current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [F] COG0005 Purine nucleoside phosphorylase, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKYEDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFRAGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDLNIPIQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILDQPLSHDEVMEVTEKVKAGFLKLVKAIVAQYELast
1 -116.0001vmk_A mol:protein length:277 purine nucleoside phosphorylase  ali model follow..  46  7MMKKIEEARTFISERTNLSPDILIILGSGFGPFIEKVEDPVIIDYKDIPHFPQPTVEGHSGKLVFGRISDKPVMIMAGRFHLYEGHDPATVAFPVYLAKYVGVKGVVVTNAAGAINPEFKPGEIILVRDIINFMFRNPLRGPNDEKIGPRFPDMSSVVDPEWARKIQE-----RLSLKEGVYIGVLGPSYETPAEIRVFEKLGADLVGMSTVPEVIAAKHCGLKVVVFSCVTNMAAGITHGRLSHEEVVRTTKMAQGKIEKALTTAVEVF. 271
2 -116.0001yqq_A mol:protein length:277 Xanthosine phosphorylase  ali model follow..  44  6FSHNPLFCIDIIKTYKDFTPRVAFILGSGLGALADQIENAVAISYEKLPGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTFKLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPGTPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKEEGFPLTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEGLSDVKLSHAQTLAAAELSKQNFINLICGFLRKI. 276
3 -114.0003odg_A mol:protein length:287 Xanthosine phosphorylase  ali model follow..  45  14FNELPFQAVKYIQKIPGFKPQIAFILGSGLGDLVDQITNDTTISYADIPGFPVSSVHGHAGELVLGDLCGVPVMCMKGRGHFYEGKGMSIMTNPVRTFKLMGCEFLFCTNAAGSLRPEVLPGSVVMLKDHINTMPGTPLVGPNDDRFGPRFFSLANAYDKDLRADMAKIAQQLDIPLTEGVFVSYPGPCFETPAEIRMMQIIGGDVVGMSVVPEVLSAAHCGLKVIALTAITNLAEGLSDVVLSHEQTLKFAKVASVNFTKLIEAFLKSK. 284
4 -112.0004m1e_A mol:protein length:297 Purine nucleoside phosphorylase  ali model follow..  50  20LKSRIDQATAKISQLWQGEPAVGMILGTGLGGLAEQIEQDIAIPYSDIPHFPTSTVKSHAGRLVCGRLRGIPIVAMEGRFHYYEGYSLEQVTFPVRVMKAMGVKTLLVTNAAGGINPQLDLSDVLIIEDHINLMPENPLRGPNDEELGPRFPDMSHPYDCQHMEVARQVALELGIHCPKGVFVAVSGPNLETRAEYRMLKLMGADVVGMSTVPEVLVAVHAGLRVLGFSVVTDLCLPDALEPVELNKILEVAARGGAKLARLIPEILPRI. 289
5 -111.0003la8_A mol:protein length:303 Putative purine nucleoside phosphorylase  ali model follow..  56  31LLKKIYETRDFLTAKGVQKPEFGLILGSGLGELAEEIENALVLNYADIPNWGRSTVSGHAGKLIYGELAGRKVLALQGRFHYYEGNSMELVTFPIRIMKALGCQGLIVTNAAGGIG--FGPGTLMAISDHINLTGANPLMGENLDDFGFRFPDMSNAYTADYREVAHQVADKIGIKLDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGFQ-SELNHEEVVAVTQQIKEDFKGLVKAILVEL. 297
6 -111.0004ns1_A mol:protein length:295 Purine nucleoside phosphorylase  ali model follow..  50  20QEQHYHEAASFLSSRLPGDAKTAIILGSGLGELAEKIENKTVIPYNEIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHINN-LPNPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQELNIPVKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHFADDFVNEQDVIRAANAASEKMGAIFARLIAAV. 289
7 -110.0004lna_A mol:protein length:293 Purine nucleoside phosphorylase  ali model follow..  48  17MFEQIQETTQFIQSKITLRPAIGIILGTGLGALTNELDIDTTIPYETIPHFPLSTVEFHSGKLLIGTLGGKSVVVMQGRFHYYEGYTMQQVTYPVRVMHALGIQTLLVSNAAGGMNPTFQTSDLMVIDDHISLLPQNPLICPNPPIFGDRFPDMSEPYRKSLIDLAFSVAAELDIPLKRGVYVSVTGPQLETRAEYRMLRQWGADAVGMSTVPEVIVANQLGMDVFGISVITDLCFPDTLEKAELVKILATAAQAEPKLTMLIREMIGRL. 287
8 -110.0004uc0_A mol:protein length:291 Purine nucleoside phosphorylase  ali model follow..  40  13YFQSMTPAVDLLIDRLGLLPRIAIVLGSGLGGLVDEVENAVRIPFADIPGFPQGGVSGHAKELVAGLFAGQPIIMLAGRVHYYEEGDAAAMRLPIETLASLGVTTLILTNAAGSLRADMPPGSVMQLIDHINFSGHNPLIGETGD---GRFVGMTQAYDGELAEAMRRAADAEDISLSSGVYMWFSGPSFETPAEIRMARTLGADAVGMSTVPEVILARFFGLKVAAASVITNYGAGMTGAELSHEETKDMAPIGGRRLVAILKRMIVDG. 280
9 -110.0001tcu_A mol:protein length:287 purine-nucleoside phosphorylase  ali model follow..  43  8NIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSVVGHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLNHEEVLATGAQRAELMQSWFEKIIEKLP 285
10 -109.0005CXQ Entity 1(prereleased)  ali follow..  45  9NYENASMAADYIKRVSNVLPDIGIICGSGLGKLIEEIEERKVIPYINIPNFPKTTVAGHVGNLVLGSVGGRKIVAMQGRLHMYEGYSNQEIALPIRVMKLLGVRVLLITNLAGGINRKLKSGDFVLIKGHINFPGNNVLVGPNQDEFGPRFPDLSNAYDRLLQQLALKIAQENDFQVHEGVYAFNGGPTYESPDESNMLLKLGCDVVGMSTVPEVIIACHCGIKVLAVSLIANNSILDAENSINHEKVLAVAEKRADLLQMWFKEIITRLP 286
11 -109.0003khs_A mol:protein length:285 Purine nucleoside phosphorylase  ali model follow..  48  3DYDLAKETAAWLNKQLQIRPVLGIVCGSGLGKIGDSLETSITVAYSDIPNFPVGSVKGHAGSLIFGSVNGVSCVCMKGRFHLYEGHTAARATFPMRVFKALGVKIVVLTNAAGGLNPSYRPGDFMVVRDHINLAGANPLTGPNDDTEGERFPSMTSVYDKTLRKYAISAARELGMSTHEGVYCCVNGPSFETPAECKILRLMGSDAVGMSTAPETIVAKHGGMRCLAVSLISNVIASNCETPATHEEVLRAGEEASARMTALVKLVIEKIR 280
12 -109.0001a9o_A mol:protein length:289 PURINE NUCLEOSIDE PHOSPHORYLASE  ali model follow..  47  7.YEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESKANHEEVLEAGKQAAQKLEQFVSLLMASIP 283
13 -106.0003gb9_A mol:protein length:311 Purine nucleoside phosphorylase  ali model follow..  45  28TYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYEEKANHEEVLAAGKQAAQKLEQFVSILMASIP 305
14 -105.0004ear_A mol:protein length:324 Purine nucleoside phosphorylase  ali model follow..  46  35TYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEEKANWEEVLAAGKQAAQKLEQFVSILMASIP 312
15 -105.0003phb_E mol:protein length:324 Purine nucleoside phosphorylase  ali model follow..  46  35TYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEEKANHEEVLAAGKQAAQKLEQFVSILMASIP 312
16 -102.0001g2o_A mol:protein length:268 PURINE NUCLEOSIDE PHOSPHORYLASE  ali model follow..  36  8PDELARRAAQVIADRTGIEHDVAVVLGSGWLPAVAALSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGE-------FVDLTDAYSPRLREL----ARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF. 268
17 -100.0002p4s_A mol:protein length:373 Purine nucleoside phosphorylase  ali model follow..  45  85TYDTLQEIATYLLERTELRPKVGIICGSGLGTLAEQLTDVDSFDYETIPHFPVSTVAGHVGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPKYRVGDIMLIKDHINLMGNNPLQGPNDERFGPRFFGMANTYDPKLNQQAKVIARQIGIELREGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITNMCTMSYEEEHCHDSIVGVGKNREKTLGEFVSRIVKHIH 362
18 -98.4001c3x_A mol:protein length:266 PENTOSYLTRANSFERASE  ali model follow..  36  10PFLVARAAADHIAQATGVGHDMALVLGSGWGGAAELLGEVVEVPTHEIPGFSSVTRSIR---VERADGSVRHALVLGSRTHLYEGKGVRAVVHGVRTAAATGAETLILTNGCGGLNQEWGAGTPVLLSDHINLTARSPLEGPT-------FVDLTDVYSPRLREL----AHRVDPTLPEGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTNLAAGISPTPLSHAEVIEAGQAAGPRISALLADIAKR.. 266
19 -40.7003ozb_A mol:protein length:259 Methylthioadenosine phosphorylase  ali model follow..  22  9..................MSVYAIIGGTGLTQLEG---------LTLSESLPIETPYGASAPLQRGRYAGREVLFLHGHPHRFPPHQVNYRA--LWALKQAGAEAVIAVNAVGGIHAAMGTGHLCVPHQLIDYTSGREHTYFAGDIEHVTHIDFSHPYDEPLRQRLIEALRALGLAHSSGVYACTQGPRLETVAEIARLERDGNDIVGMTGMPEAALARELDLPYACLALVVNPAAGKSAGIITMAEIEQALHDGIGKVREVLARVLA... 252
20 -34.1001cb0_A mol:protein length:283 PROTEIN (5`-DEOXY-5`-METHYLTHIOADENOSINE PHOS  ali model follow..  23  3............SGTTTTAVKIGIIGGTGLDDLEGRTEKYVDTPFGK------------SDALILGKIKNVDCVLLHGRQHTIMPSKVNYQA--IWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEAVSVDRVLKTLKENANKAKSLLLTTIPQI. 258
21 -33.8001v4n_A mol:protein length:281 271aa long hypothetical 5`-methylthioadenosin  ali model follow..  25  1...........MMIEPKEKASIGIIGGSGLYDPQ----------LTNVKEIKVYTPYGESDNIILGELEGRKVAFLHGRGHRIPPHKINYRA--IWALKSLGVKWVIAVSAVGSLRLDYKPGDFVVPNQFIDMTKGRTYT---FDGPTVAHVSMADPFCEHLRSIILDSAKDLGITTHDGTYICIEGPRFSTRAESIVWKEVKADIIGMTLVPEVNLACEAEMCYSVIGMVTDYDVF-ADIPVTAEEVTKVMAENTAKVKKLLYEVIRRL. 251
22 -33.5002a8y_A mol:protein length:270 5`-methylthioadenosine phosphorylase (mtaP)  ali model follow..  26  2.............IEQNEKASIGIIGGSGLYDPG----------FSESKEIKVYTPYGQSDFITIGKIGNKSVAFLHGRGHRIPPHKINYRA--IWALKELGVRWVISVSAVGSLRMDYKLGDFVIPDQFIDMTKNREYS---FDGPVVAHVSMADPFCNSLRKLAIETAKELNIKTHEGTYICIEGPRFSTRAESRTWREVKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVF-AEIPVTAEEVTRVMAENTEKAKKLLYALIQKL. 250
23 -33.0001wta_A mol:protein length:275 5`-methylthioadenosine phosphorylase  ali model follow..  23  4...........ITRPPGVRAHVGVIGGSGLYDPG----------VENPVEVKVSTPYGNSDFIVVGDVAGVKVAFLHGRGHRIPPHAINYRA--IWALKALGVKWVISVSAVGSLREDYRPGDFVVPDQFIDMTKNRR-----YDGPVTVHVSMADPFCEDLRQRLIDSGRRLGYTVHEGTYVCIEGPRFSTRAESRVWKVFKADIIGMTLVPEINLACEAQLCYATLAMVTDYDVW-ADRPVTAEEVERVMISNVERARRMLYDVIPKL. 255
24 -32.8005F76 Entity 1(prereleased)  ali follow..  19  1.MGSSSSGLVPRGSHMMSKVKVGIIGGTGFDDPN----------FKKVGVRQVTTPFGKSDTLVEGFVGDVACVVLHGKGHLIPPSEVNYRA--VWALKDLGCTHILATNACGSLQEDLVPGDFVVLNQFMDKTWGRENTSKPDSLKGVLHMPMAEPFCERTRQILIQAARNKSINVYDGSAVTINGPRFSTRCESFIHKAMGLDIVNMTLVPEVSLAREAGLSYASIAIVTDFDCWKSEEHVCVDMVLEQFRKSVVHVREILLEAVALI. 283
25 -32.7004l5a_A mol:protein length:320 S-methyl-5`-thioadenosine phosphorylase  ali model follow..  19  1.MGSSSSGLVPRGSHMMSKVKVGIIGGSGFDDPN----------FKKVGVRQVTTPFGKSDTLVEGFVGDVACVVLHGKGHLIPPSEVNYRA--VWALKDLGCTHILATNACGSLQEDLVPGDFVVLNQFMDKTWGRENTSKPDSLKGVLHMPMAEPFCERTRQILIQAARNKSINVYDGSAVTINGPRFSTRCESFIHKAMGLDIVNMTLVPEVSLAREAGLSYASIAIVTDFDCWKSEEHVCVDMVLEQFRKSVVHVREILLEAVALI. 283
26 -30.7004glf_A mol:protein length:297 RsfP  ali model follow..  19  2.......TSTAVEITVKNAADIAIIGGSGLYQMQA---------LTNKRSVKIETPYGESDDIVLGELNGVTVAFLHGQGHRLTPSEVPYRA--IYALKTLGVRYIVSVSAVGSLQETLKPLDMVIPDQMIDMTKQRVSTFFGDGAVA--HVSMADPLCPEVADILIRAYDNADIA-AKATYVCIEGPQFSTRAESHWYRQMQADIIGMTNMPEAKLAREASIAYATLALVTDFDC-PNEQAVSADYAIQNLMKNADNAQQVIKQAVALI. 260
27 -15.4004bmx_A mol:protein length:251 MTA/SAH NUCLEOSIDASE  ali model follow..  17  4......SSSGLVPRGSHMVQKIGIL-----GAMREEITPILELFGVDFEEIPLGGNV-----FHKGVYHNKEIIVAYSKI------KVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFI----PESAIFISESLNALAKEVANEQHIVLKEGVIA--SGDQFVHSKE-FLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADE--EANMSFDAFLEKSAQTS---AKFLKSMVDEL. 245
28 -15.0004wkn_A mol:protein length:245 Aminodeoxyfutalosine nucleosidase  ali model follow..  21  12....................KIGIL-----GAMREEITPILELFGVDFEEIPLGGNVFHKGV-----YHNKEIIVAYSKI------KVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFI----PESAIFISGSLNALAKKIANEQHIALKEGVIA--SGDQFVHSKERKLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADE--KAGMSFDEFLEKSAHTS---AKFLKSMVDEL. 239
29 -14.8001jds_A mol:protein length:236 5`-METHYLTHIOADENOSINE PHOSPHORYLASE  ali model follow..  17  2.......NPVHILAKKGEVAERVLVVGDPGRALSTLLQNPKLT--NENRGFLVYT----------GKYNGETVSIAT------HGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVT------GASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSD--------NLAKGGIWITKEELEKSVMDGAKAVLDTL. 234
30 -14.8004ffs_A mol:protein length:239 MTA/SAH nucleosidase  ali model follow..  20  1...............MEFMQKIGIL-----GAMREEITPILELFGVDFEEIPLGGNV-----FHKGVYHNKEIIVAYSKI------KVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFI----PESAIFISGSLNALAKKIANEQHIALKEGVIA--SGDQFVHSKERKLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADE--KAGMSFDEFLEKSAHTS---AKFLKSMVDEL. 233
31 -14.6004jwt_A mol:protein length:259 Methylthioadenosine nucleosidase  ali model follow..  22  18....................KIAIM-----GAMPEEISPIL----EKIGSYKSTSYAG---KYYEATYQGVELVIAYSKI------KVFSALSAATMIEHFGATKLLFSGVAGAISTNLKVGDLIVATKLSQHDLDITAFGHPYGYV----PEGSVFVDKDMIELSKKVALEMGKSVQEGIIA--TGDQFVANEE-WIGTTFGADALEMEGGSVGVVCNALNIPFFILRSISDAADM--DASFSFDEFLESSAKESAEFIMKMVDELVALP 248
32 -14.1002bsx_A mol:protein length:253 PURINE NUCLEOSIDE PHOSPHORYLASE  ali model follow..  13  1....MDNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDIKRGDICICNAAVR--------RVSHLLIHGDFPAVG---DFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 243
33 -13.8001sq6_A mol:protein length:253 uridine phosphorylase, putative  ali model follow..  13  2...AMDNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDIKRGDICICNAAVR--------RVSHLLIHGDFPAVG---DFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 245
34 -13.6003emv_A mol:protein length:253 Uridine phosphorylase, putative  ali model follow..  14  3.....GEMQRHIKLTKAQTTPVVLVVGD-VDKVKVLCDSYVDLAYN------------REYKSVECTYKGQKFLCVS------HGVGSAGCAICFEELMNNGAKVIIRAGSCGSLQPQMKRGDICICNAAVR--------RVSHLMIYSDFPAVA---DYEVYATLNQVAEELKVPVFNGISLSSDMPHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWDEGDFDNNLVPERLENMIKISLETCARLAKK.. 244
35 -13.3002b94_A mol:protein length:267 purine nucleoside phosphorylase  ali model follow..  15  19.....EEMQRHIKLTPSQTTPVVLVVGD-VDKVKMLCDSYVDLAYN------------REYKSVECTYKGQKFLCVS------HGVGSAGCAICFEELMNNGAKVIIRAGSCGSLQPQMKRGDICICNAAVR--------RVSHLMIYSDFPAVA---DFEVYDTLNKVAQELEVPVFNGISLSSDLPHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWDEGDFDNNLVPEKLENMIKISLETCARLAKKY. 261
36 -13.0004jos_A mol:protein length:250 Adenosylhomocysteine nucleosidase  ali model follow..  19  19....................KIAIL-----GAMEIEIQPIL----QKLEKYETVEYAN---KYYVANYNGIELVVAYSKI------KVFSSLTATIMIEHFGVDALLFTGVAGGLQ-DLQVGDMIAATATVQHDVDITAFGYPYGKI----PISEVEISARILEQAKVIAKELNLNLHTGVIA--TGDQFVHSAE-FVVKEFDAKAIEMEGASVNLICNEMNIPSFILRSISDTADG--DAPDNFDEFAKMAANRS---ADFVMKLVDRI. 244
37 -13.0004f1w_A mol:protein length:248 5`-methylthioadenosine/S-adenosylhomocysteine  ali model follow..  18  15................................IIGAMEEEVTLLRDKIDNRQTITLGG---EIYTGQLNGTEVALLKSGI------KVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQL----PGCPAGFDDKLIAAAESCIRELNLNAVRGLIV--SGDAFINGSVGLRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQ--QSHLSFDEFLAVAAKQSTLMVETLVQKLAH.. 241
38 -13.0001jys_A mol:protein length:242 MTA/SAH nucleosidase  ali model follow..  17  15................................IIGAMEEEVTLLRDKIENRQTISLGG---EIYTGQLNGTEVALLKSGI------KVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQL----PGCPAGFDDKLIAAAEACIAELNLNAVRGLIV--SGDAFINGSVGLRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQ--QSHLSFDEFLAVAAKQSSLMVESLVQKLAH.. 241
39 -12.9004wkc_A mol:protein length:245 5`-methylthioadenosine/S-adenosylhomocysteine  ali model follow..  17  5................................IIGAMEEEVTLLRDKIENRQTISLGG---EIYTGQLNGTEVALLKSGI------KVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQL----PGCPAGFDDKLIAAAEACIAELNLNAVRGLIV--SGDAFINGSVGLRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQ--QSHLSFDEFLAVAAKQSSLMVESLVQKLAHGE 233
40 -12.8004lnh_A mol:protein length:266 Uridine phosphorylase  ali model follow..  13  12LYFQSMSKQPHICVDENQVSPYVIVCGE-VNRIVELMDNVELLA------------ENREYRVFNGVYKGTTITICS------TGIGAPSMIIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVR--------GGSKAYISSAYPAYA---SFALLKEISHFLENQSVKYYFGVVRSHDS-TDEEDQLCQYWNKKGILGADMETSALFTVGRLRGLQVASI--LNNVVLYQQDVKEGVNQYVNDNKAMMNGERLAAITALETL. 255
41 -12.8004g89_A mol:protein length:237 5`-methylthioadenosine/S-adenosylhomocysteine  ali model follow..  17  10................................IIGAMEEEVTLLRDKIENRQTITIGG---EIYTGQLHGVDVALLKSGI------KVAAAMGATLLLERCQPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQL----PGCPAGFDEKLVAAAESCIKALDLNAVRGLIV--SGDAFINGSVGLRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQ--QSHLSFEEFLAVAARQSTLMVENLVQNLAR.. 236
42 -12.8003mms_A mol:protein length:230 5`-methylthioadenosine / S-adenosylhomocystei  ali model follow..  15  5................................IIAAMPEELAYLVQHLDNAQEQVVLG---TYHTGTIVSHEVVLVESGI------KVMSAMSVAILAVHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQM----AQQPLYFDKTFVAQIQESLSQLDQNWHLGLIA--TGDSFVAGNDKIKSHFPEVLAVEMEGAAIAQAAHALNLPVLVIRAMSDNANH--EANIFFDEFIIEAGRRS---AQVLLAFLKALD 230
43 -12.8003bl6_A mol:protein length:230 5`-methylthioadenosine nucleosidase/S-adenosy  ali model follow..  16  6................................IIGAMEEEVTILKNKLTQLSEISVAH---KFYTGILKDREVVITQSGI------KVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQI----PQMPVAFSKPLIEKVSQVVQQQQLTAKVGLIV--SGDSFIGSVEQRKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANG--EAEMSFEAFLEKAAVSS---SQTVEALVSQL. 230
44 -12.8001zos_A mol:protein length:230 5`-methylthioadenosine / S-adenosylhomocystei  ali model follow..  15  5................................IIAAMPEELAYLVQHLDNTQEQVVLG---TYHTGTIASHEVVLVESGI------KVMSAMSVAILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQM----AQQPLYFDKTFVAQIQESLSQLDQNWHLGLIA--TGDSFVAGNDKIKSHFPEVLAVEMEGAAIAQAAHTLNLPVLVIRAMSDNANH--EANIFFDEFIIEAGRRS---AQVLLAFLKALD 230
45 -12.8004g41_A mol:protein length:236 MTA/SAH nucleosidase  ali model follow..  15  10................................IIAAMEEELSLLLANLLDAQEHQVLS---TYYTGRFGKHELILVQSGV------KVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQM----AGQPLYYDPQFVAIFKQVLKHEKTNGQVGLIA--TGDSFVAGQDKIKTAFSNVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAH--DANITFDQFIIEAGK---RSAQILMTFLENLP 235
46 -12.6003qpb_A mol:protein length:282 Uridine phosphorylase  ali model follow..  17  21.YSGEVGLQYHLQIRPGDVGRYVIMPGD-CAKIAEHFDNAVLV--ADSREYVTYT----------GTLNGEKVSVTS------TGIGGPSASIAMEELKLCGADTFIRVGTCGGIELDVKGGDIVIATGAIRME------GTSKEYAPIEFPAVA---DLEVTNALVNAAKKLGYTSHAGVVQCKDA-SYELLNKWEAWKRLGTKASEMESAALFVAASHLGVRCGSDFLVVG----ERNALGMDNPMAHDTEAAIQVAVEALRTLIEN.. 272
47 -12.5001nw4_A mol:protein length:276 uridine phosphorylase, putative  ali model follow..  13  2...ALDNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDIKRGDICICNAAVR--------RVSHLLIHGDFPAVG---DFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 245
48 -12.4003fow_A mol:protein length:276 Uridine phosphorylase, putative  ali model follow..  13  2...ALDNLLRHLKISKEQITPVVLVVGD-VDKIKVVCDSYVDLAYN------------REYKSVECHYKGQKFLCVS------HGIGSAGCAICFEELCQNGAKVIIRAGSCGSLQPDIKRGDICICNAAVR--------RVSHLLIHGDFPAVG---DFDVYDTLNKCAQELNVPVFNGISVSSDMPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATK.. 245
49 -12.2001ryz_A mol:protein length:253 Uridine phosphorylase  ali model follow..  12  55.................................................................AELDGKAVIVCS------TGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLD------GASLHFAPMEFPAVA---DFACTTALVEAAKSIGATTHVGVTASSDT-VRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIV----TQQEIPNAETMKQTESHAVKIVVEAARRLL.... 253
50 -12.2004i2v_A mol:protein length:253 Uridine phosphorylase  ali model follow..  12  1................................MAKSDVFHLGLTKNDLQGATLAIVPGDPQRVWRAELDGKAVIVCS------TGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINVGDVLVTTAAVRLD------GASLHFAPMEFPAVA---DFSCTTALVNAAKSVGATTHIGITASSDT-VRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIV----TQQEIPNEETMKATESHAVKIVVEAARHLL.... 253
51 -12.1001tgv_A mol:protein length:256 uridine phosphorylase  ali model follow..  12  58.................................................................AELDGKPVIVCS------TGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLD------GASLHFAPLEFPAVA---DFECTTALVEAAKSIGATTHVGVTASSDT-VRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIV----TQQEIPNAETMKQTESHAVKIVVEAARRLL.... 256
52 -12.0001odi_A mol:protein length:235 PURINE NUCLEOSIDE PHOSPHORYLASE  ali model follow..  17  6.........................VRAHPGDVAERV----------LPGDPYNDHRGLWG--YTGLYKGVPVSVQT------TGMGTPSAAIVVEELVRLGARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQYLEGR--------PYAPVPDPEVFRALWRRAEALGYPHRVGLVASEDAFYATTPEEARAWARYGVLAFEMEASALFLLGRMRGVRTGAILAVSNRI--GDPELAPPEVLQEGVRRMVEVALEAVLEV..... 235
53 -12.0005C80 Entity 1(prereleased)  ali follow..  13  54.................................................................AELDGQSVVVCS------TGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLD------GASLHFAPMEFPAVP---DFDVATAMKAAAQESGATVHMGVTASSDT-VRRFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVII----TQKEIPDHATLKETEARSIKVVVEAARKMLK... 253
54 -12.0004r2w_A mol:protein length:252 Uridine phosphorylase  ali model follow..  11  53.................................................................AYADGKPVVICS------TGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLD------GASLHFAPMEFPAVA---NFECTTAMVAACRDAGVEPHIGVTASSDT-TRRFAGSMKEWQDMGVLNYEMESATLFTMCATQGWRAACVAGVIV----TQQEIPDEATMKKTEVSAVSIVVAAAKKLLA... 252
55 -11.9003o6v_A mol:protein length:261 Uridine phosphorylase  ali model follow..  13  62.................................................................AELDGQSVVVCS------TGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLD------GASLHFAPMEFPAVP---DFDVATAMKAAAQESGATVHMGVTASSDT-VRRFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVII----TQKEIPDHATLKETEARSIKVVVEAARKMLK... 261
56 -11.5004r31_A mol:protein length:279 Uridine phosphorylase  ali model follow..  11  69.................................................................GYLENEPVVVCS------TGIGGPSVSICVEELAQLGVGTFLRIGTTGAIQPYINVGDVLVTTGAVRLD------GASRHFAPLEYPAVA---DFSCTNALYSAAVAQGITPYVGITASSDT-YPAYQGSLKQWQDLNVMNYEMESATLFTMCAALGLKAGMVAGVIV----TQQEIPNEATIKSTEQKAVAVVIEAARRLISA.. 269
57 -11.4004qez_B mol:protein length:239 5`-methylthioadenosine/S-adenosylhomocysteine  ali model follow..  19  5................................VIGAMEEEVRILRDKLEQAETETVAG---EFTKGQLAGHEVILLKSGI------KVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQV----PGMPPGFDEALVALAEKCMQAENIQVVKGMIA--TGDSFMSDPNRVRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGK--ESNVSFDQFLDQAALHS---TNFIVKVLEELK 231
58 -11.3003tl6_A mol:protein length:242 Purine nucleoside phosphorylase  ali model follow..  17  14.........................NGAKYGEIAETV----------MAGDPLRV----ADTYLTDVVQYNSVRGAVGYTGYYKGVKLSVQIYAYELFNFYGVKRIIRIGSAGAFDESLKLGDIVI--------GMGACYDSNFERQYDIPGKYSCIADFQLCREAVDAAEKLGYRYKVG--IYSANYFYDDGDHSGAWKKMGVLAVEMEAAALYMIAARARKQALCMLTISD--------LCYGSGEKMTAEERRTKFTQMMEVALSLAK 242
59 -11.3005dk6_A mol:protein length:265 5`-methylthioadenosine/S-adenosylhomocysteine  ali model follow..  18  18....................KAGII---------GAMEPEVAILKEKLTDAKSTEHAG---TFHQGQLDGSDVVIVQSGI------KVAAALATAILIDRFQVDYVVNTGSAGGFDASLKVGDIVVSSEVRYHDVDLTAFGYEIGQL----PANPAAFHDDLVAAAKKGIEQLSQTAGENIKA-TTGDTFMTKEEDVRANFPTMAAVEMEGAAIAQACLQLKTPFVVIRSLSDIAGK--ESPHTFEEYLETAAV---NSSQLVLNMLGQLK 252
60 -11.3004tym_A mol:protein length:258 Purine nucleoside phosphorylase DeoD-type  ali model follow..  19  21.........................IEAKQGEIADKI----------LPGDPLRA----AENFLEDAVCFNTVRNMFGYTGTYKGHRVSVMIYARELIVDYGVKTLIRVGTAGAINPDIHVRELVL--------AQAAATNSNIIRNDWPEFDFPQIADFKLLDKAYHIAKEMDITTHVGSVLSSDVFYSNQPDRNMALGKLGVHAIEMEAAALYYLAAQHNVNALAMMTISD--------NLNNPEEDTSAEERQTTFTDMMKVGLE... 247
61 -11.3001ybf_A mol:protein length:268 AMP nucleosidase  ali model follow..  13  56................................................................MPNASAEGVTLIN-------GMGSANAATIMDLLWAIHPKAVIFLGKCGGLKLENALGDYLLPIAAIR--------GTSNDYLPEEVPSLPSF---SVLRAISSAIQNKGKDYWTGTVYTTNRRVWEYDEKFDYLRSTHASGVDMETATLMTVGFANKIPMGALLLISDRPMFPEGVKTEESDQLVTDNFAEEHLMLGIDAL..... 243
62 -11.2004wkb_A mol:protein length:244 5`-methylthioadenosine/S-adenosylhomocysteine  ali model follow..  17  5................................IIGAMQQEVAILKDLIEDVQEVNQAG---TFYSGQIQGVDVVLLQSGI------KVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQM----AGQPAAFDEKLMTVAEQALAQLNTHAVRGLIC--TGDAFVCTAERQRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADK--ESPLSFEEFLPLAAKSSSAMVLKMVELLKE.. 232
63 -11.2004x24_A mol:protein length:244 5`-methylthioadenosine/S-adenosylhomocysteine  ali model follow..  18  5................................IIGAMQQEVAILKDLIEDVQEVNQAG---TFYSGQIQGVDVVLLQSGI------KVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQM----PGQPAAFDEKLMTVAEQALAQLNTHAVRGLIC--TGDAFICTAEGQRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADK--ESPLSFEEFLPLAAK---SSSAMVLKMVELLK 231
64 -11.2003eei_A mol:protein length:233 5-methylthioadenosine nucleosidase/S-adenosyl  ali model follow..  16  8................................VIGAMEQEIELLREMMENVKAVSFGR---SAYEGELAGKRMVLALSGI------KVNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQV----PQLPARFDGILIEAAKRAARTFGAAVEQGLIV--SGDRFVHSSEGVRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADE--KADISFDEFLKTAAA---NSAKMVAEIVKSL. 233
65 -11.2004d8v_A mol:protein length:253 Purine nucleoside phosphorylase deoD-type  ali model follow..  18  19.........................IGAEKGQIADTV----------LPGDPLRA----AETYLENVECYNEVRGMYGFTGTYKGKKISVQIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVIL--------AMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVG--VFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSD-------HVLTGEET--TAEERQTTFHDMIDVALHSV. 245
66 -11.1004m3n_A mol:protein length:254 Purine nucleoside phosphorylase DeoD-type  ali model follow..  16  21.........................ISAPPGAVAEAI----------LPGDPLRA----AENFLENPVLYNQVRNMFGYTGTYKGKRVSVQIYIHELVQFYGCKTLIRVGTAGAITERLKLRDLVI--------AQAACTDSSINNLRFAGQNYAPIATFDLLRRAYEQAQSRGMPVHVGNVLSTDTFYHDQPNPYQLWAQFGVLAVEMEAAGLYTLAAKFGVQALCILTISD-------HLITGEKT--TPQERQETFDQMIEVALETI. 248
67 -11.0004kn5_A mol:protein length:253 Methylthioadenosine nucleosidase  ali model follow..  16  18....................RYGVI---------NAMAEEKAALVDAMIDEKKTTIAG---LFHHGKIGHVDVVVVESGI------KVASALTTTLLITNFGVDAVINSGSAGALGTDLRIGDIVIADYLAYADADARAFGYAYGQV----PQQPARFDTDLSNDLSESYEKVDARLVRGLVV--TSDSFIASNEQKLTHFPEAQSAEMEGASIAQVANYFDVPFAVVRAISDNANG--EAGMTFDDFIVEAGQ---QSAQVLINFFEAQ. 246
68 -10.7004l0m_A mol:protein length:259 putative 5`-methylthioadenosine/S-adenosylhom  ali model follow..  14  1....MSSGVDLGTENLYFQSMILII-----SAMQEESEEINKILDNKEEIVLNDYLEN---KIYKGKILGKDVISLTTGI------KVNAATWSSQIISKYKITHIINSGSSGGINSNLKILDIIVSSETAYYDFDLTKFGHKIGQV----PNLPQKFDEELLKKVANIVDNKLLNIDIHIGLILTGDQFVDNEKNLKKNFKDALAVDMEGAAIAQVAHIFKIPFIIIRSISDLPNNKDNHIDFNKFLKTSSINSSKMTKELIRLI..... 253
69 -10.6001pr0_A mol:protein length:239 Purine nucleoside phosphorylase  ali model follow..  18  6.........................INAEMGDFADVV----------MPGDPLRA----AETFLEDAREVNNVRGMLGFTGTYKGRKISVMIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVI--------GMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSD-------HIRTHEQT--TAAERQTTFNDMIKIALE... 231
70 -10.6005I3C Entity 1(prereleased)  ali follow..  18  5.........................INAEMGDFADVV----------MPGDPLRA----AETFLEDAREVNNVRGMLGFTGTYKGRKISVMIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVI--------GMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSD-------HIRTHEQT--TAAERQTTFNDMIKIALE... 230
71 -10.6002isc_A mol:protein length:239 purine nucleoside phosphorylase  ali model follow..  14  5.........................NSAQVGDFAETV----------MCGDPLRA----AETYLENPKLVNNVRGIQGYTGTYKGKPISVMIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVI--------FTSAGTNSKINRIRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSD-ETTAEERQNSFQNMMKIALEAAIKL............ 235
72 -10.5003occ_A mol:protein length:239 Purine nucleoside phosphorylase deoD-type  ali model follow..  16  6.........................INAEMGDFADVV----------MPGDPLRA----AETFLQDVREVNNVRGMLGFTGTYKGRKISVMIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVI--------GMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSD-------HIRTGEQT--TAAERQTTFNDMIEIALE... 231
73 -10.5001xe3_A mol:protein length:245 purine nucleoside phosphorylase  ali model follow..  17  9.........................IEAKQGEIAESI----------LPGDPLRA----AETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVII--------AMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSD-------HIFTGEET--TSEERQTTFNEMIEIALD... 234
74 -10.5004lkr_A mol:protein length:256 Purine nucleoside phosphorylase DeoD-type  ali model follow..  14  21.........................INAQPTDFAETV----------MPGDPLRA----AETYLTDAVEVTNVRNMLGYTGYYQGQRISVMLYGHELINFFGVKRIIRIGSLGATQQHVEMRDVIL--------AQAAGTDSPTNAKRSSGYHMATSATFSLLHKAYTKANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSD-------HCLTGEET--TAQERQLSFNNMIELALE... 246
75 -10.5004ldn_A mol:protein length:261 Purine nucleoside phosphorylase DeoD-type  ali model follow..  11  22.........................INAPLDAFADTI----------MPGDPLRA----AETYLENVVQVTDVRGMLGFTGEFKGRKISVMIYFHELMTTYKVKNFIRIGSCGAIHDDVKLKDLIV--------AIGASTDSKMNRIRFKDNDFAATANYNMLSECVNTLKTTDINYLVGNVFSSDLFYRPDEEQYDMMARYGILGVEMEVNALYSAAAENHCNAVALCTVTD-------HIKNHEHL--TADERRTELHEMINVALD... 247

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.