current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0006 Xaa-Pro aminopeptidase, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst MNQNPIKRLQDSLVERALDAFLIEKDEDISYFLQDQARSGVLLITRDEAVLFVSPLDKDLYARIQDVVLVSYSKSVDQELGSYIENTGLKTIGFDSEYTPYGIAQKRMNSGYAFSPQSLVAEKLRCVKSTEEIQKMTRAAEIGSAGYDFVLAALRPGITEKELVRMLHVFWANLGIEKVSFPPIIAFGENAAFPHAIPTNRSLKKGDVVLIDIGVCYEGYCSDMTRTVAFGATPEQQLLDGYVAVAEAQRAAIEFCRAGVPCRDVHKEAVRILRAHGMEKAFIHGLGHGVGREVHEYPRLSPFSDATLQLNMAVTVEPGVYFPGVGGIRIEDTIMIGVNENLNLTNRKVSSEIIIILast
1 -106.0003q6d_A mol:protein length:356 Proline dipeptidase  ali model follow..  31  3.AMEKIERLRSAFDEAGIDGILLTNEHSRRYMANFTGTAGVVLISKKRAQFITDFRYVEQASKQAGYEIVQHAGLIIDEVAKQVKELGIQKLGFEQDTLTYSSYSAHKEADAEFIPTSGLVEKLRLIKTDSEIKILKEAAQIADAAFEHILSFIRPGVSEIEVSNELEFFMRKQGATSSSFDIIVASGLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAVGE-PSDKLKEIYNIVLEAQLRGVNGIKAGLTGREADALTRDYITEKGYGEYFGHSTGHGIGLEIHEAPGLAFRSDTVLEPGMAVTVEPGIYIPGIGGVRIEDDIIVTSEGNEVITKSP--KELIIL 356
2 -105.0005cnx_A mol:protein length:361 Aminopeptidase YpdF  ali model follow..  31  1..STLLASLRDWLKAQQLDAVLLSSRQNKQPHLGISTGSGYVVISRESAHILVDSRYYVEVEARAQLHLLDATNTLTTIVNQIIADEQLQTLGFEGQQVSWETAHRWQ-SELNAKLVSATPDVLRQIKTPEEVEKIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQGAEKASFDTIVASGWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNGEESHLLFNVYQIVLQAQLAAISAIRPGVRCQQVDDAARRVITEAGYGDYFGHNTGHAIGIEVHEDPRFSPRDTTTLQPGMLLTVEPGIYLPGQGGVRIEDVVLVTPQGAEVLYAMP--KTVLLT 358
3 -103.0002zsg_A mol:protein length:359 Aminopeptidase P, putative  ali model follow..  30  2...DRSERLIQLISEEGIDAFLIMNIENSAYFSGFTGSFSIILISENTRLLITDSRYTVQAKQETDEVREVKGGDFIDVLKKTVNDLKIKTIALEEERVSLSLFRRISSGDRKFIGIDDEVKQMRMVKDEGEIEKIKQAIEISERAFLETVQQIRAGMTEKEIAALLEYTMRKEGAEGVAFDTIVASGCRSALPHGKASDKVVERGDVIVIDFGATYENYCADITRVVSIGE-PSDEVKEVHSIVLEAQERALKIAKAGVTGKLLDSVAREFIREKGYGEFFGHSLGHGIGLEVHEGPAISFRNDSPLPENVVFTVEPGIYLEGKFGIRIEEDVVLKEQGCEILTTLP--RSIFVV 359
4 -103.0005cdl_A mol:protein length:349 Proline dipeptidase  ali model follow..  30  1..SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSADGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPP--ATYEHAADTVRGLRVGFEAESLTVAELEDLRQPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGES-AFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGT-PSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSA--KESV.. 349
5 -99.7001wn1_A mol:protein length:356 dipeptidase  ali model follow..  29  1...MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRE-LSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGE-LDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAE--RELIIL 356
6 -99.4001wy2_A mol:protein length:351 Xaa-Pro dipeptidase  ali model follow..  32  3IMNEKVKKIIEFMDKNSIDAVLIAKNPNVYYISGASPLAGYILITGESATLYVPELEYEMAKEESNIPVEKFKKM--DEFYKALE--GIKSLGIESS-LPYGFIEELKKNIKEFKKVDDVIRDMRIIKSEKEIKIIEKACEIADKAVMAAIEEITEGKKEREVAAKVEYLMKMNGAEKPAFDTIIASGYRSALPHGVASDKRIERGDLVVIDLGALYQHYNSDITRTIVVGS-PNEKQKEIYEIVLEAQKKAVESAKPGITAKELDSIARNIIAEYGYGEYFNHSLGHGVGLEVHEWPRVSQYDETVLREGMVITIEPGIYIPKIGGVRIEDTILITKNGSKRLTKTE--RELI.. 351
7 -99.0001pv9_A mol:protein length:348 Xaa-Pro dipeptidase  ali model follow..  30  2..KERLEKLVKFMDENSIDRVFIAKPVNVYYFSGTSPLGGYIIVDGDEATLYVPELEYEMAKEESKLPVVKFKKF--DEIYEILK--NTETLGIEGT-LSYSMVENFKENVKEFKKIDDVIKDLRIIKTKEEIEIIEKACEIADKAVMAAIEEITEGKREREVAAKVEYLMKMNGAEKPAFDTIIASGHRSALPHGVASDKRIERGDLVVIDLGALYNHYNSDITRTIVVGS-PNEKQREIYEIVLEAQKRAVEAAKPGMTAKELDSIAREIIKEYGYGDYFIHSLGHGVGLEIHEWPRISQYDETVLKEGMVITIEPGIYIPKLGGVRIEDTVLITENGAKRLTKTE--RELL.. 348
8 -95.7004fkc_A mol:protein length:377 Xaa-Pro aminopeptidase  ali model follow..  30  9.YKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTVLILPSEGLLTAIAPRLYEKELEEFNGEVVLDSENPYKIFATKIKETFKEKLLID-DTMPVGVFLKAKDDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGP-PSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNAD--RELITL 371
9 -95.3004zng_C mol:protein length:362 Prolidase  ali model follow..  27  2...SKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFEDSQNPWEVVKNHVKSDVKSIAVEFSDIPLAKTEGLKAGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQ-PNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTD--HDLLIF 362
10 -93.7004r60_A mol:protein length:400 Proline dipeptidase  ali model follow..  26  33.YQQRIERARVLMRAQGVDALLIGAGTSLRYFSGVPWGASALLLTTEGDPVLICPAFEEGSLDAVRKRLWEEHEDPYALVVQAMDEQHAHALALDPGIAFAVHTGLRAHLGTAIRDAGAIIDGCRMCKSPAELALMQQACDMTLLVQRLAAGIAHEGIGTDQLVRFIDEAHRALGADNGSTFCIVQFGHATAFPHGIPGVQHLRAGELVLIDTGCTVQGYHSDITRTWIYGT-PSDAQQRIWELELAAQAAAFAAVRPGVACEAVDQAARAVLQAAGLGPDYPHRTGHGCGLAIHEAPYLVRGNRQPLQPGMCASNEPMIVVPGAFGVRLEDHFYVTDTGAQWFTPPSVA...... 394
11 -85.9004ege_A mol:protein length:378 Dipeptidase PepE  ali model follow..  27  14VYARRLAAAAAATEQAGLAGLVITPGYDLRYLIGSRADTFALVLPASGVPTIVLPRLELASLKESCVRDWVDGDDPYQLVAVALG--GAPAATAVTDSMPALHLLPLADAGVLPVLATDVLRQLRMVKEAAEVDALAKAGAAIDRVHARVPAFLVPGRTEAQVAADIAEAIVAEGHSAVAF-VIVGSGPHGADPHHGYSDRKLQVGDIVVVDIGGTYEGYYSDSTRTYSIGD-PSPDVAQQYSALQRAQRAAVDAVRPGVTAAQVDAAARDVLADAGLAEYFVHRTGHGIGLCVHEEPYIVAGNELPLVAGMAFSIEPGIYFPGRWGARIEDIVVVTENGALSVNNRP--HELMVV 376
12 -84.6001kp0_A mol:protein length:402 CREATINE AMIDINOHYDROLASE  ali model follow..  22  24.MTRRXXRLRAWMAKSXIDAVLFTSYHNINYYSGWLGRKYAXVIXXVKAVTISKGIDGGMPWRRSFGXNIVYTDWKRDNFYSAVKKLGAKXIGIEHDHVTLXHRRXLXKPGTEFVDVGXPVMWXRVIKSSEEXXLIRXGARISDIGGAATAAAISAGVPEYEVAIATTXAMVRXIARXFPYVELFQSGINTDGAHNPVTXRVVXRGDILSLNCFPMIFGYYTALERTLFLXX-VXDASLXIWXKNTAVHRRGLXLIKPGARCKDIASELNXMYRXWDLLRYRTFGYGHSFGVLXHYYGRLREDIXTVLEPGMVVSMEPMVMEPGAGGYREHDILVIKENXTENITGFPFGPEHNII 400
13 -84.6001chm_A mol:protein length:401 CREATINE AMIDINOHYDROLASE  ali model follow..  22  23.YANRQARLRAHLAAENIDAAIFTSYHNINYYSDFLGRPYALVVTEDDVISISANIDGGQPRRTVGTDNIVYTDWQRDNYFAAIQQAKARRIGIEHDHLNLQNRDKLAAPDAELVDVAAACMRMRMIKSAEEHVMIRHGARIADIGGAAVVEALGDQVPEYEVALHATQAMVRAIADTMDTWTWFQSGINTDGAHNPVTTRKVNKGDILSLNCFPMIAGYYTALERTLFLDH-CSDDHLRLWQVNVEVHEAGLKLIKPGARCSDIARELNEIFLKHDVLQYRTFGYGHSFGTLSHYYGRLREDIDTVLEPGMVVSMEPMIMLPGAGGYREHDILIVNENGAENITKFPYGPEKNII 400
14 -77.9004b28_A mol:protein length:470 METALLOPEPTIDASE, FAMILY M24, PUTATIVE  ali model follow..  17  72MRRFRHRRLTDHVVARGYAGLLMFDPLNIRYATDSTNMQLATLLCADGYMVMWDYKNSPFLSEFNPLKVDVAADVFANEVRILLRDHAPGLRRLAVDKVMLHGLRALQAQGFEIMDGEEVTEKARSVKGPDEIRAMRCASHACEVAVRKMEDFARSKVCENDIWAILHSENVRRGGEWIET-RLLASGPRSNPWFQECGPRVCQRNEIISFDTDLVAYGICTDISRSWWIGD-QKPRADMIYAMQVEHIRTNMEMLKPGVMIPELS--ANTHVLDAKFQKQKYGCLMHGVGLCAYPDHAVAGAYDYPLEPGMTLCVEALISEEGGDSIKLEDQVLITEDGYENLTKYPFDPALMGV 463
15 -77.7005xev_A mol:protein length:416 Xaa-Pro dipeptidase,Peptidase-related protein  ali model follow..  21  2..STPIPAMQAALAATDLDGWLVYDFQGLRRVLGIGDDVFVWVPRAGRAVVLHNHIEGGNWNRITQ-AELRPFGSHAELDAALRGVVSGQRLAMEYSPNGAVPYERVRGAGAAEVASSADLLQAFLVWTPDDLAAHRRAAALLMRAKDDAFRLIHQSVTEWEVQQLIMDQIRAAGMQA-GHDVNVSFGVNAADSHYEPSEQRLHPGECVLIDLWAQEPGRFADVTWVGFAGE-PGTEYLDAWQAVRAAREAALELLRSRFVAEELDRAARDAMGE-RWAPHFLHRTGHDLGVQIHGAGDYETRDTRTLTPGLSVTVEPGTYPAGGFGIRSEVDVYLAPDGPEVTTDLQ--QAPFIL 400
16 -77.7004rzy_A mol:protein length:447 Peptidase M24  ali model follow..  18  55MREYRWKRLTQAIVDRGYGGLLMFDPLNIRYATDSTNMQLAVLLCADGYMVIWDYKNSPFLSKFNPLKVDVQADVFANEVRVLMQDHAPGHTRLAVDKIMLHGLRALEAQGFEIMEGEEVTEKTRAIKGPDEILAMRCASHACETAVAEMEKFARAHVGEDDIWAVLHAENIKRGGEWIET-RLLASGPRTNPWFQECGPRITQKNEIIAFDTDLISYGICVDISRTWWIGDQPRPDMVYAMQHAHEHIMTNMEMLKPGVMIPDLTANCHRLDD--KFQAQKYGCLMHGVGLCAYPDKAVPGSYDYPLEPGMVLCVEAAVEVGGDFSIKLEDQVLITEDGYENLTTYPFDAALMGL 446
17 -69.5003cb5_A mol:protein length:444 FACT complex subunit spt16  ali model follow..  20  12TFHKRLGILLTSWKNQDCDSILVTSTALHTWLLGYEFPSTLILLEKHRITILTSVNKANMLTKLAETKG-EENKKLFEKIIEYIRATNKKVGVFPKDKTEWDSIFEPVKSEFNLVDASLGLAKCLAIKDEQELANIKGASRVSVAVMSKYFVDEGKKITHSKFSDQMESLIDNEDQLEWCYTPIIQSGGSYDLKPSAITDDRNLHGDVVLCSLGFRYKSYCSNVGRTYLFD--PDSEQQKNYSFLVALQKKLFEYCRDGAVIGDIYTKILGLIRAKDLEPNFVRNLGAGIGIEFRESSLVNAKNPRVLQAGMTLNLSIGFSQSKEYALLLIDTIQITRSDPIVFTDSPKAQGDISY 439
18 -68.8005xm2_A mol:protein length:437 FACT complex subunit SPT16  ali model follow..  17  9AYYRRVKRLYSNWRKVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFEKVRHSKLAESVEKAIEEKKYLAGADEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVD--PSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKLLNKITKNLGFGMGIEFREGSLINSKNQYKLKKGMVFSINLGFSDEKTYALFIGDTVLVDEDGPATVLT-SVKKKVKNV 428
19 -68.3006a8m_A mol:protein length:461 FACT complex subunit SPT16  ali model follow..  14  11TFENRLLALRDRFPSGSPSSLVFITTILHNWLLGYEFPTTLIAVFKEGCVVITSAAKTRYLEEGVAQMNKKLENKLFEDLVERVREAGSAVGLATKDSYQGKFITEWKGHGLNGVDVSLGLSSLWAVKDEKEQAYLQVSSRGSDKFMNLLSDELVRKITDAKLSDNVENEIDKSNYLDWAYSPIIQSGPKYDLRVSRSSETQLDGNGCILASCGIRYKNYCSNISRTFLID--PSDEMTDNYDFLLLLQEEIINLLRVGATPKQIYDGAVNYINSPELSAGFTKNVGSLMGLEFRDSQFVNKNDYRKVENGDCFNISLGFNTGASYALQLADTVQLTSGGPKVLTNYTKSRSQISF 443
20 -68.0005ce6_A mol:protein length:480 FACT-Spt16  ali model follow..  17  28TFQTRLKAFYSHWDDRRTDLRYLKSTALFLWLLGFEFPETIMVFTKKQIHVLCSQKKASILESVKKLHVKPKNDDGASSMDAIIRAIRVGHIAREEPEGRLLDLEKLKNSKFRLSDVANGFSALFAAKSNEEITYIKRAAYLTGSVMKNFVVTKLENVIDEEKKILHSTLMEKADNVDICYPPIFQSGGKFDLRPSAVSNDEYDSASVIICAVGARYKSYCSNIARTFLID--ADPIQSKAYEVLLKAQEAVIGSLKPGNKLSAAYLAAVSVVEKDDMVSCLTKSAGTGIGIEFRESGNINAKNDQIVKEGMVFNVSLGFQNLKVFSLLLADTIIINKDKTDVVTSIGSKA..... 450
21 -64.7003bip_A mol:protein length:467 FACT complex subunit SPT16  ali model follow..  15  12VFKKRIELLYSKYNEFSPNSLLFKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLID--PSEEMANNYDFLLTLQKEIVNILKPGRTPKEVYESVIEYIEKTKPEPNFTKNIGSLIGLEFRDSNFIVKNDYRKIQRGDCFNISFGFNNLKDSALQLADTVQIPLDETEFLTNYTKAKSQISF 447
22 -63.8003ig4_A mol:protein length:427 Xaa-pro aminopeptidase  ali model follow..  21  5FFAQNRERLVNTLPDESITILFFVPNRNFYYVTGIDEPNVIFMLKKFEETLFIEKS-NEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGELSKYYYHGVSHFLGLDTHD---VGTYKDRVLEEGMVITIEPGLYIEEESGIRIEDDILVTKDGHENLSK.......... 399
23 -63.0001a16_A mol:protein length:440 AMINOPEPTIDASE P  ali model follow..  26  7EFQRRRQALVEQMQPGSAALIFYRQNSDFWYFTGFNEPEAVLVLIKSHSVLFNRVR-QDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYARKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSG-HRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAP--GIRIEDDIVITETGNENLTA.......... 421
24 -62.2005wze_A mol:protein length:452 Aminopeptidase P  ali model follow..  24  8EYARRRKALMAQMEPNSIAIL-YRQDSDFQYLTGFPEPEAVMALIPGEYVLFCRER-QDGAIGQYGADDAFPIGDIDDILPGLIEGRDRVYYALGANNVIRSKARQGAQPPNEFVALDHLLHDQRLYKSANEVKVMRYAAEVSARAHIRAMEVCRPGLFEYHLEAELEYEFRKGGAKMPAYGSIVAAGRNACILHYRENDAAIKDGDLILIDAGCEIDCYASDITRTFPANGRFSPEQKAIYELVLEANMAAFDYIAPGRHWNEAHEATVRVITAG-YKAFYMHRAGHWLGMDVHDVGEYRVGGEWVLEPGMAMTVEPGIYIAP-IGVRIEDDVVVTRNGCEVLTN.......... 423
25 -62.0004pv4_A mol:protein length:445 Proline aminopeptidase P II  ali model follow..  25  5EYQNRRQALLAKMAPGSAAIIFYRQNSDFSYLTGFNEPEAVLILVKSHSVLFNRIR-QEAAPTKLAVDRALPFDEINEQLYLLLNRLDVIYHAQGQYEKLRHGFRKNLRAPATLTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVG-HRPFFMHGLSHWLGMDVHDVGDYGSSDRGILEPGMVLTVEPGLYIAP--GIRIEDDIVITATGNENLTA.......... 420
26 -61.5005x49_A mol:protein length:456 Probable Xaa-Pro aminopeptidase 3  ali model follow..  22  20EYALRRHKLMSLIQKEAQDQTVVVQDNNFLYLCGFQEPDSILVLQSLKAILFVPRR-TDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQK-ARKYCPHHVGHYLGMDVHDTPDMP--RSLPLQPGMVITIEPGIYIPE--GVRIEDDVVVTQDSPLILSA.......... 439
27 -61.0002iw2_A mol:protein length:494 XAA-PRO DIPEPTIDASE  ali model follow..  24  23LFALNRQRLCERLRKNP-GSIVVRQESFFHWAFGVTEPGCYGVIDTGKSTLFVPRL-KEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCSRGGMRHSSYTCICGSGENSAVLHGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEE-GAVFMPHGLGHFLGIDVHDVGGYPEGVERHLQPGMVLTVEPGIYFIGFGGVRIEEDVVVTDSGIELLTCVPRTVEEI.. 476
28 -55.5004qr8_A mol:protein length:443 Xaa-Pro dipeptidase  ali model follow..  23  13..ATLQERTRDALARFKLDALLIHVNPQFKAWVPVTQVPNCWLLVNKPKLWFYLPVDYWHNTEDVEVIALPKADGIGSLLPAARGNIGYIGPVPER-----ALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTD-VPYSNIVALNEHAAVLHYTKLDHQPEEMRSFLLDAGAEYNGYAADLTRTW------DNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQFHQRIENDLTGPFMPHGIGHPLGLQVHDVAGFMQDDSRILQPGMVLTIEPGIYFIPFGGIRIEDNVVIHENNVENMTR.......... 438
29 -54.5004zwo_A mol:protein length:440 organophosphate anhydrolase/prolidase  ali model follow..  21  13..ATLQKRTREIIERENLDGVVFHSGQAKAWLPVIDNPHCWIVANDKPKLIFYRPV-NEYWADYFDIELLVKPDQVEKLLPYDKARFAYIGEYLEVA-------QALGFELMNPEPVMNFYHYHRAYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQH-SENDTPFGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFTG--EGEFAELVATMKQHQIALCNQLAPGKLYGELHLDCHQRVAQT-TSTFFPHGLGHHIGLQVHDVGGFMADEQRKIEANQVFTIEPGLYFIPFGGIRIEDNIIVHEDSLENMTR-ELELD.... 440
30 -53.6003rva_A mol:protein length:451 Organophosphorus acid anhydrolase  ali model follow..  23  13..EELQARTREALQREGLDGLVIHSGQGKAWVPVIDNPNCWLVVNDKPTLIFYRPE-NDFWTDSFDIKLLQQADAVEKFLPYDKSRFAY--------GEYIEVAKALGFDNVNPDRVLHYLHYQRAYKTDYELDCMREANKLAVAGHKAAEQAFREGKSEFDINLAYAAASRQ-GDNDVPYTSIVALNEHASILHYMQCDTVAKESRSFLIDAGANYHGYAADITRTYAQGVHNSAMFRDLIQAVDKVTLTLVDSLKPGVAYTDIHLLAHDGIAQI-TRTFFPHGIGHFLGLQVHDVGGLVNDDRGMVEARQVFTIEPGLYFIPFGGIRIEDNIIVHRDKNENMTRLDLNLE.... 445
31 -53.3003l24_A mol:protein length:517 Xaa-Pro dipeptidase  ali model follow..  21  13..ATLQKRTREIIERENLDGVVFHSGQAKAWLPVIDNPHCWIVANDKPKLIFYRPV-NEYWADYFDIELLVKPDQVEKLLPYDKARFAY--------GEYLEVAQALGFELMNPEPVMNFYHYHRAYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQH-SENDNPYGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFTG--EGEFAELVATMKQHQIALMNQLAPGKLYGELHLDCDEIVAKGITSTFFPHGLGHHIGLQVHDVGGFMADEQRKIEANQVFTIEPGLYFIPFGGIRIEDNIIVHEDSLENMTRELRLRLTT.. 443
32 -46.1005jqk_A mol:protein length:664 Peptidase, putative  ali model follow..  24  14..AARLEELRTIMKKNKIDVYILINSKKIVKITNYSGADGILIVTKDKPILYVNALYELQAMNELDFTLRISRIDNRDEIFETISSLEFNTIAFDGKNTSVVFYEKLRKDRKNVLLQNSPVVKMKAVKNDVEIDNMKQAHILDGLALLQFFHWCEQNETEMSLRHKVDYFRSTKNFIFPSFSTISASGPNAAVIHYECTDKATIKPAIYLLDSGGQYLHGTTDVTRTTHFGE-PTAEEKRIYTLVLKGHLRLRKVIFAYTNSSALDFIARENLFNNFMD--YNHGTGHGVGLNVHEGGSIGPVGGAPLKKNMVLSNEPGYYMKDKFGVRIENMQYVISKSFDDLTMYPYEKKLL.. 603
33 -46.1001qxw_A mol:protein length:252 methionyl aminopeptidase  ali model follow..  24  2.............................................................................................................................IVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISANFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLK-VIKNLTGHGVGLSLHEAPAHDPKDKTLLTEGMVLAIEPFISSDKSFVAQIEHTVIVTKDGPILTTKIEEE...... 252
34 -45.8004s2r_P mol:protein length:639 Protein APP-1  ali model follow..  22  194..SKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKEYTEIELADKIDHLRSLQKYVTLSFDTISAVGDHAALPHYKPLNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTN-PPKEFILHNTLVLKGHINLARAKFPGIYGSRLDTLTRDALWKLGLD--FEHGTGHGVGLNVHEGPI-SVPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEATFKSLTLVPIQTSIV.. 582
35 -45.7003mx6_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  23  2........................................................................................................................PGSMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDV-AIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYS-VVRDYTGHGIGRVFHDKPSIRNGTGLTLKEGMFFTVEPMINADKSLSAQFEHTIGVTKDGFEIFTLSPKKLD.... 258
36 -45.4003ctz_A mol:protein length:623 Xaa-Pro aminopeptidase 1  ali model follow..  24  179..KDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDSYAIIGLETIMLFIDGDRIDAPSVKEHLLQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIP-KDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVTEISAADKAEEFRRQQDFVDLSFPTISSTGPTGAIIHYAPTNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFET-PTAYEKECFTYVLKGHIAVSAAVFPGTKGHLLDSFARSALWDSGLD--YLHGTGHGVGLNVHEGPSYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVTLEPLTLVPIQTKMI.. 572
37 -44.1003tb5_A mol:protein length:264 Methionine aminopeptidase  ali model follow..  21  1...........................................................................................................................MITLKSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFIESHGGVAAGYKYATCCSINDEICHGFPRKKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGES-TPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGEGYG-VVRDFVGHGIGPTIHESPMIEAGKGLRLKEGMVITIEPMVNTDGGLSCQYEHSLAITKEGPRILTSQGEELTYL.. 255
38 -43.6001o0x_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  25  2......................................................................................................................GSDKIMIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAGYKYATCVSVNEEVVHGLPLKKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGET-DERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFN-VIRDYVGHGVGRELHEDPQITPGTGVVLRKGMTLAIEPMVSEDGSRCAHFEHTILITENGAEILTK.......... 254
39 -43.3004fli_A mol:protein length:326 Methionine aminopeptidase 1  ali model follow..  22  46.........................................................................................................................TSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFS-VVRSYCGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDSAR.... 300
40 -43.3002b3h_A mol:protein length:329 Methionine aminopeptidase 1  ali model follow..  22  68.............................................................................................................................KLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFS-VVRSYCGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFM 322
41 -43.2004fo7_A mol:protein length:280 Methionine aminopeptidase  ali model follow..  24  4.............................................................................................................................TIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKT-PEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFS-VVREYCGHGIGKVFHEEPQVRAGTGIELKEGMIFTIEPMINQDRKLSAQWEHTVLVTADGYEILTLRNDET..... 254
42 -43.2004km3_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  21  1...........................................................................................................................MITLKSAREIEAMDKAGDFLASIHIGLRDLIKPGVDMWEVEEYVRRRCKEENFAMMDYPYATCCSLNDEVAHAFPRHYILKDGDLLKVDMVLGGPGGLADSCWAYAVGTP-SEEVKNLMDITKEAMYKGIEQAVVGNRIGDIGAAIQEYAESRGYG-VVRDLVGHGVGPTMHEEPMVIAGRGLRLREGMVLTIEPMINTDGGLSCQYEHQFVITKDGPVILTSQGEE...... 283
43 -43.2001y1n_A mol:protein length:291 Methionine aminopeptidase 1B  ali model follow..  23  36.........................................................................................................................GSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDV-ADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYN-VVRDFTGHGIGTTFHNGLVVQPAVETIMQPGMTFTIEPMINLDRKWTAQFEHTLLVTDTGVEILTCL......... 285
44 -43.0003iu7_A mol:protein length:288 Methionine aminopeptidase  ali model follow..  23  39.........................................................................................................................GSEPWVQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDV-ADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYN-VVRDFTGHGIGTTFHNGLVVQPAVETIMQPGMTFTIEPMINLDRKWTAQFEHTLLVTDTGVEILTCL......... 288
45 -42.2004fuk_A mol:protein length:337 Methionine aminopeptidase  ali model follow..  22  49................................................................................................................SKVKVYNIQFLHDDSKKTAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRP-DDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCS-VVRTYTGHGVGHLFHTSPTVNNKSLGMMRPGHVFTIEPMINLDGRRSAQFEHTMVVTNGGVEIFTDWVDGV..... 311
46 -41.5004mat_A mol:protein length:278 PROTEIN (METHIONINE AMINOPEPTIDASE)  ali model follow..  24  4.............................................................................................................................SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSAYPKSVCISINEVVCHGIPDDKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKP-TIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFS-VVREYCGHGIGQGFHEEPQVSRETNVVLKPGMTFTIEPMVNADRSLSAQYEHTIVVTDNGCEILTLRKDDT..... 255
47 -41.4003tav_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  25  23.........................................................................................................................KKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSGFPASICSSVNDQVVHGIPSAAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTV-IPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIGHGIGRSMHLDPFLAPGKGPLLAVGSVLAIEPMLTLDGSRAAHWEHTVAVTEAGPRILTMRP........ 280
48 -41.0004iu6_A mol:protein length:384 Methionine aminopeptidase 1  ali model follow..  22  129.............................................................................................................................KLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFS-VVRSYCGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFM 383
49 -38.0003s6b_A mol:protein length:368 Methionine aminopeptidase  ali model follow..  25  96.............................................................................................................................YVNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINDKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFS-VVRSYSGHGVGKLFHSNPTVKNKAVGIMKPGHVFTIEPMINQDGKLSAQFEHTLLITNNGVEILTKRTQDSPPLGF 353
50 -34.2003il0_A mol:protein length:131 Aminopeptidase P; XAA-pro aminopeptidase  ali model follow..  24  4.MQRRLERFDAKLVQSGLDALLVTGQNNIYYLTDFWGTNATVFITKNRRLFLTDSRYTLIAKQSVHGFDIIESKDPLKDIVKFVEVDKLETIGFDNQ-VSFAYYQALQAEGYTLSPQTNFMEELRMIK.................................................................................................................................................................................................................................... 131
51 -32.6003ovk_A mol:protein length:132 AMINOPEPTIDASE P, Xaa-Pro dipeptidase  ali model follow..  18  7FLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAATVLITAKRRVLITDSRYTLLAKASVEGFDIIESRTPLKVVAELLEADQIDCLGFE-DQVSFSFYQAMQASGITLLAQSGFVEHLR....................................................................................................................................................................................................................................... 132
52 -32.4005e2c_A mol:protein length:132 Xaa-Pro dipeptidase  ali model follow..  20  1.SNARRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNGALLVFERDAVLATDGRYRTQAASQAPDLEVAIERAVGRYLAGRAGEAGVGKLGFESHVVTVDGLDALAGKNTELVRASGTVESLREV..................................................................................................................................................................................................................................... 132
53 -32.1002dfi_A mol:protein length:301 Methionine aminopeptidase  ali model follow..  24  2...................................................................................................................................DTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGG-KPAFPVNLSI--NEIAAHYTPDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVG----MEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGF-KPIVNLSGHKIE-KLHAGISIRPHDNYVLKEGDVFAIEP-FATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAK 225
54 -29.3003qoc_A mol:protein length:135 Putative metallopeptidase  ali model follow..  20  10.FLQRRRALSAQLAAKRIDAMLVTHLTHIRYLSGFTGSNAALIINKDSARISTDGRYITQIAEQVPDIESLMARNCAPALLSDIN--GPKRVGFEADYLSVSQCEELRKSDVELIPVTGAIEKLR....................................................................................................................................................................................................................................... 135
55 -28.3003fm3_A mol:protein length:358 Methionine aminopeptidase 2  ali model follow..  20  34.........................................................................................................................MEIENFTESDILQDARRAAEAHRRARYRVQSIVRPGITLLEIVRSIEDSTRTLLKGGIGFPAGMSM--NSCAAHYTVNDIVLKEDDVLKIDFGTHSDGRIMDSAFTVAFK----ENLEPLLVAAREGTETGIKSLGVDVRVCDIGRDINEVISSYEVERPISDLHGHSISQFRIHGGISNNRDTTRIKGDSFYAVET-FATTGKGSID-PCSHFVLNTYKSRKLFNKDLIKVY.. 281
56 -27.8001b6a_A mol:protein length:478 METHIONINE AMINOPEPTIDASE  ali model follow..  19  160..............................................................................................................................QASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKEGLAFPTGCSL--NNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN----PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDIRNLNGHSIGQYRIHAGKTKGGEATRMEEGEVYAIETGHYMKNFDVGHVPIRLPRTKHLLNVINE.......... 408
57 -27.3003peb_A mol:protein length:137 Dipeptidase  ali model follow..  14  3.AMSKLDRIRHFLNENKSGLAIVSDPVTVNYLTGFDCDPFLFVYENREPALFVPALEVARASSVLPVFGYVDSENPWQKIKAGLASTDIPIIYAEFDNLNVTKFQGLQTVEGRFENLTPFIHKMRVIK.................................................................................................................................................................................................................................... 137
58 -27.1003pn9_A mol:protein length:138 Proline dipeptidase  ali model follow..  14  3.AMSKLQQILTYLESEKLDVAVVSDPVTINYLTGFYSDPHFLFVLADQEPLLFVPALEVERASSTPVVGYVDSENPWQKIKHALPQLDFKRVAVEFDNLILTKYHGLKTETAEFDNLTPRIQRMRLIK.................................................................................................................................................................................................................................... 138
59 -26.8005lyw_A mol:protein length:378 Methionine aminopeptidase 2  ali model follow..  19  54..............................................................................................................................QASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKEGLAFPTGCSL--NNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN----PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEKPIRNLNGHSIGQYRIHAGKTKGGEATRMEEGEVYAIET-HYMKNFDVGHVPIRLPRTKHLLNVINE.......... 302
60 -26.3002v6c_A mol:protein length:353 PROLIFERATION-ASSOCIATED PROTEIN 2G4  ali model follow..  17  5..............................................................................................................................IAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKGIAFPTSISV--NNCVCHFSPQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC-TPIEGMLSHQLK-VIDGEKTIKDHEKAEFEVHEVYAVDV-LVSSGEGKAKDAGTIYKRDPSKQYGLKMKTSRAFF.. 259
61 -25.5003o5v_A mol:protein length:132 X-PRO dipeptidase  ali model follow..  13  1.SNAKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPFLFVYHDLAPVLFVPALEVARASQAIPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHLNVNKFHGLQTISGQFNNLTPYVQGMR....................................................................................................................................................................................................................................... 132
62 -25.4003ooo_A mol:protein length:132 Proline dipeptidase  ali model follow..  11  3...SKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPFLFVYEDRDPILFVPALEVSRAKQSVPVFGYIDSENPWQKIASNLPSFSVSKVLAEFDNLNVTKFQGLQTVDGHFENLTPYIQNMR....................................................................................................................................................................................................................................... 132
63 -24.8002q8k_A mol:protein length:401 Proliferation-associated protein 2G4  ali model follow..  16  13..............................................................................................................................IAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKGIAFPTSISV--NNCVCHFSPLDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC-TPIEGMLSHQLK-VIDGEKTIKDHEKAEFEVHEVYAVDVLV--EGEFVAQFKFTVLLMPNGPMRITSGPFEPDLY.. 344
64 -23.9005fl8_u mol:protein length:380 ARX1  ali model follow..  15  5..............................................................................................................................ILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKELCLLTDSFILTRLEQGIAIPTTIDIDQISGCPEIDDVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETGKADAVAAAHIAMETVVALLSSGITGQLIRTIVDTIARSYNC-GVVPGSRVRRIRRFLAGQNEGIPSDDFVVQSGEVYLIDL-KMASLEHKAGELIGAYVRDFAQTHILKLKTSRQLL.. 275
65 -23.6004ipa_A mol:protein length:423 Putative curved DNA-binding protein  ali model follow..  13  1.................................................................................................................MGMATEKKEADNVAISVDVLTKYKTAAQISEKVLAEVSKLCVPGAKIIDICEQGDKLMEEELSKGFSHPTTVS---AAFITPYTPAATEIQPGEPIKIQLGAQIDGYGTIVCDTIVAKNANDPRQADLFLATYYANEVLLRLMVPPPSQAKISSLLEKVAKAYDC-NIIESTTSWLFD-EIEGKKKINIKGEGVPEVGDVWGVEV-GCSLGSGKVK-QRATLHRRTNNTYALKRPTSRKIY.. 286
66 -21.4005apn_x mol:protein length:616 Probable metalloprotease ARX1  ali model follow..  15  27.....................................................................................................................TQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLINDQLTVPELCLLTDSFILTRLEQGIAIPTTID---DQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETGKADAVAAAHIAMETVVALLASGITGQLIRTIVDTIARSYNC-GVVPGSRVRRIRRFLAGQVAEREYKGVVWTESHQEADLL...................................... 296
67 -21.4003i7m_A mol:protein length:140 Xaa-Pro dipeptidase  ali model follow..  2.HMTKLEQIQQWTAQHHASMTYLSNPKTIEYLTGFGSDPALVVFPDQDPFIFAPALEVEVIKETGPVIGYLDHENPWAMIADQVKQRHVEHVAIEKGQLQVARMEALAAQFSADLDITSFIEHMRG...................................................................................................................................................................................................................................... 139
68 -20.8004v8t_t mol:protein length:614 PROBABLE METALLOPROTEASE ARX1  ali model follow..  15  25.....................................................................................................................TQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLIQRQLTVPELCLLTDSFILTRLEQGIAIPTTIDI--DQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETGKADAVAAAHIAMEASLGGTSSGITGQLIRTIVDTIARSYNC-GVVPGSRVRRIRRFLAGQVAEREYKGVVWTESHQEADLL...................................... 294

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 2 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25.