current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [F] COG0005 Purine nucleoside phosphorylase, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKYEDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFRAGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDLNIPIQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILDQPLSHDEVMEVTEKVKAGFLKLVKAIVAQYELast
1 -107.0004m1e_A mol:protein length:297 Purine nucleoside phosphorylase  ali model follow..  50  20LKSRIDQATAKISQLWQGEPAVGMILGTGLGGLAEQIEQDIAIPYSDIPHFPTSTVKSHAGRLVCGRLRGIPIVAMEGRFHYYEGYSLEQVTFPVRVMKAMGVKTLLVTNAAGGINPQLDLSDVLIIEDHINLMPENPLRGPNDEELGPRFPDMSHPYDCQHMEVARQVALELGIHCPKGVFVAVSGPNLETRAEYRMLKLMGADVVGMSTVPEVLVAVHAGLRVLGFSVVTDLCLPDALEPVELNKILEVAARGGAKLARLIPEILPRIA 290
2 -107.0004lna_A mol:protein length:293 Purine nucleoside phosphorylase  ali model follow..  48  17MFEQIQETTQFIQSKITLRPAIGIILGTGLGALTNELDIDTTIPYETIPHFPLSTVEFHSGKLLIGTLGGKSVVVMQGRFHYYEGYTMQQVTYPVRVMHALGIQTLLVSNAAGGMNPTFQTSDLMVIDDHISLLLPQPLICPNPPIFGDRFPDMSEPYRKSLIDLAFSVAAELDIPLKRGVYVSVTGPQLETRAEYRMLRQWGADAVGMSTVPEVIVANQLGMDVFGISVITDLCFPDTLEKAELVKILATAAQAEPKLTMLIREMIGRL. 287
3 -106.0001vmk_A mol:protein length:277 purine nucleoside phosphorylase  ali model follow..  46  7MMKKIEEARTFISERTNLSPDILIILGSGFGPFIEKVEDPVIIDYKDIPHFPQPTVEGHSGKLVFGRISDKPVMIMAGRFHLYEGHDPATVAFPVYLAKYVGVKGVVVTNAAGAINPEFKPGEIILVRDIINFMFRNPLRGPNDEKIGPRFPDMSSVVDPEWARKIQE-----RLSLKEGVYIGVLGPSYETPAEIRVFEKLGADLVGMSTVPEVIAAKHCGLKVVVFSCVTNMAAGITHGRLSHEEVVRTTKMAQGKIEKALTTAVEVF. 271
4 -105.0004ns1_A mol:protein length:295 Purine nucleoside phosphorylase  ali model follow..  49  20QEQHYHEAASFLSSRLPGDAKTAIILGSGLGELAEKIENKTVIPYNEIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHINNLPNPLI-GPNMDMFGVRFPDMTRAYDREFIAKAKGIAQELNIPVKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHFADDFNDEQDVIRAANAASEKMGAIFARLIAAV. 289
5 -105.0003odg_A mol:protein length:287 Xanthosine phosphorylase  ali model follow..  45  14FNELPFQAVKYIQKIKPGKPQIAFILGSGLGDLVDQITNDTTISYADIPGFPVSSVHGHAGELVLGDLCGVPVMCMKGRGHFYEGKGMSIMTNPVRTFKLMGCEFLFCTNAAGSLRPEVLPGSVVMLKDHINTMPGTPLVGPNDDRFGPRFFSLANAYDKDLRADMAKIAQQLDIPLTEGVFVSYPGPCFETPAEIRMMQIIGGDVVGMSVVPEVLSAAHCGLKVIALTAITNLAEGLSDVVLSHEQTLKFAKVASVNFTKLIEAFLKSKA 285
6 -105.0001yqq_A mol:protein length:277 Xanthosine phosphorylase  ali model follow..  44  6FSHNPLFCIDIIKTYKPDTPRVAFILGSGLGALADQIENAVAISYEKLPGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTFKLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPGTPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKEEGFPLTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEGLSDVKLSHAQTLAAAELSKQNFINLICGFLRKI. 276
7 -105.0005cxq_A mol:protein length:288 Purine nucleoside phosphorylase  ali model follow..  45  10.YENASMAADYIKRVSNVLPDIGIICGSGLGKLIEEIEERKVIPYINIPNFPKTTVAGHVGNLVLGSVGGRKIVAMQGRLHMYEGYSNQEIALPIRVMKLLGVRVLLITNLAGGINRKLKSGDFVLIKGHINFPGLGVLVGPNQDEFGPRFPDLSNAYDRLLQQLALKIAQENDFQVHEGVYAFNGGPTYESPDESNMLLKLGCDVVGMSTVPEVIIACHCGIKVLAVSLIANNSILDNDVSINHEKVLAVAEKRADLLQMWFKEIITRLP 286
8 -105.0003khs_A mol:protein length:285 Purine nucleoside phosphorylase  ali model follow..  48  4.YDLAKETAAWLNKQLQIRPVLGIVCGSGLGKIGDSLETSITVAYSDIPNFPVGSVKGHAGSLIFGSVNGVSCVCMKGRFHLYEGHTAARATFPMRVFKALGVKIVVLTNAAGGLNPSYRPGDFMVVRDHINLPGANPLTGPNDDTEGERFPSMTSVYDKTLRKYAISAARELGMSTHEGVYCCVNGPSFETPAECKILRLMGSDAVGMSTAPETIVAKHGGMRCLAVSLISNVIASNCEAEPTHEEVLRAGEEASARMTALVKLVIEKIR 280
9 -104.0004uc0_A mol:protein length:291 Purine nucleoside phosphorylase  ali model follow..  40  13YFQSMTPAVDLLIDRLNGLPRIAIVLGSGLGGLVDEVENAVRIPFADIPGFPQGGVSGHAKELVAGLFAGQPIIMLAGRVHYYEEGDAAAMRLPIETLASLGVTTLILTNAAGSLRADMPPGSVMQLIDHINFSGHNPLIGETG---DGRFVGMTQAYDGELAEAMRRAADAEDISLSSGVYMWFSGPSFETPAEIRMARTLGADAVGMSTVPEVILARFFGLKVAAASVITNYGAGMTGAELSHEETKDMAPIGGRRLVAILKRMIVDGG 281
10 -103.0001tcu_A mol:protein length:287 purine-nucleoside phosphorylase  ali model follow..  42  9.IENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSVVGHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDPNHEEVLATGAQRAELMQSWFEKIIEKLP 285
11 -101.0003la8_A mol:protein length:303 Putative purine nucleoside phosphorylase  ali model follow..  56  31LLKKIYETRDFLTAKGVQKPEFGLILGSGLGELAEEIENALVLNYADIPNWGRSTVSGHAGKLIYGELAGRKVLALQGRFHYYEGNSMELVTFPIRIMKALGCQGLIVTNAAG--GIGFGPGTLMAISDHINLTGANPLMGENLDDFGFRFPDMSNAYTADYREVAHQVADKIGIKLDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGF-QSELNHEEVVAVTQQIKEDFKGLVKAILVEL. 297
12 -101.0001a9o_A mol:protein length:289 PURINE NUCLEOSIDE PHOSPHORYLASE  ali model follow..  47  6TYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQLQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDSQGKANHEEVLEAGKQAAQKLEQFVSLLMASIP 283
13 -100.0001g2o_A mol:protein length:268 PURINE NUCLEOSIDE PHOSPHORYLASE  ali model follow..  36  8PDELARRAAQVIADRTGGEHDVAVVLGSGWLPAVAALSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVG-------GEFVDLTDAYSPRLRELARQSDPQ----LAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF. 268
14 -99.2004ear_A mol:protein length:324 Purine nucleoside phosphorylase  ali model follow..  46  36.YEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQLQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEEKANWEEVLAAGKQAAQKLEQFVSILMASIP 312
15 -98.3003gb9_A mol:protein length:311 Purine nucleoside phosphorylase  ali model follow..  45  28TYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQLQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDSLEKANHEEVLAAGKQAAQKLEQFVSILMASIP 305
16 -97.0003phb_E mol:protein length:324 Purine nucleoside phosphorylase  ali model follow..  46  36.YEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQLQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEEKANHEEVLAAGKQAAQKLEQFVSILMASIP 312
17 -95.5002p4s_A mol:protein length:373 Purine nucleoside phosphorylase  ali model follow..  45  85TYDTLQEIATYLLERTELRPKVGIICGSGLGTLAEQLTDVDSFDYETIPHFPVSTVAGHVGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPKYRVGDIMLIKDHINLMGNNPLQGPNDERFGPRFFGMANTYDPKLNQQAKVIARQIGIELREGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITNMCTMSYEEEHCHDSIVGVGKNREKTLGEFVSRIVKHIH 362
18 -94.6005ifk_A mol:protein length:312 Purine nucleoside phosphorylase  ali model follow..  44  9QRALIKSAHRYISEKLEDLPKALVICGSGLSGISTKIADEPILSYSTIPGFKVSTVPGHSGELIFGYMNGAPVVLMNGRLHSYEGHSLAETVHPIRLHLLGSINVLIVTNAAGGINASFKAGDLMCVYDHINFPGFHPLRGANFDEFGPRFLATSDAYDLELRKLLFSKKKELNIEIHEGTYSYVHGPTFESRAESRFLRLAGTDAVGMSTVPEVVTARHCGWRVLALSLITNECVPIQEGKATHEEVLENSAKASKDVQELIFSVVAEI. 306
19 -92.2001c3x_A mol:protein length:266 PENTOSYLTRANSFERASE  ali model follow..  36  11.FLVARAAADHIAQATGEGHDMALVLGSGWGGAAELLGEVAEVPTHEIPGFSSVTRSIR---VERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINLTARSPLE-------GPTFVDLTDVYSPRLRELAHRVDPT----LPEGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTNLAAGISPTPLSHAEVIEAGQAAGPRISALLADIAKR.. 266
20 -87.3003ozb_A mol:protein length:259 Methylthioadenosine phosphorylase  ali model follow..  21  3............NLYFQGMSVYAIIGGTGLTQLEG-LTLSESLPIETPYGAPSAP-------LQRGRYAGREVLFLARHGHPHRFPHQVNYRANLWALKQAGAEAVIAVNAVGGIHAAMGTGHLCVPHQLIDYTSGREHTYFAGDIEHVTHIDFSHPYDEPLRQRLIEALRALGLAHSSGVYACTQGPRLETVAEIARLERDGNDIVGMTGMPEAALARELDLPYACLALVVNPAAGKSAGIITMAEIEQALHDGIGKVREVLARVLAG.. 253
21 -83.4004l5a_A mol:protein length:320 S-methyl-5`-thioadenosine phosphorylase  ali model follow..  19  2..GSSSSGLVPRGSHMMSKVKVGIIGGSGFDDPNLF--KKVGVRQVTTPFGK------PSDTLVEGFVGDVACLPRHGKGHLIPPSEV-NYRANVWALKDLGCTHILATNACGSLQEDLVPGDFVVLNQFMDKTWGRENTSKPDSLKGVLHMPMAEPFCERTRQILIQAARNKSINVAEGSAVTINGPRFSTRCESFIHKAMGLDIVNMTLVPEVSLAREAGLSYASIAIVTDFDCWKSEEHVCVDMVLEQFRKSVVHVREILLEAVALIG 284
22 -82.3005eub_A mol:protein length:297 S-methyl-5`-thioadenosine phosphorylase  ali model follow..  24  4.....LYFQSMASGTTTTAVKIGIIGGTGLDDPE--ILEGRTEKYVDTPFGK------PSDALILGKIKNVDCLARHGRQHTIMPSKV-NYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEAVSVDRVLKTLKENANKAKSLLLTTIPQIG 267
23 -80.5004glf_A mol:protein length:297 RsfP  ali model follow..  20  2.......TSTAVEITVKNAADIAIIGGSGLYQM-QALTNKRSVKIETPYGEP-------SDDIVLGELNGVTVAFLTRHGQGHRLTSEVPYRANIYALKTLGVRYIVSVSAVGSLQETLKPLDMVIPDQMIDMTKQRVSTFFG--DGAVAHVSMADPLCPEVADILIRAYDNADIAHAKATYVCIEGPQFSTRAESHWYRQMQADIIGMTNMPEAKLAREASIAYATLALVTDFDCWHPNQAVSADYAIQNLMKNADNAQQVIKQAVALIA 261
24 -79.4001wta_A mol:protein length:275 5`-methylthioadenosine phosphorylase  ali model follow..  22  1........MFEITRPPGVRAHVGVIGGSGLYDPGI---------VENPVEVKVSTPYGNSDFIVVGDVAGVKVLPRHGRGHRIPPHAI-NYRANIWALKALGVKWVISVSAVGSLREDYRPGDFVVPDQFIDMTKNRRHYTFYDGP-VTVHVSMADPFCEDLRQRLIDSGRRLGYTVHEGTYVCIEGPRFSTRAESRVWKDVKADIIGMTLVPEINLACEAQLCYATLAMVTDYDVW-ADRPVTAEEVERVMISNVERARRMLYDVIPKLA 256
25 -78.3001v4n_A mol:protein length:281 271aa long hypothetical 5`-methylthioadenosine phosphorylase  ali model follow..  25  1...........MMIEPKEKASIGIIGGSGLYDPQI-LTNVKEIKVYTPYGEP-------SDNIILGELEGRKVLPRHGRGHRIPPHKI-NYRANIWALKSLGVKWVIAVSAVGSLRLDYKPGDFVVPNQFIDMTKGRTYTFFDGP--TVAHVSMADPFCEHLRSIILDSAKDLGITTHKGTYICIEGPRFSTRAESIVWKEFKADIIGMTLVPEVNLACEAEMCYSVIGMVTDYDVF-ADIPVTAEEVTKVMAENTAKVKKLLYEVIRRLP 252
26 -77.3002a8y_A mol:protein length:270 5`-methylthioadenosine phosphorylase (mtaP)  ali model follow..  25  2.............IEQNEKASIGIIGGSGLYDFSESKEIKVYTPYGQPSDFITIGKIGNKSVA---------FLPRHGRGHRIPPHKI-NYRANIWALKELGVRWVISVSAVGSLRMDYKLGDFVIPDQFIDMTKNREYSFFDGP--VVAHVSMADPFCNSLRKLAIETAKELNIKTHEGTYICIEGPRFSTRAESRTWREVKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVF-AEIPVTAEEVTRVMAENTEKAKKLLYALIQKLP 251
27 -22.5001jds_A mol:protein length:236 5`-METHYLTHIOADENOSINE PHOSPHORYLASE  ali model follow..  16  5..........HILAKKGEVAERVLVVGD-ARLLSTLLQNPKLTNENR--------------LVYTGKYNGETVSIAT------HGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPD------FELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSD--------NLAKGGIWITKEELEKSVMDGAKAVLDTL. 234
28 -21.6001odi_A mol:protein length:235 PURINE NUCLEOSIDE PHOSPHORYLASE  ali model follow..  16  5..........HVRAHPGDVAERVLLPGD---------PGRAEWIAKTFLQNPRRYNDHRGLWGYTGLYKGVPVSVQT------TGMGTPSAAIVVEELVRLGARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQYLEGR--------PYAPVPDPEVFRALWRRAEALGYPHRVGLVASEDAFYATTPEEARAWARYGVLAFEMEASALFLLGRMRGVRTGAILAVSNRIG--DPELAPPEVLQEGVRRMVEVALEAVLEV..... 235
29 -21.0005ZNC Entity 1(prereleased)  ali follow..  12  1....MDNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIH--------GDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 243
30 -20.6002bsx_A mol:protein length:253 PURINE NUCLEOSIDE PHOSPHORYLASE  ali model follow..  12  1....MDNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICN----------AAVREDRVSHLLIHGDFP-DFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 243
31 -20.6001ybf_A mol:protein length:268 AMP nucleosidase  ali model follow..  14  12.....NWLPRYTQRQLIDFEPYILLTNFSLHVFAEHYGVPIV-----------------GEHTSMPNASAEGVTLIN------FGMGSANAATIMDLLWAIHPKAVIFLGKCGGLKLENALGDYLLPIAAIRGEGTSNDYLPEEVPSLP---------SFSVLRAISSAIQNKGKDYWTGTVYTTNRRVWEYDEKFDYLRSTHASGVDMETATLMTVGFANKIPMGALLLISDRPMFPEGVK-TEESDQLVTDNFAEEHLMLGIDALEIIR 247
32 -20.5006aym_A mol:protein length:238 5`-methylthioadenosine/S-adenosylhomocysteine nucleosidase  ali model follow..  15  1...............MGSGMKIAILGAM-ITPLLETLKDYTKIEHANN-------------TYYFAKYKDHELVLAYSKI------KVNSTLSASVMIEKFGAQVLLFTGVAGAFNPELEIGDLLYATKLAQYDLD--ITAFGHPLGFVPGNEIFIKTDEKLNNLALEVAKELNIKLRAGIIA--TGDEFICDEAKKIREIFNADACEMEGASVALVCDALKVPCFILRAMSDKA-----GEKAEFDFDEFVINSAKISANFVLKMCEKL. 232
33 -20.5004lnh_A mol:protein length:266 Uridine phosphorylase  ali model follow..  12  17.....MSKQPHICVDENQVSPYVIVCGE-VNRIVELMDNVELLAENR--------------RVFNGVYKGTTITICS------TGIGAPSMIIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVRDEGGSKAYISSAYPAYA---------SFALLKEISHFLENQSVKYYFGVVRSHDSFYTDEEDQLQYWNKKGILGADMETSALFTVGRLRGLQVASILNNVVLYQ--QDVKEGVNQYVNDNKAMMNGERLAAITALETL. 255
34 -20.5004bmx_A mol:protein length:251 MTA/SAH NUCLEOSIDASE  ali model follow..  14  3.....SSSSGLVPRGSHMVQKIGILGAM----------REEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKI------KVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVD--LSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVLKEGVIA--SGDQFVHSKERKLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNA-----DEEANMSFDAFLEKSAQTSAKFLKSMVDEL. 245
35 -20.4004r2w_A mol:protein length:252 Uridine phosphorylase  ali model follow..  11  9...........LTKAMLDGATLAIVPGD-VKRIAELMDNATFLASHR--------------TSYLAYADGKPVVICS------TGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVA---------NFECTTAMVAACRDAGVEPHIGVTASSDT-TRRFAGSMKEWQDMGVLNYEMESATLFTMCATQGWRAACVAGVIVNRT--QQEIPDEATMKKTEVSAVSIVVAAAKKLLA... 252
36 -20.4002isc_A mol:protein length:239 purine nucleoside phosphorylase  ali model follow..  16  1.......ATPHNSAQVGDFAETVLMCGD-AKLIAETYLENPKLVNNV-----------RGIQGYTGTYKGKPISVMG------HGMGLPSICIYAELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINRIRFMD--------HDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHIL--HHEETTAEERQNSFQNMMKIALEAAIKL..... 235
37 -20.2004wkn_A mol:protein length:245 Aminodeoxyfutalosine nucleosidase  ali model follow..  18  43.............................................................VFHKGVYHNKEIIVAYSKI------KVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVD--LSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIA--SGDQFVHSKERKLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNA-----DEKAGMSFDEFLEKSAHTSAKFLKSMVDEL. 239
38 -20.2006aqu_A mol:protein length:247 Purine nucleoside phosphorylase  ali model follow..  12  4.....DNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDIKRGDICICNAAVREDRVSHLLIHGDFPAVG---------DFDVYDTLNKCAQELNVPVFNGISVSSDM-NKIIPSRLEDYSKANAAVVELELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 245
39 -20.2004ffs_A mol:protein length:239 MTA/SAH nucleosidase  ali model follow..  16  1...............MEFMQKIGILGAEEITPILELFGVDFE------------EIPLGGNVFHKGVYHNKEIIVAYSKI------KVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVD--LSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIA--SGDQFVHSKERKLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNA-----DEKAGMSFDEFLEKSAHTSAKFLKSMVDEL. 233
40 -20.1004jwt_A mol:protein length:259 Methylthioadenosine nucleosidase  ali model follow..  17  9...........TENLYFQSMKIAIMGAM-ISPILEKIGSYKSTSYAGN-------------KYYEATYQGVELVIAYSKI------KVFSALSAATMIEHFGATKLLFSGVAGAISTNLKVGDLIVATKLSQHDLD--ITAFGHPYGYVPEGSVFVEADKDMIELSKKVALEMGKSVQEGIIA--TGDQFVANEERKIGTTFGADALEMEGGSVGVVCNALNIPFFILRSISDAA-----DMDASFSFDEFLESSAKESAEFIMKMVDEL. 244
41 -20.1006EYP Entity 1(prereleased)  ali follow..  14  18...................ATLAIIPGD-VQKIAELMDNPVFLA------------SHREYTVYRAELDGQSVVVCS------TGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVP---------DFDVATAMKAAAQESGATVHMGVTASSDT---RFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRT--QKEIPDHATLKETEARSIKVVVEAARKMLK... 253
42 -20.0001sq6_A mol:protein length:253 uridine phosphorylase, putative  ali model follow..  12  4.....DNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIH--------GDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 245
43 -20.0005ccd_A mol:protein length:232 Aminodeoxyfutalosine nucleosidase  ali model follow..  17  1................GPGQKIGILGAM----------REEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKI------KVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVD--LSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIA--SGDQFVHSKERKLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISNNA-----DEKAGMSFDEFLEKSAHTSAKFLKSMVDEL. 232
44 -20.0001xe3_A mol:protein length:245 purine nucleoside phosphorylase  ali model follow..  18  3.....SSMSVHIEAKQGEIAESILLPGD---------PLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQG------TGMGVPSISIYVNLIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGF--------DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIF--TGEETTSEERQTTFNEMIEIALDAAIQ...... 238
45 -20.0001ryz_A mol:protein length:253 Uridine phosphorylase  ali model follow..  13  19...................AQLAIVPGD-VEKIAALMDKPVKLASH------------REFTSWRAELDGKAVIVCS------TGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVA---------DFACTTALVEAAKSIGATTHVGVTASSDT---RFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRT--QQEIPNAETMKQTESHAVKIVVEAARRLL.... 253
46 -20.0003emv_A mol:protein length:253 Uridine phosphorylase, putative  ali model follow..  14  3.....GEMQRHIKLTKAQTTPVVLVVGD-VDKVKVLCDSYVDLAYN------------REYKSVECTYKGQKFLCVS------HGVGSAGCAICFEELMNNGAKVIIRAGSCGSLQPQMKRGDICICNAAVREDRVSHLMIYSDFPAVA---------DYEVYATLNQVAEELKVPVFNGISLSSDMPHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWDEGDFDNNLVPERLENMIKISLETCARLAKK.. 244
47 -20.0004ldn_A mol:protein length:261 Purine nucleoside phosphorylase DeoD-type  ali model follow..  14  21..........HINAPLDAFADTILMPGD---------PLRAKLIAETYLENVVQVTDVRGMLGFTGEFKGRKISVMG------HGMGAPSASIYFHLMTTYKVKNFIRIGSCGAIHDDVKLKDLIVAIGASTDSKMNRIRFKDN--------DFAATANYNMLSECVNTLKTTDINYLVGNVFSSDLFYRPDEEQYDMMARYGILGVEMEVNALYSAAAENHCNAVALCTVTDHIK--NHEHLTADERRTELHEMINVALDVALKLPTE.. 255
48 -19.9001vhj_A mol:protein length:253 purine nucleoside phosphorylase  ali model follow..  18  1....MSLATPHINAQMGDFADVVLMPGD---------PLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGRRISVMG------HGMGIPSCSIYVTLIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRIRFKDH--------DFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDPSMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDHIK--TGEQTTSEERQNTFNEMIEIALDSVLIGDQA.. 241
49 -19.8003occ_A mol:protein length:239 Purine nucleoside phosphorylase deoD-type  ali model follow..  15  5..........HINAEMGDFADVVLMPGD---------PLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMG------HGMGIPSCSIYAKLITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIA--------DFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIR--TGEQTTAAERQTTFNDMIEIALESVLLGDNA.. 239
50 -19.8001tgv_A mol:protein length:256 uridine phosphorylase  ali model follow..  13  14...........LTKNDLQGATLAIVPGD-VEKIAALMDKPVKLASH------------REFTTWRAELDGKPVIVCS------TGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVA---------DFECTTALVEAAKSIGATTHVGVTASSDT---HFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRT--QQEIPNAETMKQTESHAVKIVVEAARRLL.... 256
51 -19.8001nw4_A mol:protein length:276 uridine phosphorylase, putative  ali model follow..  12  4.....DNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICN----------AAVREDRVSHLLIHGDFP-DFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 245
52 -19.8004m7w_A mol:protein length:258 Purine nucleoside phosphorylase DeoD-type  ali model follow..  18  21..........HIGANRGDVAETILLPGD---------PLRAKYIAETFLEDVVQYNNVRGMLGFTGTYKGKKVSVQG------TGMGVPSIGIYSHLITEFGVKNLIRVGTAGSYQEDVKVRDVVIAMSASTDSAINKLRFNGA--------DYAPTASSDLVFKAYEIAKAKGLNVKAGNVFTSDTFYGDDPNAWKKWAEFGVLCVEMETAQLYTTAAKLGVNALTLLTISDSFI--THEVTSAEERQTTFNEMIEVALETALQL..... 252
53 -19.8003o6v_A mol:protein length:261 Uridine phosphorylase  ali model follow..  14  26...................ATLAIIPGD-VQKIAELMDNPVFLA------------SHREYTVYRAELDGQSVVVCS------TGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVP---------DFDVATAMKAAAQESGATVHMGVTASSDT---RFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRT--QKEIPDHATLKETEARSIKVVVEAARKMLK... 261
54 -19.7004i2v_A mol:protein length:253 Uridine phosphorylase  ali model follow..  13  11...........LTKNDLQGATLAIVPGD-VEKIAKLMDNPVHLASH------------REFTSWRAELDGKAVIVCS------TGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINVGDVLVTTAAVRLDGASLHFAPMEFPAVA---------DFSCTTALVNAAKSVGATTHIGITASSDT---HFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRT--QQEIPNEETMKATESHAVKIVVEAARHLL.... 253
55 -19.6004m3n_A mol:protein length:254 Purine nucleoside phosphorylase DeoD-type  ali model follow..  18  15.....QSMTPHISAPPGAVAEAILLPGD---------PLRAKYIAENFLENPVLYNQVRNMFGYTGTYKGKRVSVQG------TGMGIPSASIYIHLVQFYGCKTLIRVGTAGAITERLKLRDLVIAQAACTDSSINNLRFAGQ--------NYAPIATFDLLRRAYEQAQSRGMPVHVGNVLSTDTFYHDQPNPYQLWAQFGVLAVEMEAAGLYTLAAKFGVQALCILTISDHLI--TGEKTTPQERQETFDQMIEVALETI........ 248
56 -19.6001pr0_A mol:protein length:239 Purine nucleoside phosphorylase  ali model follow..  17  5..........HINAEMGDFADVVLMPGD---------PLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMG------HGMGIPSCSIYTKLITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDH--------DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIR--THEQTTAAERQTTFNDMIKIALESVLLGDKE.. 239
57 -19.6002b94_A mol:protein length:267 purine nucleoside phosphorylase  ali model follow..  14  19.....EEMQRHIKLTPSQTTPVVLVVGD-VDKVKMLCDSYVDLAYN------------REYKSVECTYKGQKFLCVS------HGVGSAGCAICFEELMNNGAKVIIRAGSCGSLQPTMKRGDICICNAAVREDRVSHLMIYSDFPAVA---------DFEVYDTLNKVAQELEVPVFNGISLSSDLPHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWDEGDFDNNLVPEKLENMIKISLETCARLAKK.. 260
58 -19.4005lu0_A mol:protein length:233 Purine nucleoside phosphorylase DeoD-type  ali model follow..  17  4..........HINAKIGDFYPQCLLCGD---------PLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGRGISLMG------HGMGIASCTIYVTLIKTYQVKELLRIGTCGAISPKVGLKDIIMATGASTDSKTNRVRFLNH--------DLSATPDFELSLRAYQTAKRLGIDLKVGNVFSSDFFYSFETHAFDLMAKYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLI--TKEALSPKERVESFDNMIILALEMMS....... 233
59 -19.4003fow_A mol:protein length:276 Uridine phosphorylase, putative  ali model follow..  12  4.....DNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGIGSAGCAICFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICN----------AAVREDRVSHLLIHGDFP-DFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 245
60 -19.4004lkr_A mol:protein length:256 Purine nucleoside phosphorylase DeoD-type  ali model follow..  13  15.....QSMTAHINAQPTDFAETVIMPGD---------PLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMG------HGMGISSMVLYGHLINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSSGY--------HMATSATFSLLHKAYTKANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCL--TGEETTAQERQLSFNNMIELALETALN...... 250
61 -19.3004jos_A mol:protein length:250 Adenosylhomocysteine nucleosidase  ali model follow..  16  11............NLYFQSMKKIAILGAIEIQPILQKLEKYETVEYANN-------------KYYVANYNGIELVVAYSKI------KVFSSLTATIMIEHFGVDALLFTGVAGGLQ-DLQVGDMIAATATVQHDVD--ITAFGYPYGKIPISEVEIATSARILEQAKVIAKELNLNLHTGVIA--TGDQFVHSAERKVVKEFDAKAIEMEGASVNLICNEMNIPSFILRSISDTA-----DGDAPDNFDEFAKMAANRSADFVMKLVDRI. 244
62 -19.3003mb8_A mol:protein length:279 Purine nucleoside phosphorylase  ali model follow..  13  7.....MEVQPHIRLRKEDVEPVVIIVGD-TEEVANMCEKKQELAYN------------REYRSFRVVYDSQPITVIS------HGIGCPGTSIAIEELAYLGAKVIIRAGTCGSLKPKLKQGDVCVTYAAVNETGLISNILPEGFPCVA---------TPHVYQALMDAAKELGIEAASGIGVTQDYFYQNGILPSKLMYSKCCDVIDMEMSGVLGLCQARGIATCGILAVDGSPL--QWDEGDYDATGVKATTGKENMVKITLKACANLR 247
63 -19.2003qpb_A mol:protein length:282 Uridine phosphorylase  ali model follow..  17  25.....VGLQYHLQIRPGDVGRYVIMPGD-CAKIAEHFDNAVLVADS------------REYVTYTGTLNGEKVSVTS------TGIGGPSASIAMEELKLCGADTFIRVGTCGGIELDVKGGDIVIATGAIRMEGTSKEYAPIEFPAVA---------DLEVTNALVNAAKKLGYTSHAGVVQCKDA-SYELLNKWEAWKRLGTKASEMESAALFVAASHLGVRCGSDFLVVG----ERNALGMDNPMAHDTEAAIQVAVEALRTLIEN.. 272
64 -19.1005mx4_A mol:protein length:233 Purine nucleoside phosphorylase DeoD-type  ali model follow..  17  4..........HINAKIGDFYPQCLLCGD---------PLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGKGISLMG------HGMGIASCTIYVTLIKTYQVKELLRIGTCGAISPKVGLKDIIMATGASTDSKTNRVRFLN--------HDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFDLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLI--TKEALSPKERIESFDNMIILALEMMS....... 233
65 -19.1001zos_A mol:protein length:230 5`-methylthioadenosine / S-adenosylhomocysteine nucleosidase  ali model follow..  17  2....................KIGIIAAEELAYLVQHLDNTQEQVVLGN-------------TYHTGTIASHEVVLVESGI------KVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVD--VTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNWHLGLIA--TGDSFVAGNDKIEAHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNA-----NHEANIFFDEFIIEAGRRSAQVLLAFLKALD 230
66 -19.0004tym_A mol:protein length:258 Purine nucleoside phosphorylase DeoD-type  ali model follow..  19  15.....QSMSIHIEAKQGEIADKILLPGD---------PLRAKFIAENFLEDAVCFNTVRNMFGYTGTYKGHRVSVMG------TGMGMPSISIYARLIVDYGVKTLIRVGTAGAINPDIHVRELVLAQAAATNSNIIRNDWPEF--------DFPQIADFKLLDKAYHIAKEMDITTHVGSVLSSDVFYSNQPDRNMALGKLGVHAIEMEAAALYYLAAQHNVNALAMMTISDNLNNPEEDTSAEERQTTFTDMMKVGLETLISE...... 252
67 -18.9003tl6_A mol:protein length:242 Purine nucleoside phosphorylase  ali model follow..  17  13..........HNGAKYGEIAETVLMAGD---------PLRVKLLADTYLTDVVQYNSVRGAVGYTGYYKGVKLSVQA------HGMGMPSIGIYAYLFNFYGVKRIIRIGSAGAFDESLKLGDIVIGMGACYDSNFERQYDIPG--------KYSCIADFQLCREAVDAAEKLGYRYKVGNIYSANY--YDDGDHSGAWKKMGVLAVEMEAAALYMIAARARKQALCMLTISD--------LCYGSGEKMTAEERRTKFTQMMEVALSLAK 242
68 -18.9003mms_A mol:protein length:230 5`-methylthioadenosine / S-adenosylhomocysteine nucleosidase  ali model follow..  17  2....................KIGIIAAEELAYLVQHLDNAQEQVVLGN-------------TYHTGTIVSHEVVLVESGI------KVMSAMSVAILAVHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQ--MAQQPLYFESDKTFVAQIQESLSQLDQNWHLGLIA--TGDSFVAGNDKIEAHFPEVLAVEMEGAAIAQAAHALNLPVLVIRAMSDNA-----NHEANIFFDEFIIEAGRRSAQVLLAFLKALD 230
69 -18.8004wkc_A mol:protein length:245 5`-methylthioadenosine/S-adenosylhomocysteine nucleosidase  ali model follow..  17  2....................KIGIIGAEEVTLLRDKIENRQTISLGGC-------------EIYTGQLNGTEVALLKSGI------KVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDAD--VTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIV--SGDAFINGSVGL--NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVA-----DQQSHLSFDEFLAVAAKQSSLMVESLVQKLA 230
70 -18.8004f1w_A mol:protein length:248 5`-methylthioadenosine/S-adenosylhomocysteine nucleosidase  ali model follow..  17  8................GSHMKIGIIGAEEVTLLRDKIDNRQTITLGGC-------------EIYTGQLNGTEVALLKSGI------KVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGC--PAGFKADDKLIAAAESCIRELNLNAVRGLIV--SGDAFINGSVGL--NFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVA-----DQQSHLSFDEFLAVAAKQSTLMVETLVQKLA 240
71 -18.8004d8v_A mol:protein length:253 Purine nucleoside phosphorylase deoD-type  ali model follow..  17  13.....SHMSVHIGAEKGQIADTVLLPGD-AKFIAETYLENVECYNEV-----------RGMYGFTGTYKGKKISVQG------TGMGVPSISIYVNLIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGS--------VDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQ--YNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVL--TGEETTAEERQTTFHDMIDVALHSVSQ...... 247
72 -18.7001jys_A mol:protein length:242 MTA/SAH nucleosidase  ali model follow..  17  5.............MDPEFSMKIGIIGAEEVTLLRDKIENRQTISLGGC-------------EIYTGQLNGTEVALLKSGI------KVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDAD--VTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIV--SGDAFINGSVGL--NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVA-----DQQSHLSFDEFLAVAAKQSSLMVESLVQKLA 240
73 -18.5003bl6_A mol:protein length:230 5`-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase  ali model follow..  15  3....................MIGIIGAEEVTILKNKLTQLSEISVAHV-------------KFYTGILKDREVVITQSGI------KVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQ--IPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIV--SGDSFIGSVEQR--AFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLA-----NGEAEMSFEAFLEKAAVSSSQTVEALVSQL. 230
74 -18.5004g41_A mol:protein length:236 MTA/SAH nucleosidase  ali model follow..  14  4.................GSMKIGIIAAEELSLLLANLLDAQEHQVLSK-------------TYYTGRFGKHELILVQSGV------KVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQ--MAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIA--TGDSFVAGQDKI--AFSNVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTA-----AHDANITFDQFIIEAGKRSAQILMTFLENLP 235
75 -18.5004g89_A mol:protein length:237 5`-methylthioadenosine/S-adenosylhomocysteine nucleosidase  ali model follow..  18  3................SKSMKIGIIGAEEVTLLRDKIENRQTITIGGS-------------EIYTGQLHGVDVALLKSGI------KVAAAMGATLLLERCQPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQ--LPGCPAGFKADEKLVAAAESCIKALDLNAVRGLIV--SGDAFINGSVGL--NFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVA-----DQQSHLSFEEFLAVAARQSTLMVENLVQNLA 235

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 3 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.