current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0002 Acetylglutamate semialdehyde dehydrogenase, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MKVGIIGASGYTGGELLRLLVSHPDVRLELATSRSLAGKPVSSTHRHLTGFLDLKYENPVSEEIRERCDVVFVAVPHGTAMNYVPELLDGSTKVIDLSADYRLDTPVFENIYGIKHSDPRKAVYGLVELHPEAAREEFVANPGCFPTGANLAAAPLAAAGLIDIAVFDSKTGISGAGISPTETSHYPNIAENIIPYKLTAHRHRAEILQELTRLDGKLRNISFTPHVIPSIRGILTTAHLFTKEPLSTGDVQEIYEEFYRDKPFVRLPGGVPSLTAVRGSNFCDIGFEADKENNRVVVLSAIDNLVKGASGQAIQNMNLMFGLAETRGLWLPAAAPLast
1 -104.0001xyg_A mol:protein length:359 putative N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  39  17IRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVS-VKDADFSTVDAVFCCLPHGTTQEIIKEL-PTALKIVDLSADFRLRNIAYEEWYGQPHKAVEEVVYGLTEILREIKKARLVANPGCYPTTIQLPLVPLLKANLIKHIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 359
2 -101.0002cvo_A mol:protein length:366 putative Semialdehyde dehydrogenase  ali model follow..  38  24VRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPNLVA-VKDADFSNVDAVFCCLPHGTTQEIIKGLPQEL-KIVDLSADFRLDINEYAEWYGHSHRAPEEAVYGLTEVLRNIRNARLVANPGCYPTSIQLPLVPLIKAKLIKVIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGIKGHRHVPEIEQGLSEAAESKVTISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLNGVPHTRHVVGSNYCFMNVFEDRIPGRAIIISVIDNLVKGASGQAVQNLNLMMGLPENTGLQYQPLFP 366
3 -100.0002ozp_A mol:protein length:345 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  36  5KTLSIVGASGYAGGEFLRLALSHPYLEVKQVTSRRFAGEPVHFVHPNLRGRTNLKFVP---PEKLEPADILVLALPHGVFAREFDRYSALAPVLVDLSADFRLKDPELYRRYYGEHPRPDRFVYAVPELYRELKGADWIAGAGCNATATLLGLYPLLKAGVLKPIFVTLLISTSAGGAEASPASHHPERAGSIRVYKPTGHRHTAEVVENL----PGRPEVHLTAIATDRVRGILMTAQCFVQDGWSERDVWQAYREAYAGEPFIRLVKQYPDPRFVQGTNYADIGFELEEDTGRLVVMTAIDNLVKGTAGHALQALNVRMGWPETLGLDFPGLHP 345
4 -99.8001vkn_A mol:protein length:351 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  41  8IRAGIIGATGYTGLELVRLLKNHPEAKITYLSSRTYAGKKLEEIFPSTLENSILSEFD--PEKVSKNCDVLFTALPAGASYDLVREL--KGVKIIDLGADFRFDDPGVYREWYGKEYENIKRVYGLPELHREIKNAQVVGNPGCYPTSVILALAPALKHNLVDPILVDAKSGVSGAGRKEKVDYLFSEVNESLRPYNVAKHRHVPEMEQELGKISGKKVNVVFTPHLVPMTRGILSTIYVKTDKSL--EEIHEAYLEFYKNEPFVHVLPMYPSTKWCYGSNHVFIGMQMEERTNTLILMSAIDNLVKGASGQAVQNMNIMFGLDETKGLEFTPIYP 345
5 -99.7005ein_A mol:protein length:344 N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase  ali model follow..  37  4KTLSIVGASGYAGGEFLRLALSHPYLEVKQVTSRRFAGEPVHFVHPNLRGRTNLKFIP---PEKLEPADILVLALPHGVFAREFDRYSALAPILIDLSADFRLKDPELYRRYYGEHPRPDCFVYAVPELYRELKGADWIAGAGANATATLLGLYPLLKAGVLKPIFVTLLISTSAAGAEASPASHHPERAGSIRVYKPTGHRHTAEVVENL----PGRPEVHLTAIATDRVRGILMTAQCFVQDGWSERDVWQAYREAYAGEPFIRLVKQYPDPRFVQGTNYADIGFELEEDTGRLVVMTAIDNLVKGTAGHALQALNVRMGWPETLGLDFPGLHP 344
6 -97.4002i3a_A mol:protein length:352 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  36  10TKVAVAGASGYAGGEILRLLLGHPALRIGALTAATSAGSTLGEHHPHLTPLAHRVVEP-TEAAVLGGHDAVFLALPHGHSAVLAQQL-SPETLIIDCGADFRLTDAAWERFYGSSHAGSWPYGLPELPGARDLRGTRRIAVPGCYPTAALLALFPALAADLIEPVTVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIGVHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASRGILATCTARTRSPLS--QLRAAYEKAYHAEPFIYLMGQLPRTGAVIGSNAAHIAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP 352
7 -94.1002g17_A mol:protein length:337 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  33  5LNTLIVGASGYAGAELVSYVNRHPHMTITALAQSNDAGKLISDLHPQLKGIVDLPLQPSDVRDFSADVDVVFLATAHEVSHDLAPQFLQAGCVVFDLSGAFRVNDAFYEKYYGFTHELLEQAVYGLAEWNVDLNTANLIAVPGCYPTAAQLSLKPLIDGGLLDLQWPVINATSGVSGAGRKAAISNSFCEVSLQPYGVFTHRHQPEIAVHL------GAEVIFTPHLGNFPRGILETITCRLKAGVTHAQVADVLQKAYGDKPLVRLYDKVPALKNVVGLPFCDIGFAVQG--EHLIVVATEDNLLKGAAAQAVQCANIRFGFAETQSL....... 336
8 -92.5003dr3_A mol:protein length:337 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  33  5LNTLIVGASGYAGAELVTYVNRHPHMNITALAQSNDAGKLISDLHPQLKGIVELPLQPSDISEFSPGVDVVFLATAHEVSHDLAPQFLEAGCVVFDLSGAFRVNDTFYEKYYGFTHELLEQAAYGLAEWCGNLKEANLIAVPGCYPTAAQLALKPLIDADLLDLQWPVINATSGVSGAGRKAAISNSFCEVSLQPYGVFTHRHQPEIATHL------GADVIFTPHLGNFPRGILETITCRLKSGVTQAQVAQALQQAYAHKPLVRLYDKVPALKNVVGLPFCDIGFAVQG--EHLIIVATEDNLLKGAAAQAVQCANIRFGYAETQSL....... 336
9 -81.6005cef_A mol:protein length:375 Aspartate-semialdehyde dehydrogenase  ali model follow..  19  9IKVGVLGATGTVGQRFIELLAAHPYFALHALASSRSAGQQYARVVRWKLPRHMVVHECRPDAPGFAECGVVFSGLDADVAGDIENAFRAADLVVYSNAKNYRRDPLCPLIVPLVNPS---HLSIIPYQREQLLKKGYIVTNANCSTTGIVVPLAALEKAFGLDTVIVTTLQAISGAGYPGVSSLDIMDNVVPLISGEEDKIEWETNDNKAFDLHAPKQINVSATCTRVPVIDGHTGCVSVKFARPPSVAEVENAFREYTCDAQHLGVPPQPRLDKNLHNGACVSVGRIRECPVFDIKFVCLIDNVRLGAATSSIINAEIAVGLIQLE......... 369
10 -79.8004dpk_A mol:protein length:359 Malonyl-CoA/succinyl-CoA reductase  ali model follow..  21  8LKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGIADMEIKPTDPKLMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPH----TISLIDEQRKREWKGFIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDGDGYDAKTIKEIFRILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTARPQVYFDRWAGDVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVGYIEK.......... 359
11 -77.5002ep5_A mol:protein length:350 350aa long hypothetical aspartate-semialdehyde dehydrogenase  ali model follow..  21  5IKVSLLGSTGMVGQKMVKMLAKHPYLELVKVASPSKIGKKYKDAVKWIEQEVQDLPIVSTNYEDHKDVDVVLSALPNELAESIELELVKNGKIVVSNASPFRMDPDVPLINPEINWE----HLELLKFQKERGWKGILVKNPNCTAAIMSMPIKPLIEIATKSKIIITTLQAVSGAGYNGISFM---AIEGNIIPYIKGEEDKIAKELTKLNQIIPANLDSTVTSIRVPTRVGHMGVINIVTNERINIEEIKKTLKNFKSLPQQKNLPDRPQPIIDVNAESGMAVTVRIRHENNVLRLVVLGDNLVRGAAGITILTVEVMKEL............. 347
12 -77.3004zhs_D mol:protein length:379 Aspartate Semialdehyde Dehydrogenase  ali model follow..  19  18KRCGVLGATGAVGTRFILLLSQHPLLELVAVASDRSSGKKYRDAVRWKQSKVADLTVRCCDPAEFSDCDIIFSGLDPDAAGEIEMAFLKANFAVFSNAKNYRLDPMVPLVVPLVNAGHIDVIP---QRKHFGLDKGMLVCNSNCAVVGLVVPAKALIQKGPIESVSMVTMQAVSGAGYPGVSSMDIFDIPGEEGKISSEARKILGDLNSDLAGFSDKPLQISVACNRVPVLDGHTVCASLRFVNPPTASQVREALREYKPEVQTLGCRPQPRLDRETEGGYACTVGRIREDDVFDIQFVALSHNTVLGASGSSILNAESAIL.............. 369
13 -77.2002yv3_A mol:protein length:331 Aspartate-semialdehyde dehydrogenase  ali model follow..  18  1MRVAVVGATGAVGREILKVLEARPLSELRLYASPRSAGVRLAFRGEEIP---------EPLPEGPLPVDLVLASAGGGISRAKALVWAEGGALVVDNSSAWRYEPWVPLVVPEVNREKIF-------------QHRGIIANPNCTTAILAMALWPLHRAFQAKRVIVATYQAASGAGAKAMEELPKAEAFAHPLPFNVIPHIDAFQENGYTREFGDDTIRISATAVRVPTLRAHAEAVSVEFARPVTPEAAREVLKEAPGVEVVDEPAKRYPMPLTASGKWDVEVGRIRKSLENGLDFFVVGDQLLKGAALNAVQIAEEWLK.............. 329
14 -77.0002gyy_A mol:protein length:366 Aspartate beta-semialdehyde dehydrogenase  ali model follow..  17  3YTVAVVGATGAVGAQMIKMLEESPIDKIRYLASARSAGKSLKFKDQDIT-------IEETTETAFEGVDIALFSAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALD-------------AHNGIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGAGMGAILETKHYPIAFNALPIDVFTDNDYTYEEMKMKIMEDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVHQIYPQAINAVGSRDTFVGRIRKDLEKGIHMWVVSDNLLKGAAWNSVQIAETLHGLVRPTAELKFEL.. 357
15 -75.9003hsk_A mol:protein length:381 Aspartate-semialdehyde dehydrogenase  ali model follow..  17  14KKAGVLGATGSVGQRFILLLSKHPEFEIHALASSRSAGKKYKDAASWKQTEQDIVVQECKPEGNFLECDVVFSGLDADVAGDIEKSFVEAGLAVVSNAKNYRREKDVPLVVPIVNPEHIDVVENKV---KGGKKPGFIICISNCSTAGLVAPLKPLVEKFGIDALTTTTLQAISGAGFSPGV-SGMDILDNIVPYISGEEDKLEWETKKILGGVNASEMKVSAQCNRVPVIDGHTECISLRFANAPSVEDVKQCLREYECAASKLGCRPQPRLDRDRDSGYGVSVGRIREDSLLDFKMVVLSHNTIIGAAGAGILIAEILKA.............. 371
16 -75.6002qz9_A mol:protein length:336 Aspartate-semialdehyde dehydrogenase  ali model follow..  18  4FNVAIFGATGAVGETMLEVLQERPVDELFLLASERSEGKTYRFNGKTVR-------VQNVEEFDWSQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIA-----------EFRNRNIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQQIAFNCIPQNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIE-LFRGADFPTQVRDAGGKDHVLVGRVRNDIHSGINLWVVADNVRKGAATNAVQIAELLV............... 332
17 -75.3001ys4_A mol:protein length:354 Aspartate-semialdehyde dehydrogenase  ali model follow..  19  9IKVGVLGATGSVGQRFVQLLADHPMFELTALASERSAGKKYKDACYWFQDRDMVVIPTDPKHEEFEDVDIVFSALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDVPLVIPEVNAD----HLELIEIQREKGWDGAIITNPNCSTICAVITLKPIMDKFGLEAVFIATMQAVSGAGYNGVPSMAILD--NLIPFIKNEEEKMQTESLKLLGTVELANFKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVMDKFYAKPIVIREEIDQPRLDRNEGNGMSIVGRIRKDPIFDVKYTALEHNTIRGAAGASVLNAEYFVK----KYI....... 354
18 -74.1005jw6_A mol:protein length:371 Aspartate-semialdehyde dehydrogenase  ali model follow..  18  7KKCGVLGATGSVGQRFILLLADHPFLELHAIASNRSAGKKYKDAVRWKQTRLSNLVLRDCRADQFSDCDLVFSGLNSDVAGEIEMEFIKAEIPVFSNAKNYRKHPLVPLVVPTVNPQHLDLIPHQRKE--FGLKKGFLVCNSNCAVIGVVIPFAALQAKFGVEEVEVFTEQAVSGAGYPGVPSMDIMD--NVIPYISGEEDKLENEAQKILGSLNADGLTVGATCTRVGVTDGHMAFVSLRFKNGPSAEEVKQAMREYQSEAQKLGCRPQPRLDRDISKGYTVSVGRVREASYFDLRFAALSHNTVIGAAGSSILNAEVAVI.............. 359
19 -72.4001nwc_A mol:protein length:371 Aspartate-semialdehyde dehydrogenase  ali model follow..  12  2KNVGFIGWRGMVGSVLMDRMSQENDFENLNPTTSQAGQKAPV-----FGGKDAGDLKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISE---------GLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELFGAALGGSLIPWETGQTKEEWKGYAETNKILGNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKRELTPAKVTGTLSVPVGRLRKLAPEYLAAFTVGDQLLWGAAEPVRRILKQLVA.............. 371
20 -72.4002hjs_A mol:protein length:340 USG-1 protein homolog  ali model follow..  17  7LNVAVVGATGSVGEALVGLLDERPLHRLHLLASAESAGQRMGFAESSLR-------VGDVDSFDFSSVGLAFFAAAAEVSRAHAERARAAGCSVIDLSGALEPSVAPPVM----------------AERLASQAAPFLLSSPCAVAAELCEVLAPLLATLDCRQLNLTACLSVSSLGREGVKELFDRQIAFNLLAVGAVDAEGHSAIERRIFALGERIGPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKGIE-WVGEGDYPTVVGDALGQDETYVGRVRAGQPCQVNLWIVSDNVRKGAALNAVLLGELL--IKHYLG........ 339
21 -72.2005bnt_C mol:protein length:378 Aspartate-semialdehyde dehydrogenase  ali model follow..  13  4KRVGLIGWRGMVGSVLMQRMLEERDFEPVFFTTSNVGGQGPEVGKDIA------PLKDAYSIDELKTLDVILTCQGGDYTSEVFPKLREAGGYWIDAASSLRMEDDAVIVLDPVNRKVIDQ---------ALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELFGAPLGGSLIPWPNGQSREEWKAQAETNKILANPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHNPWVKLVPNHRRELTPAAVTGTLSVPVGRLRKLNSQYLGAFTVGDQLLWGAAEPLRRMLRILLE.............. 371
22 -71.9003uw3_A mol:protein length:377 Aspartate-semialdehyde dehydrogenase  ali model follow..  13  5MNVGLVGWRGMVGSVLMQRMQEEGDFDLIEPSTSNAGGKAPSFAKNET------TLKDATSIDDLKKCDVIITCQGGDYTNDVFPKLRAANGYWIDAASSLRMKDDAVIILDPVNLNVIKD---------ALVNGTKNFIGGNCTVSLMLMALGGLFRENLVDWMTAMTYQAASGAGAQNMRELQMGTLNGAVAAQLADPASAILDIDRRVLAAMNGSVPVDGLCVRIGAMRCHSQALTIKLKKDVPLDEINGILASANDWVKVVPNSMRDLSPAKVTGTLSVPVGRLRKLAGEYLSAFTVGDQLLWGAAEPLRRMLRILLD.............. 376
23 -71.7004r5m_A mol:protein length:376 Aspartate-semialdehyde dehydrogenase 1  ali model follow..  14  1MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPN----GKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGGYWIDAASTLRMDKEAIITLDPVNLKQILH---------GIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELQMGVINDAVSSELANPASSILDIDKKVAETMDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERRELTPAKVTGTLSVPVGRLRKMADDFLNAFTVGDQLLWGAAEPLRRTLRIILAEK............ 370
24 -70.6006bac_A mol:protein length:379 Aspartate-semialdehyde dehydrogenase  ali model follow..  13  3MKVGFVGWRGMVGSVLMQRMKEENDFAHIPEAFFFTSSNVGGAAPDFGQA--AKTLLDANDVAELAKMDIIVTCQGGDYTKSVFQALRDSGWNGIDAASSLRMKDDAIIALDPVNRNVIDN---------GLKNGVKNYIGGNCTVSLMLMALGGLFQNDLVEWATSMTYQAASGAGAKNMRELGMGAIHAQVADELADPSSAILDIDRKVSDFLGNPTVIDGLCVRIGAMRCHSQAITLKLKKDLPVSEIEAILAGANDWVKVVPNEKRELTPAKVTGTLSVPVGRIRKLGGEYISAFTVGDQLLWGAAEPMRRVLRIVLG.............. 371
25 -69.0001brm_A mol:protein length:367 ASPARTATE-SEMIALDEHYDE DEHYDROGENASE  ali model follow..  14  2KNVGFIGWRGMVGSVLMQRMVEERDFRPVFFSTSQLGQAAPSFGGTTG------TLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITD---------GLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELFGVPLAGSLIPWDNGQSREEWKGQAETNKILNSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDRRELTPAAVTGTLTTPVGRLRKLNPEFLSAFTVGDQLLWGAAEPLRRMLRQL................ 366
26 -67.1003vos_A mol:protein length:362 Aspartate-semialdehyde dehydrogenase  ali model follow..  18  14LSIGIVGATGQVGQVMRTLLDERPASAVRFFASARSQGRKLAFRGQEIE-------VEDAETADPSGLDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFERDA-----------HRRPKGIIANPNCTTMAAMPVLKVLHDEARLVRLVVSSYQAVSGSGLAGVAELYVAPIAFNVVPLGSLVDDGSGETDEDQKLLGIPDLLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVDV-----PTPLAAAGVDESLVGRIRRDDGRGLALFVSGDNLRKGAALNTIQIAELLTA.............. 354
27 -64.4004woj_A mol:protein length:370 Aspartate semialdehyde dehydrogenase  ali model follow..  16  2LKVGFIGWRGMVGSVLMSRMIESKDFDCILPTFFSTSQVGQLPTG----MQQYGALQDAYSIDQLSSMDILLSCQGGEYTKEIHHKLREAGGFWIDAASTLRLDKDSTLVLDPLNHDQIINA---------IDNGKKDFIGSNCTVSLMSLAIAGLLKEDLVEWVNSSTYQAISGAGAAAMQELTVQTLAYNLLPWPSGQTKEEYKAATELNKILDKTIPVDGICVRVPSLRSHSQALTVKLRQKLTIEEIKQKISQGNEWVKVIDNNKKYLTPQANSGTLDIAIGRIKSSLDDIFHCFTVGDQLLWGAAEPLRRVLNII................ 362
28 -31.8001cf2_P mol:protein length:337 PROTEIN (GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE)  ali model follow..  10  2KAVAING-YGTVGKRVADAIAQQDDMKVIGVSKTRPDFEARMALKKGYDLYVAIIEVAGTVDDMLDEADIVIDCTPEGIGAKNLKMYKEKGIKAIFQGG---------------EKHEDIGLSFNSLSNYEESYGKDYTRVVSCNTTGLCRTLKPLHDSFGIKKVRAVIVRRGADPAQVSKG-----PINAIIPNPPKLPSHHGPDVKTVL------DINIDTMAVIVPTTLMHQHNVMVEVEETPTVDDIIDVFEDT-PRVILISAEDGLTSTAEIMEFEIPVWRESITVVDNEIYYMQAVHQ-MEEDKYKSINKTNKAMNILQ........... 337
29 -29.2001b7g_O mol:protein length:340 PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE)  ali model follow..  11  2VNVAVNG-YGTIGKRVADAIIKQPDMKLVGVAKTSPNYEAFIAHRRGIRIYVPQQSIKKFEEDLIKTSDIVVDTTPNGVGAQYKPIYLQLQRNAIFQGG---------------EKAEVADISFSALCNYNEALGKKYIRVVSCNTTALLRTICTVNKVSKVEKVRATIVRRAADQKEVKKG-----PINSLVPDPATVPSHHAKDVNSVI-----RNLDIATMAVIAPTTLMHMHFINITLKDKVEKKDILSVLENT.............................................................................. 243
30 -29.1002czc_A mol:protein length:334 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  14  3VKVGVNG-YGTIGKRVAYAVTKQDDMELIGITKTKPDFEAYRAKELGIPVYAASFEVAGTLNDLLEKVDIIVDATPGGIGAKNKPLYEKAGVKAIFQGG---------------EKADVAEVSFVAQANYEAALGKNYVRVVSCNTTGLVRTLSAIREYADYVYAVMIRRAADPNDTKRGPIN--------AIKPTVEVPSHHGPDVQTVI------PINIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFENTTRVL-LFEKEKGFDSTAQIIEYEIAVWKESINIKGNRLFYIQAVHQFELADKWDSIKKTNKSLGILK........... 334
31 -23.9002yyy_A mol:protein length:343 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  12  3AKVLING-YGSIGKRVADAVSMQDDMEVIGVTKTKPDFEARLAVEKGYKLFVAIPDNERVKLDIIEDADIVVDGAPKKIGKQNLENIYKPHKVKAILQGG--------------EKAKDVEDNFNALWSYNRCYGKDYVRVVSCNTTGLCRILYAINSIADIKKARIVLVRRAADPNDDKT-----GPVNAITPNPVTVPSHHGPDVVSVVPEF---EGKILTSAVIVPTTLMHMHTLMVEVDGDVSRDDILEAIKKTPRII-TVRAEDGFSSTAKIIENELVVWEESINVLENEIFLMQAVHQ---IVIPENIDCIRAMLQMNKAMGIQ...... 343
32 -19.2001nvm_B mol:protein length:312 acetaldehyde dehydrogenase (acylating)  ali model follow..  14  5LKVAIIGS-GNIGTDLMKVLRNAKYLEMGAMIDAASDGLARAQRM---VTTTYAGVEGLIKLPEFADIDFVFDATSASAHVQNEARQAKPGIRLIDLTPA----AIGPYCVPVVNLEEHLGK-----------LNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEF........................................................................................................................................................ 175
33 -18.8004jn6_B mol:protein length:306 Acetaldehyde dehydrogenase  ali model follow..  11  8AKVAIVG-SGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVDWLLAQP--DKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPA----AVGPAVIPPANLREHLDA-----------PNVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRA------------NIDEFTKTTARGVQTIGGAAR------GKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQYRLLNEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNL-DIMTAAATKVGEEI................ 295
34 -18.5004iq8_A mol:protein length:340 Glyceraldehyde-3-phosphate dehydrogenase 3  ali model follow..  14  4VRVAING--GRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERDPANLPWGSSNVD---IAIDSTGVFKIDAGAKKVVITAPSSTAPMFVMGVNE-EKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTATGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQG------KLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLVLGYTEDAVVSSDFLGDSHSSISAGIQLSPKFVKLVSWYDN---GYSTRVVDLVEHV................ 331
35 -18.2004k9d_A mol:protein length:347 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  13  6PKVGING--GRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMYDSTHGRFKGSVSAEGGKLIVTNGKTTHHISVHNSKDPAEIPWGVDGAYVVESTGVFTLKGGAKKVIISAPSADAPMFVMGVNNDTYDKANNHIISNASCTTNCLAPLAKVIHDKFGIIEGLMTTVHATTATGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPDLNG------KLTGMAFRVPTPDVSVVDLTCRLQKGATMDEIKAAVKEAANGPMILEYTEDQVVSTDFTGDTHSSILACISLNPNFVKLIAWYDN---GYSNRVVDLISYI................ 338
36 -18.1003h9e_O mol:protein length:346 Glyceraldehyde-3-phosphate dehydrogenase, testis-specific  ali model follow..  14  8LTVGING--GRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSP---YVVESTGVYLISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKG------KLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMILAYTEDEVVSTDFLGDTHSSIKAGIALNDNFVKLISWYDN---GYSHRVVDLLRYMFSRDAEN......... 342
37 -18.1006dfz_A mol:protein length:332 glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  15  1VKVGING--GRIGRLVMRASLEHPEVQVVAVNDPFIDLEYMEYMYDSTHGRFKGTTEVKDGKLVINGNPISVYALKDPAAIPWKEAGAD---FVVESTGVFTLHGGAKKVIISAPSADAPMFVMGVNEKTYDAATMNVVSNASCTTNCLAPLAKVINDNFGIEEGLMTTIHAYTATGPSGKKWRDGRGANQNVIPATTGAAKAVGKVIPELNG------KLTGMAFRVPVPDVSVVDLTCRLKKPTSYEEIKKVVKKASETDLFLAYTEDQVVSSDFISDTHSSVLAGIQLNPTFVKLVSWYDN---GYSHRVVDLIEYM................ 329
38 -18.1005tso_P mol:protein length:333 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  13  2VKVGVNG--GRIGRLVTRAAFNSGKVDIVAINDPFIDLHYMVYMYDSTHGKFHGTVKAENGKLVINGKAITIFQERDPANIKWGDAGAT---YVVESTGVFTLKGGAKRVIISAPSADAPMFVMGVNH-EKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNG------KLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLILGYTEDQVVSCDFNSDTHSSTGAGIALNDHFVKLISWYDN---GYSNRVVDLMVHMASKE............ 333
39 -18.0004o59_O mol:protein length:332 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  12  1VKVGVNG--GRIGRLVTRAAFNSGKVDIVAINDPFIDLHYMVYMYDSTHGKFNGTVKAENGKLVINGKAITIFQERDPANIKWGDAGAE---YVVESTGVFTLKGGAKRVIISAPSADAPMFVMGVNH-EKYNNTLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNG------KLTGMAFRVPTPNVSVVDLTCRLEKPAKYDEIKKVVKQASEGPLILGYTEDQVVSCDFNSDTHSSTGAGIALNDHFVKLISWYDN---GYSNRVVDLMVHMASKE............ 332
40 -18.0002i5p_O mol:protein length:342 Glyceraldehyde-3-phosphate dehydrogenase 1  ali model follow..  12  9VSIAING--GRIGRLVLRIALERKNIDVVAINDPFISVDYAAYMYDSTHGKYKGEVSHDGSNLIINGKKVAVFQEKDPATLPWGKLGVD---IAVDSTGVFKELDSAQKHIDAITAPSKTAPMFVVGVNEDKYNGEKIVSNASCTTNCLAPIAKIINDEFGIEEGLMTTVHSITATGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQG------KLTGMAFRVPTTDVSVVDLTVKLVKAATYDEIKAAVKKVSEGKLVVGYTEDAVVSSDFLGDTHSTIAAGIQLSPKFVKLVAWYDN---GYSTRVVDLVEHV................ 335
41 -17.9001vsu_A mol:protein length:359 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  12  17ATLGING--GRIGRLVLRACMERNDITVVAINDPFMDVEYMAYLYDSVHGNFNGTVEVSGKDLCINGKVVKVFQAKDPAEIPWGASGAQ---IVCESTGVFTTEEKA-VIISAPPKDNVPMYVMGVNNTEYDPSKFNVISNASCTTNCLAPLAKIINDKFGIVEGLMTTVHSLTGPSKGGKDWRAGRCAGNNIIPASTGAAKAVGKVIPALNG------KLTGMAIRVPTPDVSVVDLTCKLAKPASIEEIYQAVKEASNGPMIMGYTSDDVVSTDFIGCKYSSINACIALNDSFVKLISWYDN---GYSNRLVDLAVYV................ 348
42 -17.9003gpd_R mol:protein length:334 D-GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  13  3VKVGVDG--GRIGRLVTRAAFNSGKVDIVAINDPFIDLHYMVYMYDSTHGKFHGTVKAEDGKLVIDGKAITIFQERDPENIKWGDAGTA---YVVESTGVFTLKGGAKRIVISAPSADAPMFVMGVNH-FKYANSLKIISNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATSPSGKLWRGGRGAAQNLIPASTGAAKAVGKVIPELDG------KLTGMAFRVPTANVSVLDLTCRLEKPAKYDDIKKVVKEASEGPLILGYTEDEVVSDDFNGSNHSSIGAGIELNDTFVKLVSWYDN---GYSERVVDLMAHMASKE............ 334
43 -17.8002vyn_D mol:protein length:334 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  15  2VKVGING--GRIGRLVLRVCMEKGVRVVAVNDPFIDPEYMVYMFYDSTHGRYKGTVEHKNGRLVVDNLEINVFQCKEPKEIPWSSVGNP---YVVEATGVYLISSGARRVIVTAPSPDAPMLVMGVNEKDYNPGSMTVVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHAYTATGPSKKDWRGGRGAHQNIIPSSTGAAKAVGKVIPELNG------KLTGMAFRVPTPNVSVVDLTCRLAQPASYTAIKEAVKAAAKGPMILAYTEDQVVSTDFNGDSHSSIKAGIALNDNFVKLVSWYDN---GYSHRVVDLLRYMFSREK........... 334
44 -17.8001znq_O mol:protein length:338 Glyceraldehyde-3-phosphate dehydrogenase, liver  ali model follow..  12  7VKVGVNG--GRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAE---YVVESTGVFTLQGGAKRVIISAPSADAPMFVMGVNH-EKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNG------KLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLILGYTEHQVVSSDFNSDTHSSTGAGIALNDHFVKLISWYDN---GYSNRVVDLMAHMASKE............ 338
45 -17.7004p8r_A mol:protein length:339 Glyceraldehyde 3-phosphate dehydrogenase, cytosolic  ali model follow..  13  5IRVGING--GRIGRVVFRAAQRRNDIEIVGINDLLDADYMAYMLYDSTHGRFEGAVEVQGGALVVNGKKIRVTSERDPANLKWNEINVD---VVVESTGLFLIQAGAKKVVITGPSKDDTPMFVMGVN-HTTYKGEAIVSNASCTTNCLAPLAKVLNDKFGIVEGLMTTVHATTATGPSQKDWRGGRGAAQNIIPSSTGAAKAVGKIIPSLNG------KLTGMAFRVPTPNVSVVDLTVRLERPATYKQICDAIKAASEGELILGYVDEEIVSSDINGIPLTSVRAGISLNDNFVKLVSWYDN---GYSNKVLDLIAHI................ 331
46 -17.7003cps_A mol:protein length:354 Glyceraldehyde 3-phosphate dehydrogenase  ali model follow..  12  12GTLGING--GRIGRLVLRACMERNDITVVAINDPFMDVEYMAYLYDSVHGNFNGTVEVSGKDLCINGKVVKVFQAKDPAEIPWGASGAQ---IVCESTGVFTTEEKA-VIISAPPKDNVPMYVMGVNNTEYDPSKFNVISNASCTTNCLAPLAKIINDKFGIVEGLMTTVHSLTGPSKGGKDWRAGRCAGNNIIPASTGAAKAVGKVIPALNG------KLTGMAIRVPTPDVSVVDLTCKLAKPASIEEIYQAVKEASNGPMIMGYTSDDVVSTDFIGCKYSSINACIALNDSFVKLISWYDN---GYSNRLVDLAVYV................ 343
47 -17.4003vaz_P mol:protein length:344 Glyceraldehyde-3-phosphate dehydrogenase 1  ali model follow..  12  5VKVAING--GRIGRLAFRRIQEVEGLEVVAVNDLTDDDMLAHLLYDTMQGRFTGEVEVVDGGFRVNGKEVKSFSEPDASKLPWKDLNID---VVLECTGFYTIEAGAKKVLISAPATGDLKTIVFNTNHQELDGSETVVSGASCTTNSLAPVAKVLNDDFGLVEGLMTTIHAYTGDQNRKGDKRRARAAAENIIPNSTGAAKAIGKVIPEIDG------KLDGGAQRVPVATGSLTELTVVLEKQDVTVEQVNEAMKN-ASNESFGYTEDEIVSSDVVGMTYGSL-VMSVGDRQLVKVAAWYDN---SYTAQLVRTLAYLAELSK........... 338
48 -17.4004z0h_O mol:protein length:334 Glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic  ali model follow..  14  2IRIGING--GRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKY-QWKHNELKIKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGAD---YVVESTGVFTLKGGAKKVVISAPSKDAPMFVVGVNE-HEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNG------KLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLILGYTEDDVVSTDFVGDNRSSIKAGIALSDKFVKLVSWYDN---GYSSRVVDLIVHM................ 331
49 -17.3003e5r_O mol:protein length:337 Glyceraldehyde-3-phosphate dehydrogenase, cytosolic  ali model follow..  14  4IKIGING--GRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKY-QWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAE---YVVESTGVFTLKGGAKKVVISAPSKDAPMFVCGVNE-DKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNG------KLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLIIGYVEEDLVSTDFVGDSRSSIKAGIALNDNFVKLVAWYDN---GYSNRVIDLIRHM................ 333
50 -17.3004qx6_A mol:protein length:356 Glyceraldehyde 3-phosphate dehydrogenase  ali model follow..  13  17VKVGING--GRIGRLAFRRIQNVEGVEVTRINDLTDPNMLAHLLYDTTQGRFDGTVEVKEGGFEVNGQFVKVSAEREPANIDWATDGVE---IVLEATGFFASKEKA-KVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALQDNFGVKQGLMTTIHAYTGDQMILDGPHRGGDGAANIVPNSTGAAKAIGLVIPELNG------KLDGAAQRVPVPTGSVTELVATLEKDVTVEEVNAAMKAAAND--SYGYTEDPIVSSDIVGISYGSL-VQTVDGNQLVKVVSWYDN---SYTSQLVRTLEYFAKIAK........... 350
51 -17.3002d2i_A mol:protein length:380 glyceraldehyde 3-phosphate dehydrogenase  ali model follow..  14  3IRVAING--GRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHYDSVLGRFNADISYDENSITVNGKTMKIVCDRNPLNLPWKEWDID---LVIESTGVFVTAEGASKHIQAGKAEGVGTYVIGVNDSEYRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTTTHSYTLDDASHRDLRRARAAAVNIVPTTTGAAKAVALVIPELKG------KLNGIALRVPTPNVSVVDLVVQVEKPTITEQVNEVLQKASQTTMIIKYSDLPLVSSDFRGTDESSISLTLVMDGDLVKVIAWYDN---GYSQRVVDLAELAARKSGRLGL....... 342
52 -17.3003b1j_A mol:protein length:339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+)  ali model follow..  14  3IRVAING--GRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHYDSVLGRFNADISYDENSITVNGKTMKIVCDRNPLNLPWKEWDID---LVIESTGVFVTAEGASKHIQAGKGEGVGTYVIGVNDSEYRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTTTHSYTLDQRSHRDLRRARAAAVNIVPTTTGAAKAVALVIPELKG------KLNGIALRVPTPNVSVVDLVVQVEKPTITEQVNEVLQKASQTTMIIKYSDLPLVSSDFRGTDESSISLTLVMDGDLVKVIAWYDN---GYSQRVVDLAELA................ 333
53 -17.2001dbv_O mol:protein length:334 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  14  2VKVGING--GRIGRNVFRAALKNPDIEVVAVNGLTDANTLAHLLYDSVHGRLDAEVSVNGNNLVVNGKEIIVKAERDPENLAWGEIGVD---IVVESTGRFTKREDA-VIISAPAKNEDITIVMGVNQDKYDPKAHHVISNASCTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDDASHKDLRRARAAAESIIPTTTGAAKAVALVLPELKG------KLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELILAYSEEPLVSRDYNGSTVSSTLSTMVIDGKMVKVVSWYDN---GYSHRVVDLAAYI................ 329
54 -17.2004mvj_A mol:protein length:355 Glyceraldehyde-3-phosphate dehydrogenase A  ali model follow..  13  21IKVGING--GRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLYDSTHGRFDGTVEVKDGHLIVNGKKIRVTAERDPANLKWDEVGVD---VVAEATGLFLITAGAKKVVMTGPSKDNTPMFVKGAN-FDKYAGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATTATGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNG------KLTGMAFRVPTPNVSVVDLTVRLEKAATYEQIKAAVKAAAEGEMVLGYTEDDVVSTDFNGEVCTSVKAGIALNDNFVKLVSWYDN---GYSNKVLDLIAHI................ 347
55 -17.2001crw_G mol:protein length:333 D-GLYCERALDEHYDE-3-PHOSPHATE-DEHYDROGENASE  ali model follow..  13  2.KIGING--GRIGRLVLRAALEMGAQVVAVNDPFIALEYMVYMFYDSTHGMFKGEVKAEDGALVVDGKKITVFNEMKPENIPWSKAGAE---YIVESTGVFTFKGGAKKVIISAPSADAPMFVCGVNL-EKYSKDMKVVSNASCTTNCLAPVAKVLHENFEIVEGLMTTVHAVTATGPSAKDWRGGRGAAQNIIPSSTGAAKAVGKVIPELDG------KLTGMAFRVPTPNVSVVDLTVRLGKECSYDDIKAAMKAASEGPLVLGYTEDDVVSCDFTGDNRSSIKAGIQLSKTFVKVVSWYDN---GYSQRVIDLIKHMQKVDSA.......... 333
56 -17.2005ur0_A mol:protein length:349 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  12  12VKIGING--GRIGRLVFRASLERTDVEVVAINDIMMTPEYMIYMYDTVHGKFHGKLEHTEKSIIVNGREIHVLCERDPEQLPWGQHNVE---YVVESTGIFTKLDSAAKHLKGSAPADTPTFVMGVNN-HEYKPEMTVINNASCTTNCLAPIAAVLHENFGIVEGLMTTVHAVTATAPSRKDWRGGRAAGYNIIPSSTGAAKAVGLVIPSLNG------KLTGMAFRVPTVDVSVVDLTCRLEKPATKKQIDEAMKAASESERFLKFTDEEVVSSDFVHDSASSTKASICLNEHFVKVVAWYDN---GYSNRVLDLIKSTAKIQ............ 343
57 -17.1001npt_O mol:protein length:334 Glyceraldehyde 3-phosphate dehydrogenase  ali model follow..  14  2VKVGING--GRIGRNVFRAALKNPDIEVVAVNDLTDANTLAHLLYDSVHGRLDAEVSVNGNNLVVNGKEIIVKAERDPENLAWGEIGVD---IVVESTGRFTKREDA-VIISAPAKNEDITIVMGVNQDKYDPKAHHVISNASATTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDQRPHKDLRRARAAAESIIPTTTGAAKAVALVLPELKG------KLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELILAYSEEPLVSRDYNGSTVSSTLSTMVIDGKMVKVVSWYDN---GYSHRVVDLAAYI................ 329
58 -17.1003dbv_O mol:protein length:334 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  14  2VKVGING--GRIGRNVFRAALKNPDIEVVAVNDTGGANTLAHLLYDSVHGRLDAEVSVNGNNLVVNGKEIIVKAERDPENLAWGEIGVD---IVVESTGRFTKREDA-VIISAPAKNEDITIVMGVNQDKYDPKAHHVISNASCTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDDASHKDLRRARAAAESIIPTTTGAAKAVALVLPELKG------KLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELILAYSEEPLVSRDYNGSTVSSTLSTMVIDGKMVKVVSWYDN---GYSHRVVDLAAYI................ 329
59 -16.9005y37_A mol:protein length:344 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  13  7VKVGING--GRIGRLAFRRIQNVEGVEVTRINDLTDPNMLAHLLYDTTQGRFDGTVEVKEGGFEVNGQFVKVSAEREPANIDWATDGVE---IVLEATGFFASKEKA-KVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALQDNFGVKQGLMTTIHAYTGDQMILDGPHRGGDGAANIVPNSTGAAKAIGLVIPELNG------KLDGAAQRVPVPTGSVTELVATLEKDVTVEEVNAAMKAAYTEDPIVSSDIVGISYGSLFDATQTKVQTVDGN--QLVKVVSWYDN---SYTSQLVRTLEYFAKIAKAAA........ 343
60 -16.9002b4r_O mol:protein length:345 glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  12  6TKLGING--GRIGRLVFRAAFGRKDIEVVAINDPFMDLNHLCYLYDSVHGQFPCEVTHADGFLLIGEKKVSVFAEKDPSQIPWGKCQVD---VVCESTGVFLTKELA-VIMSAPPKDDTPIYVMGINHHQYD-TKQLIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHASTGPSKGGKDWRAGRCALSNIIPASTGAAKAVGKVLPELNG------KLTGVAFRVPIGTVSVVDLVCRLQKPAKYEEVALEIKKAAEGPLILGYTEDEVVSQDFVHDNRSSIKAGLALNDNFFKLVSWYDN---GYSNRVLDLAVHI................ 336
61 -16.9002ep7_A mol:protein length:342 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  13  3IKVGING--GRIGRSFFRASWGREEIEIVAINDLTDAKHLAHLLYDSVHGIFKGSVEAKDDSIVVDGKEIKVFAQKDPSQIPWGDLGVD---VVIEATGVFRDRENA-VIITAPAKNPDITVVLGVNEEKYNPKEHNIISNASCTTNCLAPCVKVLNEAFGVEKGYMVTVHAYTNDQRPHKDFRRARAAAINIVPTTTGAAKAIGEVIPELKG------KLDGTARRVPVPDGSLIDLTVVVNKAPSSVEEVNEKFREAAQKYRESGKVYLKEILQYCEDPIVSTDIVGNPHSNLVHIAAWYDN---GYSCRLRDLVIYL................ 337
62 -16.9004dib_A mol:protein length:345 Glyceraldehyde 3-phosphate dehydrogenase  ali model follow..  11  5TRVAING--GRIGRMVFRQAIKESAFEIVAINASYPSETLAHLIYDTVHGKFDGTVEAFEDHLLVDGKMIRLLNNRDPKELPWTDLGVE---VVIEATGKFNSKEKA-VILTAPGKNEDVTIVVGVNEDQLDITKHTVISNASCTTNCLAPVVKVLDEQFGIENGLMTTVHAYTNDQKPHKDLRRARACGQSIIPTTTGAAKALAKVLPHLNG------KLHGMALRVPTPNVSLVDLVVDVKRDVTVEAINDAFKTVANGALIVEFSEEPLVSIDFNTNTHSAILSTMVMGDRKVKVLAWYDN---GYSRRVVDLVTLV................ 332
63 -16.8003sth_A mol:protein length:361 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  13  18CKLGING--GRIGRLVFRAAMERGDVEVLAINDPFMSLDYMVYLYDSVHGHYPGEVSHKDGKLIVGGKAVTVFNEKEPTAIPWGQAGVH---YICESTGIFLTKEKA-VIMSAPPKDDTPMFVMGVNNDQYK-SSDVIVSNASCTTNCLAPLAKIVHDKFGIVEGLMTTVHAMTGPSKGGKDWRAGRSAGVNIIPASTGAAKAVGKIIPSLNG------KLTGMAFRVPVPDVSVVDLTCKLAKPAKYEDIVAAVKEAATSGPMISYTDEEVVSSDFVHCKFSSVNAGIMLNDTFVKLVSWYDN---GYSNRLVELAHYMSVQDGA.......... 355
64 -16.8003l0d_A mol:protein length:356 Glyceraldehyde 3-phosphate dehydrogenase  ali model follow..  11  18VRVAING--GRIGRNILRAIIESGRQDIEVVALNDLGSVETNAHYDSVHGCFPGTVQVVGDAIDIGSSLIKVFAERDPAQLPWKALDID---IALECTGIFTLDAGAKRVLVSAPSEGADLTVVYGVNHQFLSKEHHVISNASCTTNCLAPVAQVLHNTVGIEKGFMTTIHSYTGDQPMHRDLYRARAAALSMIPTSTGAAKAVGLVLPELK-------LLDGVSIRVPTPNVSVVDLTFTAKRSTTIEEINTAIRTAAQGSLILDYTDEKLVSCDFNHNPHSAIDQTKVIDGQLCRVLVWYDN---GFSNRMCDTAVAF................ 346
65 -16.7001vc2_A mol:protein length:331 Glyceraldehyde 3-Phosphate Dehydrogenase  ali model follow..  14  1MKVGING--GRIGRQVFRILHERGVEVALINDLTDNKTLAHLLKYDSTYGRFPGAVGYDEENLYVDGKAIRATAIKDPREIPWKQAGVG---VVVESTGVFTDGEKA-VIITAPAKNEDITVVLGVNHEQYDPAKHHILSNASCTTNSLAPVMKVLEKAFGVEKALMTTVHSYTNDDLPHKDLRRARAAALNIIPTTTGAAKATALVLPSLKG------RFDGMALRVPTPTGSISDITALLKREVTAEEVNAALKAAAEGPLILAYTEDEIVLRDIVMDPHSSIGKLTKAIGNLVKVFAWYDN---GYANRVADLVELV................ 326
66 -16.6004lsm_A mol:protein length:346 Glyceraldehyde 3-phosphate dehydrogenase, cytosolic  ali model follow..  12  11IKIGING--GRIGRMVFRAAQHRNDIEIVGINDLLDADYMAYMLYDSTHGRYGGMVEVREGALVVNGKKIRVTSERDPANLKWNEVGAV---VVVESTGLFLIQAGAKKVVMTGPPKDDTPMFVMGVN-NTMYKGQEIVSNASCTTNCLAPLAKIIHEKFGIVEGLMTTVHATTATGPSQKDWRGGRGAAQNIIPSATGAAKAVGKVIPALNG------RLTGMAFRVPTPNVSVVDLTARLERPATYEQICAAIKAASEGELILGYTEDEVVSTDMNGVALTSVKAGISLNDRFVKLISWYDN---GYSHKVLDLVAYI................ 337
67 -16.6001gpd_G mol:protein length:334 D-GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  14  3.KIGING--GRIGRLVLRAALSCGAQVVAVNDPFIALEYMVYMFYDSTHGVFKGEVKMEDGALVVDGKKITVFNEMKPENIPWSKAGAE---YIVESTGVFTFKGGAKKVVISAPSADAPMFVCGVNL-EKYSKDMTVVSNASCTTNCLAPVAKVLHENFEIVEGLMTTVHAVTATGPSAKDWRGGRGAAQNIIPSSTGAAKAVGKVIPELDG------KLTGMAFRVPTPDVSVVDLTVRLGKECSYDDIKAAMKTASEGPLFLGYTEDDVVSSDFIGDNRSSIKAGIQLSKTFVKVVSWYDN---GYSQRVIDLLKHMQKVDSA.......... 334
68 -16.6005c7i_O mol:protein length:333 Glyceraldehyde-3-phosphate dehydrogenase, testis-specific  ali model follow..  14  2LTVGING--GRIGRLVLRVCMEKGIRVVAVNDPFIDPEYMVYMFYDSTHGRYKGNVEHKNGQLVVDNLEINTYQCKDPKEIPWSSIGNP---YVVECTGVYLISSGARRVVVTAPSPDAPMFVMGVNEKDYNPGSMTIVSNASCTTNCLAPLAKVIHENFGIVEGLMTTVHSYTATGPSKKDWRGGRGAHQNIIPSSTGAAKAVGKVIPELKG------KLTGMAFRVPTPNVSVVDLTCRLAKPASYSAITEAVKAAAKGPLILAYTEDQVVSTDFNGNPHSSIKAGIALNDNFVKLVAWYDN---GYSNRVVDLLRYMFSRE............ 333
69 -16.6005m6d_A mol:protein length:355 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  12  17VKVGING--GRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLLYDTTQGRFDGTVEVKEGGFEVNGKFIKVSAERDPEQIDWATDGVE---IVLEATGFFALKGGAKKVVITAPGGNDVKTVVFNTNHDVLDGTETVISGASCTTNCLAPMAKALQDNFGVVEGLMTTIHAYTGDQMILDGPHRGGDGAANIVPNSTGAAKAIGLVIPELNG------KLDGSAQRVPTPTGSVTELVAVLEKNVTVDEVNAAMKA--ASNESYGYTEDPIVSSDIVGMSYGSL-VLDVDGKQLVKVVSWYDN---SYTAQLVRTLEYFAKIAK........... 349
70 -16.5006DW9 Entity 1(prereleased)  ali follow..  13  1MRIVING--GRIGRLVLRQILKRNSPIEVVAINDLVAGDLLTYLYDSTHGSFAPQATFSDGCLVMGERKVHFLAEKDVQKLPWKDLDVD---VVVESTGLFVNRDDV-VLITAPAKGDVPTFVMGVNH-QQFDPADVIISNASCTTNCLAPLAKVLLDNFGIEEGLMTTVHAATATGPSRKDWRGGRGAFQNIIPASTGAAKAVGLCLPELKG------KLTGMAFRVPVADVSVVDLTVKLSSATTYEAICEAVKHAANTSMIMYYTEEAVVSSDFIGCEYSSVQAGVALNDRFFKLVAWYDN---GYATRIVDLLEYV................ 329
71 -16.4002pkr_O mol:protein length:365 Glyceraldehyde-3-phosphate dehydrogenase Aor  ali model follow..  14  2LKVAING--GRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHYDSILGTFDADVKTAGDSAISVDIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAP--------------GKGDIPTYVVGVNEEGYT-HADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRSHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKG------KLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELILSVCDEPLVSIDFRCTDVSSTSLTMVMGDDMVKVIAWYDN---GYSQRVVDLADIV................ 331
72 -16.3001obf_O mol:protein length:335 GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE  ali model follow..  13  2IRVAING--GRIGRNILRAHYEGGKSHDIEIVAINDLGDPKTNAHDTAHGKFPGTVSVNGSYMVVNGDKIRVDANRNPAQLPWGALKVD---VVLECTGFFTTKEKAGAHIKGGGADVDATVVYGVNHGTLK-STDTVISNASCTTNCLAPLVKPLNDKLGLQDGLMTTVHAYTNNDVYHEDLRRARSATMSMIPTKTGAAAAVGDVLPELDG------KLNGYAIRVPTINVSIVDLSFVAKRNTTVEEVNGILKAASEGELILDYNTEPLVSVDYNHDPASSTASLTKVSGRLVKVSSWYDN---GFSNRMLDTTVAL................ 331
73 -16.2002pkq_O mol:protein length:368 Glyceraldehyde-3-phosphate dehydrogenase B  ali model follow..  15  2LKVAING--GRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHYDSILGTFKADVKIIDNETFSLGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAP-------------AKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKG------KLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLLDVCDIPLVSVDFRCSDFSSTSLTMVMGGDMVKVVAWYDN---GYSQRVVDLADLV................ 334
74 -16.2003k2b_A mol:protein length:337 Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic  ali model follow..  14  3LKVAING--GRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHYDSTLGIFDADVKPSGETAISVDIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAP---KGDIPTYVVGVNADAYS-------------HDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKG------KLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELILDVCDEPLVSVDFRCSDFSTTSLTMVMGDDMVKVIAWYDN---GYSQRVVDLADIV................ 332
75 -16.2001hdg_O mol:protein length:332 HOLO-D-GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  15  2.RVAING--GRIGRLVYRIIYERKNPDIEVVAINDLTDTKTLAHYDSVHKKFPGKVEYTENSLIVDGKEIKVFAEPDPSKLPWKDLGVD---FVIESTGVFRNREKA-VIITAPAKGEDITVVIGCNEDQLK-PEHTIISCASCTTNSIAPIVKVLHEKFGIVSGMLTTVHSYTNDQRPHKDLRRARAAAVNIIPTTTGAAKAVALVVPEVKG------KLDGMAIRVPTPDGSITDLTVLVEKETTVEEVNAVMKEATEGRLIIGYNDEPIVSSDIIGTTFSGITITNVIGGKLVKVASWYDN---GYSNRVVDTLELL................ 329

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 3 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.