLGGLAISEAVLARISKGSWFTNGYTYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALASLRDLPGVA-ETRSVGLVGCVQCLLDPTR--ADGTAEDKAFTLKIDERCFELGLIVRPLGDLCVISPLIISRAQIDEMVAIMRQAITEV 454
48 -32.3001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMI  ali model follow..  22  29.....................VVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-VMFGEITAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARDRFLTFRNGYHGDTFGAMDNSMHSLWKGYLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPIAGGMRMYHPE--WLKRIRKICDREGILLIADEIATGFRTGKLFACEHAEIAPDILCLGKALTGGMTLSATLTTREVAETISEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVADV--RVLGAIGVVETTHPVN------------MAALQKFFVEQGVWIRPGKLIYLMPPYIILPQQLQRLTAAVNRAVQD. 423
49 -32.3001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  22  29.....................VVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-VMFGGITAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARQRFLTFRNGYHGDTFGAMDNSMHSLWKGYLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPIAGGMRMYHPE--WLKRIRKICDREGILLIADEIATGFRTGKLFACEHAEIAPDILCLGKALTGGMTLSATLTTREVAETISEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVADV--RVLGAIGVVETTHPVN------------MAALQKFFVEQGVWIAPGKLIYLMPPYIILPQQLQRLTAAVNRAVQD. 423
50 -31.5004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  21  33..................ARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEENTFFKTTHPAVVELSSLLAEVTPGFDRVFYTNSGSESVDTMIRMVRGKPEKKTLIGRWNGYHGSTIGGASLGGPGMAHIEQPWWYKHGKDMTPDEFGVVAAR-WLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFRTGEWFGHQHFGFQPDLFTAAKGLSSGLPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAK-------------RELFPDFGEIGTLCRDIFFRNNLIMRA-TRAEVDEMLAVAERCLEEF 449
51 -31.1003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  19  22......THMGTHARGESPTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNHAYVGHGTEASITLAKMIIDRAPGMSRVYFGLSGSDANETNIKLVLGRPEKKKIISRWRGYHGSG----VMTGSLTGLDLFHNAFDLPRAPVLHTEAPYY--ADKLEEMILAEGPEIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFRLGTMFGSDHYGIKPDLITIAKGLTSAAPLSGVIVADRVWQVLVKLGSLGHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGMLAAVEFVADKDD-------------RVFFDASQKIGPQVATALAASGVIGRA-TREQADIVVSKTADAVKSV 456
52 -31.0003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  19  21......THLAQHARGESANRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQAREHSYVGHGTEASITLAKMILDRAPNMSKVYFGLGGSDANETNVKLILGRPEKKKIISRWRGYHGSG----LVTGSLTGLELFHKKFDLPVEQVIHTEAPYYHCVAELEALIEREGADIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFRLGTMFGSDHYGLEPDIITIAKGLTSAAPLSGSIVSDKVWKVLEENGPIGHGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEALSQHANVGDVRGEGLLCAVEFVKDRDS--RTFFDAADKIGPQISAKLLEQDKIIARAMPQGDILGFA-TRAEADQVVEGTLRAVKAV 456
53 -30.4003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate ami  ali model follow..  23  43.......PYSSIGREAVSPVVAVAAHGAWLTDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV-VMFGGLTEPAARLAKLLVDITPGLDTVFFSDSGSVSVEVAAKMARGLPGKRRLMTWRGGYHGDTFLAMSICDGGMHSL----TDVLAAQVFAPQVPRDYDPSAAFEAQLAQHAGELAAVVVEPVAGGMRFHDPR--YLHDLRDICRRYEVLLIFDEIATGFRTGALFAADHAGVSPDIMCVGKALTGGLSLAATLCTADVAHTISAAGALMRGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARALPAVTDV--RVCGAIGVIECDRPVD------------LAVATPAALDRGVWLRPRNLVYAMPPYICTPAEITQITSAMVEVARLV 452
54 -30.4003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate ami  ali model follow..  23  38.......PYSSIGREAVSPVVAVAAHGAWLTDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV-VMFGGLTEPAARLAKLLVDITPGLDTVFFSDSGSVSVEVAAKMARGLPGKRRLMTWRGGYHGDTFLAMSICDGGMHSL----TDVLAAQVFAPQVPRDYDPSAAFEAQLAQHAGELAAVVVEPVAGGMRFHDPR--YLHDLRDICRRYEVLLIFDEIATGFRTGALFAADHAGVSPDIMCVGKALTGGLSLAATLCTADVAHTISAAGALMHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARALPAVTDV--RVCGAIGVIECDRPVD------------LAVATPAALDRGVWLRPRNLVYAMPPYICTPAEITQITSAMVEVARLV 447
55 -30.1003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  17  38..................TRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRENTFFKTTHVPAIALAQKLAELAPDLNHVFFAGGGSEANDTNIRMVRGQPEKTVIISRKNAYHGST----VASSALGGMAGMHAQSGLIPDVHHINQPNWWAEGGDMEAILELGENRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFRTGNWFGTQTMGIRPHIMTIAKGLSSGAPIGGSIVCDEVAHVIG-KDEFNHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTP------------NKASRAKFASEPGTIGYICRERCFANNLIMRH-TPAEIDEMFVRIRKSLDEA 452
56 -30.1004grx_A mol:protein length:465 Aminotransferase  ali model follow..  19  42..................TVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRHAFFGRMSDQTVMLSEKLVEVSPDNGRVFYTNSGSEANDTMVKMAEGKPQKRKILTRWNAYHGVT------VSASMTGKPYNSVFGLPLPGFIHLTCPHY--ARELEDTITREGADIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFRTGNTWGCLTYDFMPDAIISSKNLTAGFPMGAVILGPDLAKRVEAIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKRIADRPNIG-EYRGIGFMWALEAVKDKPT--KTPFDANLSVSERIANTCTDLGLICRPLGQSIVLCPFILTEAQMDEMFEKLEKALDKV 460
57 -30.0004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  19  44..................TVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERHAAFGKMSDQTVMLSEKLVEVSPDSGRVFYTNSGSEANDTMVKMAEGKPQKRKILTRWNAYHGAT------VSASMTGFPYNSVFGLPLPGFVHLTCPHY--ARELEETIQREGADIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLEAIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIG-EYRGIGFMWALEAVKDKAS--KTPFDGNLSVSERIANTCTDLGLICFPLGQSVVLCPFILTEAQMDEMFDKLEKALDKV 462
58 -30.0003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  19  44..................TVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPDSGRVFYTNSGSEANDTMVKMAEGKPQKRKILTRWNAYHGVT------VSASMTGKPYNSVFGLPLPGFVHLTCPHY--ARELEETIQREGADIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLEAIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIG-EYRGIGFMWALEAVKDKAS--KTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPFILTEAQMDEMFDKLEKALDKV 462
59 -30.0004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  19  44..................TVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPDSGRVFYTNSGSEANDTMVKMAEGKPQKRKILTRWNAYHGVT------VSASMTGKPYNSVFGLPLPGFVHLTCPHY--ARELEETIQREGADIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLEAIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIG-EYRGIGFMWALEAVKDKAS--KTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPFILTEAQMDEMFDKLEKALDKV 462
60 -28.2004a0f_A mol:protein length:831 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMI  ali model follow..  17  339.......PYTQHKLVHQETVTVRCGENFSIYKASDNQQFDACASWWTQGPDPTQAELAREMGYTAAR-MFPENVYEPALKCAELLLDGVGKASRVYFSDNGSTAIEIALKMAEEKHIVVKVIALRGSYHGDTDPPTVFLSNGSWNISLPESFSEIADKSRDASTLARIYSAYLSKHLQEHSAHVGALIIEPVAGGMHMVDPL--FQRVLVNECRNRKIPVIFDEVFTGFRLGVETTTELLGCKPDIACFAKLLTGGVPLAVTLATDAVFDSFSKLKALLHGHSYSAHAMGCATAAKAIQWFKDPETNHNITSQGKTLREELVQQISSHSAVQRVVVIGTLFAL-----ELKADASNSGYASLYAKSLLIMLREDGIFTRPLGNVIYLMGPCTSPEICRRLLTKLYKRLGEF 822
61 -13.9004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  21  57...GVTDPFAIVMEQVKSPTEAV-IRGKDTILLGTYNYMGMT----------FDPDVIAAGKEALEK---FGS-----------------GTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSDGCQQGNAE-IVRFRHNSVEDLDKRLGRLPKEPAKLVVEGVYSMLGDIAP----LKEMVAVAKKHGAMVLVDEA-MGFFGPNGGVYEAQGLEGQIDTFSASVGT---VGGFVSNHPKFEAVRLACRPY---TASLPPSVVATATTSIRKLTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVM-----------------EDQEQAAMMWQALLDGGLYVNMARPPAT-ICAEHTPAQIQTVLGMFQAAGRAV 431
62 -13.8003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  15  35.........YFDINKNGKHLVLGKQASPDDIILQSNDYLALA----------NHPLIKARLAKSLLE-----------------------SLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAEGARYANAQ-AHPFMHNNCDHLRMLIQRHGPGI--IVVDSIYSTLGTIAP----LAELVNISKEFGCALLVDES-LGTHGPNGGLLAELGLTREVHSLAKTFAY----GAIWCNNEVNRCVPFISYPA---SSTLLPYEAAGLETTLEIIESDNRRQHLDRMARKLRIGLSQLG-------------------LTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPAT-LNSDVNDEQIAKIIEVCSDAVNYG 398
63 -13.7002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  21  62.........................RGKDTILLGTYNYMGMT----------FDPDVIAAGKEALEK---FGS-----------------GTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSDGCQQGNAE-IVRFRHNSVEDLDKRLGRLPKEPAKLVVEGVYSMLGDIAP----LKEMVAVAKKHGAMVLVDEA-MGFFGPNGGVYEAQGLEGQIDTFSKSVGT---VGGFVSNHPKFEAVRLACRPY---TASLPPSVVATATTSIRKLTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVM-----------------EDQEQAAMMWQALLDGGLYVNMARPPAT-ICAEHTPAQIQTVLGMFQAAGRAV 415
64 -13.4002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  15  21.........YFDINKNGKHLVLGKQASPDDIILQSNDYLALA----------NHPLIKARLAKSLLE-----------------------SLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAEGARYANAQ-AHPFMHNNCDHLRMLIQRHGPGI--IVVDSIYSTLGTIAP----LAELVNISKEFGCALLVDES-LGTHGPNGGLLAELGLTREVHSLAKTFAY----GAIWCNNEVNRCVPFISYPA---SSTLLPYEAAGLETTLEIIESDNRRQHLDRMARKLRIGLSQLG-------------------LTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPAT-LNSDVNDEQIAKIIEVCSDAVNYG 384
65 -13.2002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  21  30.....................MDKVLSPTEAMINGRKTILLGTY----YMGMTDPDVIAAGKQALDE---FGS-----------------GTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSDGCWLGDAE-IVRFRHNSVEDLDKRLGRLPAEAGKLVVEGVYSMMGDIAP----LQEMVAVSKKHGAMILVDEA-MGFFGEHGGVFEEAGVEADVDTFSKSVGT---VGGFVSNHPKFEVLRLVCRPY---TASLPPSVVATAATSIRKLHAGDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVI-----------------TDMAQAVALWQGLLEAGLYVNTARPPAT-LCAEHSDEQVEQILGMFESAGRAT 395
66 -12.7003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  19  22...GLYAYFRPIQSKQDTEVKID---GRRVLMFGSNSYLGLT----------TDTRIIKAAQDALEK---YGT-----------------GCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDDGSRLSFSK-VIKYGHNNMEDLRAKLSRLPEDSAKLICDGIFSMEGDIVN----LPELTSIANEFDAAVMVDDA-LGVIGHKGGTASHFGLNDDVDTFSKSLAS----GFVAGDADVIDFLKHNARSVMFSA-SMTPASVASTLKALEIINEPEHIEKLWKNTDYAKAQLLDHG------------------FDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAV-LMATHTYDQIDEAIEKMVKVFKQA 392
67 -12.3001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  15  26.....................VAQGAGRWL-VADDRQYLNFSSN----YLGLSHPQIIRAWQQGAEQGIGSGG---------------------SGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIMMAKEDRIAADRLSHASLLEAASLSPSQLRRFNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAP----LAEIQQVTQQHNGWLMVDDA-TGVIGEQGGSCWLQKVKPELLTFGKGFGV---SGAALCSSTVADYLLQFARHLIYST-SMPPAQAQALRASLAVIRSDE--DARREKLAALITRFRAGVQDLPFTLADSC--------------SAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTV-LTAAHEMQDIDRLLEVLHGN.... 383
68 -12.1003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  20  28....LADIEQRRRAEGLRRELRVRPPVAAELDLASNDYLGLS----------QHPDVLDGGVEALRTGGGAGGSEAFEHQLASFL-----GAESALVFSSGYTANLGALV---ALSGPGSLIVSDALSHAS-DACRLSRAR--------------------VVVSPHRDVDAVDAALAARTEERAVVVTESVFSADGDLAP----LRDLHAVCRRHGALLLVDEA-LGVRGTRGGLLHEVGLAGATTTLSKALGS----GAVLGPEAVRAHLIDTARSFIFDT-GLAPAAVGAASAALRVLDEPQRARAVLDRAAELATIAGVTEAPV----------------------SAVVSVILGDPEIAVGAAAACLDRGVRVPPTVPAGT-ARASLTDDEMALARQVLTDVLATA 396
69 -11.9001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  20  12....LTNDLETARAEG-EERIITSAQQADITVADGSHVINFCAN----YLGLAHPDLIAAAKAGMDS--GFG-------------------MASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFLLGAEDAIISDALNHASIIDGVRLCKAKRYRYQELEARLKEAREAGARHVLIATDGVFSMDGVIAN----LKGVCDLADKYDALVMVDDSAVGFVGENGGSHEYCDVMGRVDTLGKALGGAS--GYTAARKEVVEWLRQRSRPY----LFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGAD--------------HAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVV-MSAAHTPEQITRAVEAFTRIGKQL 397
70 -11.8002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  19  55.......................................DYLGM--------QHPVVLAAMHEALEAGAGSGG---------------------TRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSEGIKRNAGPKRI-FRHNDVAHLRELIAADDPAAPKLIAESVYSMDGDFGP----IKEICDIAEEFGALTYIDEVAVGMYGPRGGVAERDGLMHRIDTLAKAYG----FGGYAASARMVDAVRSYAPGF---STSLPPAIAAGAQASIAFLKTAEG-QKLRDAQQMHAKVLKMRLKALGMPIIDHG--------------SHIVPVVIGDPVHTKAVSDMLLSDGVYVQPINFPTV-PSPVHDLKQIDGLVHAMDLLWARC 400
71 -11.7003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  19  22...GLYKSERIITSPQNAEIKVG---EKEVLNFCANNYLGLA----------DHPALIKTAQTVVEQ--GFG-------------------MASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGVFSMDGIIAD----LKSICDLADKYNALVMVDDSAVGFIGENGGTPEYCGVADRVDTLGKALGGAS--GYTSGHKEIIEWLRNRSRPYLFSN-TVAPVIVATSLKVLELLKTEGLRKQLQENSRYFRAGMEKLG------------------FQLVPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVV-MSAVHTQQQLDRAIEAFGQVGKKL 396
72 -11.6005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  19  23.........RRRRTADTPCAAHMTVDGRAIIGFASNDYLGLA----------AHPQLIAAIAEGAQRGAGSGGSAQLEDDLAEFVGGFVEN-ARALYFSTGYMANLATLT---ALAGRGTTLFSDALNHAS-DGARLSRAD--------------------VQIYPHCDTDALSAMLEASDADVKVIVSDTVFSMDGDIAP----LPRLLELAEQHGAWLIVDDA-FGVLGPQGGAIAQAALRSPIGTLDKAAGV---SGAFAAHETVIEWLVQRARPYIFTT-ASVPAAAHAVSASLRIIGGEE--DARRAHLQQLIGRTRAMLKATPWLPVDSH--------------TAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTV-LSAAHSQADLDRLEAGLQQLGAKA 395
73 -10.4001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  17  26....................................................MHPKILDLMARDMTQHAGYGQDSHCAKAARLIGELLERPDADVHFISGGTQTNLIACSALRPWEA---IATQLGHISTHETGAIEATGHKVVTAPCPDGKLRVADIESALHENRSEHMVIPKLVYISNTTEVGTQYTKQ--------------LEDISASCKEHGLYLFLD----GARLASALSSPVNDLTADIARLTDMF-GATKAGGMFGEALIILLIKQRGALMAKGWLLG---------IQFEVLMKDNLFFELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELN-------NDFDMYTVEPLKDG-----TCIMRLCTSWATEEKECHRFVEVLKRLVAS. 357
74 -10.3004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  15  22....LQDKYTQYQRDNLLRELTPFIKDDSIIDFTTSDYLNLS----------SAHNLKHAIVNGFDKGFGSKG---------------------SNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYQQLSQLQDIYDGK----SFITTEGVFSTSGSITQ----LDKLAKITPEK--LIVDEAHSFGVLGKNGGAINSFRISYKVFPLGKAFGG---VGAVCTTEAIAEYLIQFARNYIYTT-ALPPMILKAALIQLKNLENNDNRARLQQNITFFNELCDAK-----------------DLELVSKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTV-LHSNNTFDQIQQALEIISKEVKYE 388
75 -9.9001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transa  ali model follow..  19  29....................................EYIQLAAQYKPLNLGQGFPDALNALAAAANSP-GFGHPQALSKLYSQLVDRTINPMTEVLVTVGAYEALYATIQGH--VDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTISSADWVL-----DNNELEALFN---EKTKMIIINTPHNPLGKVMDRAE-LEVVANLCKKWNVLCVSDEVYEHMHIRICTLPGMWERTITIGSAGKTFS-GWKIGWAYGPEALLKNLQMVHQVYTCATPIQEAIAVGFETELKRLKSPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQ-GGYFMVADWSSLDSKVDLTQETDARKDYRFTKWMTKSGLQGIPP---SAFYSEPNKHL--DENLQKAAEILRKW 425

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.