current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0002 Acetylglutamate semialdehyde dehydrogenase, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MKVGIIGASGYTGGELLRLLVSHPDVRLELATSRSLAGKPVSSTHRHLTGFLDLKYENPVSEEIRERCDVVFVAVPHGTAMNYVPELLDGSTKVIDLSADYRLDTPVFENIYGIKHSDPRKAVYGLVELHPEAAREEFVANPGCFPTGANLAAAPLAAAGLIDIAVFDSKTGISGAGISPTETSHYPNIAENIIPYKLTAHRHRAEILQELTRLDGKLRNISFTPHVIPSIRGILTTAHLFTKEPLSTGDVQEIYEEFYRDKPFVRLPGGVPSLTAVRGSNFCDIGFEADKENNRVVVLSAIDNLVKGASGQAIQNMNLMFGLAETRGLWLPAAAPLast
1 -118.0001xyg_A mol:protein length:359 putative N-acetyl-gamma-glutamyl-phosphate re  ali model follow..  39  17IRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADF-STVDAVFCCLPHGTTQEIIKELP-TALKIVDLSADFRLRNAEYEEWYGQPHKAVEEVVYGLTEILREDIKARLVANPGCYPTTIQLPLVPLLKANLIKNIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 359
2 -117.0002cvo_A mol:protein length:366 putative Semialdehyde dehydrogenase  ali model follow..  38  24VRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPNLVAVKDADF-SNVDAVFCCLPHGTTQEIIKGLP-QELKIVDLSADFRLRDNEYAEWYGHSHRAPEEAVYGLTEVLRNEIRARLVANPGCYPTSIQLPLVPLIKAKLIKNIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGIKGHRHVPEIEQGLSEAAESKVTISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLSSVPHTRHVVGSNYCFMNVFEDRIPGRAIIISVIDNLVKGASGQAVQNLNLMMGLPENTGLQYQPLFP 366
3 -115.0001vkn_A mol:protein length:351 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  42  8IRAGIIGATGYTGLELVRLLKNHPEAKITYLSSRTYAGKKLEEIFPSTLENSILSEF--DPEKVSKNCDVLFTALPAGASYDLVREL--KGVKIIDLGADFRFDDGVYREWYGKELSGYEKRVYGLPELHREEIKAQVVGNPGCYPTSVILALAPALKHNLVDTILVDAKSGVSGAGRKEKVDYLFSEVNESLRPYNVAKHRHVPEMEQELGKISGKKVNVVFTPHLVPMTRGILSTIYVKTDKSL--EEIHEAYLEFYKNEPFVHVLGIYPSTKWCYGSNHVFIGMQMEERTNTLILMSAIDNLVKGASGQAVQNMNIMFGLDETKGLEFTPIYP 345
4 -115.0005ein_A mol:protein length:344 N-acetyl-gamma-glutamyl-phosphate/N-acetyl-ga  ali model follow..  37  4KTLSIVGASGYAGGEFLRLALSHPYLEVKQVTSRRFAGEPVHFVHPNLRGRTNLKFIPPE---KLEPADILVLALPHGVFAREFDRYSALAPILIDLSADFRLKDELYRRYYG-EHPRPDCFVYAVPELYREALKADWIAGAGANATATLLGLYPLLKAGVLKPIFVTLLISTSAAGAEASPASHHPERAGSIRVYKPTGHRHTAEVVENL----PGRPEVHLTAIATDRVRGILMTAQCFVQDGWSERDVWQAYREAYAGEPFIRLVKQYPDPRFVQGTNYADIGFELEEDTGRLVVMTAIDNLVKGTAGHALQALNVRMGWPETLGLDFPGLHP 344
5 -114.0002ozp_A mol:protein length:345 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  37  5KTLSIVGASGYAGGEFLRLALSHPYLEVKQVTSRRFAGEPVHFVHPNLRGRTNLKFVPPE---KLEPADILVLALPHGVFAREFDRYSALAPVLVDLSADFRLKDELYRRYYG-EHPRPDRFVYAVPELYREALKADWIAGAGCNATATLLGLYPLLKAGVLKPIFVTLLISTSAGGAEASPASHHPERAGSIRVYKPTGHRHTAEVVENL----PGRPEVHLTAIATDRVRGILMTAQCFVQDGWSERDVWQAYREAYAGEPFIRLVKQYPDPRFVQGTNYADIGFELEEDTGRLVVMTAIDNLVKGTAGHALQALNVRMGWPETLGLDFPGLHP 345
6 -109.0002g17_A mol:protein length:337 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  35  5LNTLIVGASGYAGAELVSYVNRHPHMTITALTVSAQAGKLISDLHPQLKGIVDLPLQPMDVRDFSADVDVVFLATAHEVSHDLAPQFLQAGCVVFDLSGAFRVNDAFYEKYYGFTHQYPEQAVYGLAEWNVDKLNANLIAVPGCYPTAAQLSLKPLIDGGLLDLPVINATSGVSGAGRKAAISNSFCEV--SLQPYGVFTHRHQPEIAVHLG------AEVIFTPHLGNFPRGILETITCRLKAGVTHAQVADVLQKAYGDKPLVRLYDKVPALKNVVGLPFCDIGFAVQ--GEHLIVVATEDNLLKGAAAQAVQCANIRFGFAETQSL....... 336
7 -109.0003dr3_A mol:protein length:337 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  35  5LNTLIVGASGYAGAELVTYVNRHPHMNITALTVSAQAGKLISDLHPQLKGIVELPLQPMDISEFSPGVDVVFLATAHEVSHDLAPQFLEAGCVVFDLSGAFRVNDTFYEKYYGFTHQYPEQAAYGLAEWCGNKLKANLIAVPGCYPTAAQLALKPLIDADLLDLPVINATSGVSGAGRKAAISNSFCEV--SLQPYGVFTHRHQPEIATHLG------ADVIFTPHLGNFPRGILETITCRLKSGVTQAQVAQALQQAYAHKPLVRLYDKVPALKNVVGLPFCDIGFAVQ--GEHLIIVATEDNLLKGAAAQAVQCANIRFGYAETQSL....... 336
8 -102.0002i3a_A mol:protein length:352 N-acetyl-gamma-glutamyl-phosphate reductase  ali model follow..  38  10TKVAVAGASGYAGGEILRLLLGHPRLRIGALTAATSAGSTLGEHHPHLTPLAHRVVEPTEAAVLGG-HDAVFLALPHGHSAVLAQQLSP-ETLIIDCGADFRLTDAVWERFYGSSHAG--SWPYGLPELARDQLRTRRIAVPGCYPTAALLALFPALAADLIEAVTVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASRGILATCTARTRSPLS--QLRAAYEKAYHAEPFIYLMGQLPRTGAVIGSNAAHIAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP 352
9 -32.0004dpk_A mol:protein length:359 Malonyl-CoA/succinyl-CoA reductase  ali model follow..  21  8LKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRQVPKEIADMEIKPTDPKLMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDV------------------VPELNPHTIKGFIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIVDNILPLGDGYDAKTIKEIFRILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLV............... 352
10 -29.8001ys4_A mol:protein length:354 Aspartate-semialdehyde dehydrogenase  ali model follow..  21  9IKVGVLGATGSVGQRFVQLLADHPMFELTALASERSAGKKYKDA-DIPENIKDMVVIPTDKHEEFEDVDIVFSALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDV------------------IPEVNADHLDGAIITNPNCSTICAVITLKPIMDKFGLEAVFIATMQAVSGAGYN---GVPSMAILDNLIPFKNEEEKMQTESLKLLGTLKDGKVKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVMDKFDPLKDLIREEIDRPQPRNEGNGMSIVVGRIRKDPIFDVKYTALEHNTIRGAAGASVLNAEYFV............... 350
11 -29.8002ep5_A mol:protein length:350 350aa long hypothetical aspartate-semialdehyd  ali model follow..  21  5IKVSLLGSTGMVGQKMVKMLAKHPYLELVKVASPSKIGKKYKDAVDIPEEVQDLPIVSTNYEDH-KDVDVVLSALPNELAESIELELVKNGKIVVSNASPFRMDPDV------------------NPEINWEHLKGILVKNPNCTAAIMSMPIKPLIEIATKSKIIITTLQAVSGAGYN---GISFMAIEGNIIPYKGEEDKIAKELTKLNGKLENNQIDSTVTSIRVPTRVGHMGVINIVTNERINIEEIKKTLKNFKSLPQQKNLPTAPKQPVNAESGMAVTVG-RIRHENNVLRLVVLGDNLVRGAAGITILTVEVMK............... 345
12 -29.4003hsk_A mol:protein length:381 Aspartate-semialdehyde dehydrogenase  ali model follow..  19  14KKAGVLGATGSVGQRFILLLSKHPEFEIHALASSRSAGKKYKDA-TLPETEQDIVVQECKPEGNFLECDVVFSGLDADVAGDIEKSFVEAGLAVVSNAKNYRREKDV------------------VPIVNPEHIPGFIICISNCSTAGLVAPLKPLVEKGPIDALTTTTLQAISGAGFSPGVSGM--DILDNIVPY-ISGEEDKLEWETEFVPIPESEMKVSAQCNRVPVIDGHTECISLRFANAPSVEDVKQCLREYECAASKLGCHSAPKQTRDRDSGYGVSVGRIREDSLLDFKMVVLSHNTIIGAAGAGILIAEILK............... 370
13 -28.0002yv3_A mol:protein length:331 Aspartate-semialdehyde dehydrogenase  ali model follow..  19  1MRVAVVGATGAVGREILKVLEARPLSELRLYASPRSAGVRLA--------FRGEEIPVEPLPEGPLPVDLVLASAGGGISRAKALVWAEGGALVVDNSSAWRYEPWV------------------VPEVNREKIFQHIIANPNCTTAILAMALWPLHRAFQAKRVIVATYQAASGAGAKAHGEAPKAEAFAHPLPFNVIPHEEMKVVWETHKIFGDDTIRISATAVRVPTLRAHAEAVSVEFARPVTPEAAREVLKEA----PGVEVVDEYPMPLTASGKWDVEVGRIRKSLANGLDFFVVGDQLLKGAALNAVQIAEEWL............... 328
14 -27.9005cef_A mol:protein length:375 Aspartate-semialdehyde dehydrogenase  ali model follow..  19  9IKVGVLGATGTVGQRFIELLAAHPYFALHALASSRSAGQQYARV-PIPDAVRHMVVHECRPDAGFAECGVVFSGLDADVAGDIENAFRAADLVVYSNAKNYRRDPLC------------------VPLVNPSHLKGYIVTNANCSTTGIVVPLAALEKAGPLDTVIVTTLQAISGAGYP---GVSSLDIMDNVVPL-ISGEEDKIEWEKAFDLHAPKQINVSATCTRVPVIDGHTGCVSVKFARSPSVAEVENAFREYTCDAQHLGVPSAPAQAKNLHNGACVSVGRIRECPVFDIKFVCLIDNVRLGAATSSIINAEIAV............... 361
15 -26.9004zhs_D mol:protein length:379 Aspartate Semialdehyde Dehydrogenase  ali model follow..  21  18KRCGVLGATGAVGTRFILLLSQHPLLELVAVASDRSSGKKYRDAVPMPAKVADLTVRCCDPAEF-SDCDIIFSGLDPDAAGEIEMAFLKANFAVFSNAKNYRLDPMV------------------VPLVNAGHIKGMLVCNSNCAVVGLVVPAKALIQKGPIESVSMVTMQAVSGAGYP---GVSSMDIFDNIVPY-IPGEEGKISSEDLAGFSDQKPLQISVACNRVPVLDGHTVCASLRFVNPPTASQVREALREYKPEVQTLGCPSA-MSIHVMDEVDRPQPRLDRETEGGYACTVGRIHNTVLGASGSSILNAESAI............... 368
16 -25.7002gyy_A mol:protein length:366 Aspartate beta-semialdehyde dehydrogenase  ali model follow..  18  4.TVAVVGATGAVGAQMIKMLEESPIDKIRYLASARSAGKSLKFKDQDIT-------IEETTETAFEGVDIALFSAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDV------------------VPEVNAHALDAHIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGAGMGADLHAEILPSGGDKKHYPIATYEEMKMTKETKKIMEDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAF----PGAVLEDDYPQAINAVGSRDTFVGIRKDLDAEKGIHMWVVDNLLKGAAWNSVQIAETLH............... 342
17 -25.6003vos_A mol:protein length:362 Aspartate-semialdehyde dehydrogenase  ali model follow..  19  14LSIGIVGATGQVGQVMRTLLDERPASAVRFFASARSQGRKLA----------EIEVEDAETADP-SGLDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDV------------------VSEVNFERDAHRIIANPNCTTMAAMPVLKVLHDEARLVRLVVSSYQAVSGSGLAGVAELA--NVVPLAGSLVDDGSGETDERFESRKILGIPDLLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELL----DGATGVQLVD-VPTPLAAAGVDESLVGIRRDPDGRGLALFVSGDNLRKGAALNTIQIAELLT............... 353
18 -25.5002qz9_A mol:protein length:336 Aspartate-semialdehyde dehydrogenase  ali model follow..  18  4FNVAIFGATGAVGETMLEVLQERPVDELFLLASERSEGKTYR----------TVRVQNVEEFDW-SQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDI------------------VPEVNPEAIAENIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGNGYPAETNTFSQQIAFNCIPQEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQT-DGIELFRGADFPTQVRDAGGKDHVLVGRVRNDISSGINLWVVADNVRKGAATNAVQIAELLV............... 332
19 -24.8002hjs_A mol:protein length:340 USG-1 protein homolog  ali model follow..  17  7LNVAVVGATGSVGEALVGLLDERPLHRLHLLASAESAGQRMG----------SLRVGDVDSFDF-SSVGLAFFAAAAEVSRAHAERARAAGCSVIDLSGALEPSVAP------------------MVSVNAERLAPFLLSSPCAVAAELCEVLAPLLATLDCRQLNLTACLSVSSLGREG-VKELARQTAELLNAFNLLAQIERRIFAEVQALLGERIGPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDAT-KGIEWVGEGDYPTVVGDALGQDETYVGRVRAGQACQVNLWIVSDNVRKGAALNAVLLGELLI............... 334
20 -22.7001nwc_A mol:protein length:371 Aspartate-semialdehyde dehydrogenase  ali model follow..  13  3.NVGFIGWRGMVGSVLMDRMSQEENLNPVFFTTSQAGQKA-----PVFGGKDAGDLKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDWVDAASALRMK---------------DDAIIVLDPVNQHVISEGLFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKSSILDIERKVTAKMRADNFPTDNFIPWIDKLLPELSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIEITLRELTPAKVTGTLSVPVG-KLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA.............. 371
21 -22.2003uw3_A mol:protein length:377 Aspartate-semialdehyde dehydrogenase  ali model follow..  14  5MNVGLVGWRGMVGSVLMQRMQEEDLIEPVFFSTSNAGGKAPS-------AKNETTLKDATSIDDLKKCDVIITCQGGDYTNDVFPKLRAAGWNWIDAASSLRMK---------------DDAVIILDPVNLNVIKDALFIGGNCTVSLMLMALGGLFRENLVDWMTAMTYQAASGAGAQNELLAQMGTLNGAVAAQLADPASAILDIDRRVLAAMGVPLAGSLIPWIIGAMRCHSQALTIKLKKDVPLDEINGILASANDWVKVVEASMRDLSPAKVTGTLSVPVG-KLAMGGEYLSAFTVGDQLLWGAAEPLRRMLRILL............... 375
22 -22.2004r5m_A mol:protein length:376 Aspartate-semialdehyde dehydrogenase 1  ali model follow..  14  1MRVGLVGWRGMVGSVLMQRMVEEDLIEPVFFSTSQIGVPAPN-------GKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKWIDAASTLRMD---------------KEAIITLDPVNLKQILHGIFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNELISQMGVINDAVSSELANPASSILDIDKKVAETMGVPLAGSLIPWIIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIDITARELTPAKVTGTLSVPVG-KMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILA.............. 368
23 -22.1004woj_A mol:protein length:365 Aspartate-semialdehyde dehydrogenase  ali model follow..  14  3LKVGFIGWRGMVGSVLMSRMIESDCILPTFFSTSQVGQLPTG-------MQQYGALQDAYSIDQLSSMDILLSCQGGEYTKEIHHKLREAGWQWIDAASTLRLD---------------KDSTLVLDPLNHDQIINAIFIGSNCTVSLMSLAIAGLLKEDLVEWVNSSTYQAISGAGAAAIREKILRELSKDSSKIPQQKTVQLPWIDVGMPS-TKKTIPVDGICVRVPSLRSHSQALTVKLRQKLTIEEIKQKISQGNEWVKVIEDTLKYLTPQANSGTLDIAIG-SSLLADDIFHCFTVGDQLLWGAAEPLRRVLNII................ 363
24 -21.8001brm_A mol:protein length:367 ASPARTATE-SEMIALDEHYDE DEHYDROGENASE  ali model follow..  15  2KNVGFIGWRGMVGSVLMQRMVEEDAIRPVFFSTSQLGQAAPS-------GGTTGTLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGWQWIDAASSLRMK---------------DDAIIILDPVNQDVITDGLFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHELLTQMGHLYGHVADELATPSSAILDIERKVTTLTGVPLAGSLIPWIVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVEITMRELTPAAVTGTLTTPVG-KLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQL................ 366
25 -21.5005bnt_C mol:protein length:378 Aspartate-semialdehyde dehydrogenase  ali model follow..  14  4KRVGLIGWRGMVGSVLMQRMLEEDLIEPVFFTTSNVGGQGPE-------GKDIAPLKDAYSIDELKTLDVILTCQGGDYTSEVFPKLREAGWQWIDAASSLRME---------------DDAVIVLDPVNRKVIDQALYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNELLKQMGAAHASVADDLANPASAILDIDRKVAETLGAPLGGSLIPWIVGAMRCHSQALTIKLNKDVPLTDIEGLISQ---HNPWVKLVPNHREVSAVTGTLSVPVG-KLNMGSQYLGAFTVGDQLLWGAAEPLRRMLRILL............... 370
26 -13.6003ic5_A mol:protein length:118 putative saccharopine dehydrogenase  ali model follow..  15  7.NICVVGA-GKIGQMIAALLKTSSNYSVTVADHDLAALAVLNR--MGVATKQVDAKDEAGLAKALGGFDAVISAAPFFLTPIIAKAAKAAGAHYFDLTEDVAATNAVRA................................................................................................................................................................................................................................... 111
27 -12.3002czc_A mol:protein length:334 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  15  3VKVGVNG-YGTIGKRVAYAVTKQDDMELIGITKTKPDFEAYRAKELGIPVYAASEEFIPTLNDLLEKVDIIVDATPGGIGAKNKPLYEKAGVKAIFQGG---------------EKADVAEVSFVAQANYEAALGKNYVRVVSCNTTGLVRTLSAIREYDYVYAVMIRRAADPNDTKRGPI---------NAIKPTVEVPSHHGPDVQTVI------PINIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFENTTRVLLFEKEKGFDSTAQIIEWNNLYEIAVWKESKGNRLFYIQAVHQFELADKWDSIKKTNKSLGILK........... 334
28 -12.0001b7g_O mol:protein length:340 PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGE  ali model follow..  12  2VNVAVNG-YGTIGKRVADAIIKQPDMKLVGVAKTSPNYEAFIAHRRGIRIYVPQQSIKKTVEDLIKTSDIVVDTTPNGVGAQYKPIYLQLQRNAIFQGG---------------EKAEVADISFSALCNYNEALGKKYIRVVSCNTTALLRTICTVNKVSKVEKTIVRRAADQKEVKKGPINSLVPDPAT--------VPSHHAKDVNSVIRNLDIATMAVI-----APTTLMHMHFINITLKDKVEKKDILSVLEN............................................................................... 242
29 -11.7002yyy_A mol:protein length:343 Glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  12  3AKVLING-YGSIGKRVADAVSMQDDMEVIGVTKTKPDFEARLAVEKGYKLFVAIPDNERTILDIIEDADIVVDGAPKKIGKQNLENIYKPHKVKAILQGG--------------EKAKDVEDNFNALWSYNRCYGKDYVRVVSCNTTGLCRILYAINSIADIKKARIVLVRRAADPNDDKTGPVNAITPN----PVTVPSH-HGPDVVSVVPEFEGKILTSAVI---VPTTLMHMHTLMVEVDGDVSRDDILEAIKKT-PRIITVRAEDGFSSTAKIIRYDINELVVWEESLENEIFLMQAVHQCIRAMLQMEEDNFKSIEKTNKAMGIQ...... 343
30 -11.7001cf2_P mol:protein length:337 PROTEIN (GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGE  ali model follow..  12  2KAVAING-YGTVGKRVADAIAQQDDMKVIGVSKTRKKGYDLYVAIPERVKLFEKA-VAGTVDDMLDEADIVIDCTPEGIGAKNLKMYKEKGIKAIFQGG---------------EKHEDIGLSFNSLSNYEESYGKDYTRVVSCNTTGLCRTLKPLHDSFGIKKVIVRRGADPAQVSKGPINAII--------NPPKLPSH-HGPDVKTVL------DINIDTMAVIVPTTLMHQHNVMVEVEETPTVDDIIDVFEDTPR---LISAEDGLTSTAEIMEYA--EIYYMQAVHQESDIVPENVDAVMEEDKYKSINKTNKAMNILQ........... 337
31 -9.6503wb9_A mol:protein length:305 Diaminopimelate dehydrogenase  ali model follow..  15  4LRVAVVG--GNVGRYALEAVQAAPDMELVGVVRRKVLAATPPEL---------TGVRVVTDISQLEGVQGALLCVPTRSVPEYAEAMLRRGIHTVD-SYDI--------------HGDLADLRRRLDPVAREHGAAAVISDPGTDSIIRALL-----------EFMAPKGITYTNFGPGMSMG-------------------HSVAVKA----IPGVRDALSMT---IPAGMGVHKRVYVELEPGADFAEVERAIKTVRDETRVTQVESVSALMDVGHGVVMERKGVSGATHNQLFRFEMRINN-VMVAALRAAARQK.................. 272
32 -9.6403bio_A mol:protein length:304 Oxidoreductase, Gfo/Idh/MocA family  ali model follow..  17  10IRAAIVG--GNIGRYALQALREAPDFEIAGIVRRNPAEVPFE-----------QPFRVVSDIEQLESVDVALVCSPSREVERTALEILKKGICTAD-SFDI--------------HDGILALRRSLGDAAGKSGAAAVIADPGSDSVVRTLM-----------QAIVPKGITYTNFGPGMSMG-------------------HTVAVKA----IDGVKAALSMT---IPLGTGVHRMVYVELLPGHNLEEVSAAIKAVHDETHVIQVDEVDALIDMGHGVRMVRKGVSGSTQNQRMSFDMEINN-VLVCAARAAMRQQ.................. 277
33 -9.3501npt_O mol:protein length:334 Glyceraldehyde 3-phosphate dehydrogenase  ali model follow..  15  2VKVGING--GRIGRNVFRAALKNPDIEVVAVNDLTDANTLAHLLYDSVHGRLDAEVSVNGNNLVVNGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKNEDITI--------------VMGVNQDKYDPKAHHVISNASA-PFAKVLGMMTTVHSYTNDQRILDLPHKDLRRARAAAE-SIIPTTTGAAKAVALV----LPELKGKLNGMAMR----------VPTPNVSVVDLVAELEKEVTVEEVNAALKAAYSEEPLVSR-----DYNGSTVSSTIDALSTMVIDGKMVKVVSWYDN---GYSHRVVDLAAYI................ 329
34 -9.3401dbv_O mol:protein length:334 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  15  2VKVGING--GRIGRNVFRAALKNPDIEVVAVNGLTDANTLAHLLYDSVHGRLDAEVSVNGNNLVVNGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKNEDITI--------------VMGVNQDKYDPKAHHVISNASC-PFAKVLGMMTTVHSYTNDQRILDASHKDLRRARAAAE-SIIPTTTGAAKAVALV----LPELKGKLNGMAMR----------VPTPNVSVVDLVAELEKEVTVEEVNAALKAAYSEEPLVSR-----DYNGSTVSSTIDALSTMVIDGKMVKVVSWYDN---GYSHRVVDLAAYI................ 329
35 -9.3103dbv_O mol:protein length:334 GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  15  2VKVGING--GRIGRNVFRAALKNPDIEVVAVNDTGGANTLAHLLYDSVHGRLDAEVSVNGNNLVVNGVDIVVESTGRFTKREDAAKHLEAGAKKVIISAPAKNEDITI--------------VMGVNQDKYDPKAHHVISNASC-PFAKVLGMMTTVHSYTNDQRILDASHKDLRRARAAAE-SIIPTTTGAAKAVALV----LPELKGKLNGMAMR----------VPTPNVSVVDLVAELEKEVTVEEVNAALKAAYSEEPLVSR-----DYNGSTVSSTIDALSTMVIDGKMVKVVSWYDN---GYSHRVVDLAAYI................ 329
36 -9.2804jn6_B mol:protein length:306 Acetaldehyde dehydrogenase  ali model follow..  14  8AKVAIVG-SGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARA--AKLGLETTHEGVDWLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTP-------------------AAVGPAVIPPANLREHLDAPNVN-GGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGV---------------QTIGGAARGKAIIILNPADPPMI--MRDTIFCAIPTDADREAIAASIHDVVK-----EVQTYVPGYRLLNEPQFDEPSINSGGQALVTTFVE-----VEGAGDPYAGNLDIMTAAATKVG........ 292
37 -9.2704lrs_B mol:protein length:323 Acetaldehyde dehydrogenase  ali model follow..  16  18AVAAIVG-PGNIGTDLLIKLQRSEHIEVRYMVGVDPASEGLARA--RKLGVEASAEGVDWLLEQDELPDLVFEATSAKAHLANAPRYAEAGITAIDLTP-------------------AAVGPLVCPPVNLTEHLDAPNVN-GGQATIPIVHAVSRVVPVAYAEIVAAIASRSAGPGTRANIDEFTETTAAAI---------------EQVGGAARGKAIIILNPVEPPMI--MRDTVYCAIPPDADTDAITASIEEMVA-----EVARYVPGYTLRTEPQYDQPRDIWKGMARVAVFLE-----VRGNGDPWAGNLDIMTAAAARVG........ 302
38 -9.0004dib_A mol:protein length:345 Glyceraldehyde 3-phosphate dehydrogenase  ali model follow..  13  5TRVAING--GRIGRMVFRQAIKESAFEIVAINASYPSETLAHLIYDTVHGKFDGTVEAFEDHLLVDGVEVVIEATGKFNSKEKAILHVEAGAKKVILTAPGKNEDVTI--------------VVGVNEDQLDITKHTVISNASC-PVVKVLGLMTTVHAYTNDQKNIDNPHKDLRRARACGQ-SIIPTTTGAAKALAKV----LPHLNGKLHGMALR----------VPTPNVSLVDLVVDVKRDVTVEAINDAFKTVFSEEPLVSI-----DFNTNTHSAIIDGLSTMVMGDRKVKVLAWYDN---GYSRRVVDLVTLV................ 332

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.