current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0006 Xaa-Pro aminopeptidase, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst MNQNPIKRLQDSLVERALDAFLIEKDEDISYFLQDQARSGVLLITRDEAVLFVSPLDKDLYARIQDVVLVSYSKSVDQELGSYIENTGLKTIGFDSEYTPYGIAQKRMNSGYAFSPQSLVAEKLRCVKSTEEIQKMTRAAEIGSAGYDFVLAALRPGITEKELVRMLHVFWANLGIEKVSFPPIIAFGENAAFPHAIPTNRSLKKGDVVLIDIGVCYEGYCSDMTRTVAFGATPEQQLLDGYVAVAEAQRAAIEFCRAGVPCRDVHKEAVRILRAHGMEKAFIHGLGHGVGREVHEYPRLSPFSDATLQLNMAVTVEPGVYFPGVGGIRIEDTIMIGVNENLNLTNRKVSSEIIIILast
1 -117.0003q6d_A mol:protein length:356 Proline dipeptidase  ali model follow..  31  2NAMEKIERLRSAFDEAGIDGILLTNEHSRRYMANFTGTAGVVLISKKRAQFITDFRYVEQAKQAVGYEIVQHAGLIIDEVAKQVKELGIQKLGFEQDTLTYSSYSAHKEADAEFIPTSGLVEKLRLIKTDSEIKILKEAAQIADAAFEHILSFIRPGVSEIEVSNELEFFMRKQGATSSSFDIIVASGLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAVGE-PSDKLKEIYNIVLEAQLRGVNGIKAGLTGREADALTRDYITEKGYGEYFGHSTGHGIGLEIHEAPGLAFRSDTVLEPGMAVTVEPGIYIPGIGGVRIEDDIIVTSEGNEVITKS--PKELIIL 356
2 -113.0002zsg_A mol:protein length:359 Aminopeptidase P, putative  ali model follow..  29  1..MDRSERLIQLISEEGIDAFLIMNIENSAYFSGFTGSFSIILISENTRLLITDSRYTVQAKETDFEVREVKGGDFIDVLKKTVNDLKIKTIALEEERVSLSLFRRISSADRKFIGIDDEVKQMRMVKDEGEIEKIKQAIEISERAFLETVQQIRAGMTEKEIAALLEYTMRKEGAEGVAFDTIVASGCRSALPHGKASDKVVERGDVIVIDFGATYENYCADITRVVSIGE-PSDEVKEVHSIVLEAQERALKIAKAGVTGKLLDSVAREFIREKGYGEFFGHSLGHGIGLEVHEGPAISFRNDSPLPENVVFTVEPGIYLEGKFGIRIEEDVVLKEQGCEILTTL--PRSIFVV 359
3 -105.0001pv9_A mol:protein length:348 Xaa-Pro dipeptidase  ali model follow..  30  2..KERLEKLVKFMDENSIDRVFIAKPVNVYYFSGTSPLGGYIIVDGDEATLYVPELEYEMAKEESKLPVVKFKK--FDEIYEILK--NTETLGIEGT-LSYSMVENFKENVKEFKKIDDVIKDLRIIKTKEEIEIIEKACEIADKAVMAAIEEITEGKREREVAAKVEYLMKMNGAEKPAFDTIIASGHRSALPHGVASDKRIERGDLVVIDLGALYNHYNSDITRTIVVGS-PNEKQREIYEIVLEAQKRAVEAAKPGMTAKELDSIAREIIKEYGYGDYFIHSLGHGVGLEIHEWPRISQYDETVLKEGMVITIEPGIYIPKLGGVRIEDTVLITENGAKRLTKT--ERELL.. 348
4 -103.0001wy2_A mol:protein length:351 Xaa-Pro dipeptidase  ali model follow..  32  3IMNEKVKKIIEFMDKNSIDAVLIAKNPNVYYISGASPLAGYILITGESATLYVPELEYEMAKEESNIPVEKFKK--MDEFYKALE--GIKSLGIESS-LPYGFIEELKKNIKEFKKVDDVIRDMRIIKSEKEIKIIEKACEIADKAVMAAIEEITEGKKEREVAAKVEYLMKMNGAEKPAFDTIIASGYRSALPHGVASDKRIERGDLVVIDLGALYQHYNSDITRTIVVGS-PNEKQKEIYEIVLEAQKKAVESAKPGITAKELDSIARNIIAEYGYGEYFNHSLGHGVGLEVHEWPRVSQYDETVLREGMVITIEPGIYIPKIGGVRIEDTILITKNGSKRLTKT--ERELI.. 351
5 -98.3001wn1_A mol:protein length:356 dipeptidase  ali model follow..  29  1...MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRE-LSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGE-LDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKA--ERELIIL 356
6 -90.0004fkc_A mol:protein length:377 Xaa-Pro aminopeptidase  ali model follow..  30  10..KRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSENPYKIFATKIKETFKEEKLLIDDTMPVGVFLKAKDIKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGP-PSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNA--DRELITL 371
7 -89.4001kp0_A mol:protein length:402 CREATINE AMIDINOHYDROLASE  ali model follow..  23  25..TRRXXRLRAWMAKSXIDAVLFTSYHNINYYSGWLGRKYAXVIXXVKAVTISKGIDGGMPWRRSFGXNIVYTDWKRDNFYSAVKKLGAKXIGIEHDHVTLXHRRXLXKAGTEFVDVGXPVMWXRVIKSSEEXXLIRXGARISDIGGAATAAAISAGVPEYEVAIATTXAMVRXIARXFPYWIWFQSGINTDGAHNPVTXRVVXRGDILSLNCFPMIFGYYTALERTLFLXX-VXDASLXIWXKNTAVHRRGLXLIKPGARCKDIASELNXMYRXWDLLRYRTFGYGHSFGVLXHYYGRLREDIXTVLEPGMVVSMEPMVMXPGAGGYREHDILVIKENXTENITGFPFGPEHNII 400
8 -85.2001chm_A mol:protein length:401 CREATINE AMIDINOHYDROLASE  ali model follow..  22  24..ANRQARLRAHLAAENIDAAIFTSYHNINYYSDFLGRPYALVVTEDDVISISANIDGGQPRRTVGTDNIVYTDWQRDNYFAAIQQAKARRIGIEHDHLNLQNRDKLAARDAELVDVAAACMRMRMIKSAEEHVMIRHGARIADIGGAAVVEALGDQVPEYEVALHATQAMVRAIADTMDTWTWFQSGINTDGAHNPVTTRKVNKGDILSLNCFPMIAGYYTALERTLFLDH-CSDDHLRLWQVNVEVHEAGLKLIKPGARCSDIARELNEIFLKHDVLQYRTFGYGHSFGTLSHYYGRLREDIDTVLEPGMVVSMEPMIMLPGAGGYREHDILIVNENGAENITKFPYGPEKNII 400
9 -80.5004r60_A mol:protein length:400 Proline dipeptidase  ali model follow..  26  34..QQRIERARVLMRAQGVDALLIGAGTSLRYFSGVPWGAALLLTTEGDPVLICPAFEEGSLDAVLQLPV-EEHEDPYALVVQAMDEQHAHALALDPGIAFAVHTGLRAHLGTAIRDAGAIIDGCRMCKSPAELALMQQACDMTLLVQRLAAGIAHEGIGTDQLVRFIDEAHRALGADNGSTFCIVQFGHATAFPHGIPGVQHLRAGELVLIDTGCTVQGYHSDITRTWIYGT-PSDAQQRIWELELAAQAAAFAAVRPGVACEAVDQAARAVLQAAGLGPDYRHRTGHGCGLAIHEAPYLVRGNRQPLQPGMCASNEPMIVVPGAFGVRLEDHFYVTDTGAQWFT--PPSVAI... 395
10 -77.8004ege_A mol:protein length:378 Dipeptidase PepE  ali model follow..  26  14VYARRLAAAAAATEQAGLAGLVITPGYDLRYLIGSRADTALVLPASGVPTIVLPRLELASLKESAASDL-VDGDDPYQLVAVALGGAP-AATAVTDSMPALHLLPLADALGVLPVLATDVLRQLRMVKEAAEVDALAKAGAAIDRVHARVPAFLVPGRTEAQVAADIAEAIVAEGHSAVAF-VIVGSGPHGADPHHGYSDRKLQVGDIVVVDIGGTYEGYYSDSTRTYSIGD-PSPDVAQQYSALQRAQRAAVDAVRPGVTAAQVDAAARDVLADAGLAEYFVHRTGHGIGLCVHEEPYIVAGNELPLVAGMAFSIEPGIYFPGRWGARIEDIVVVTENGALSVN--NRPHELMVV 376
11 -73.6004rzy_A mol:protein length:447 Peptidase M24  ali model follow..  18  55MREYRWKRLTQAIVDRGYGGLLMFDPLNIRYATDSTNMQLAVLLCADGYMVIWDYKNSPFLSKFNPLKVDVQADVFANEVRVLMQDHAPGHTRLAVDKIMLHGLRALEAQGFEIMEGEEVTEKTRAIKGPDEILAMRCASHACETAVAEMEKFARAHVSEDDIWAVLHAENIKRGGEW-IETRLLASGPRTNPWFQECGPRITQKNEIIAFDTDLISYGICVDISRTWWIGDQPRPDMVYAMQHAHEHIMTNMEMLKPGVMIPDLTANCHRLDD--KFQAQKYGCLMHGVGL-CDEWPLVAYPDDYPLEPGMVLCVEAAVEVGGDFSIKLEDQVLITEDGYENLT--TYPFDAALM 444
12 -71.9004b28_A mol:protein length:470 METALLOPEPTIDASE, FAMILY M24, PUTATIVE  ali model follow..  18  72MRRFRHRRLTDHVVARGYAGLLMFDPLNIRYATDSTNMQLATLLCADGYMVMWDYKNSPFLSEFRGDKVDVAADVFANEVRILLRDHAPGLRRLAVDKVMLHGLRALQAQGFEIMDGEEVTEKARSVKGPDEIRAMRCASHACEVAVRKMEDFARSKVCENDIWAILHSENVRRGGEW-IETRLLASGPRSNPWFQECGPRVCQRNEIISFDTDLVAYGICTDISRSWWIGD-QKPRADMIYAMQVEHIRTNMEMLKPGVMIPELS--ANTHVLDAKFQKQKYGCLMHGVGL-CDEWPLVAYPDDYPLEPGMTLCVEALISEEGGDSIKLEDQVLITEDGYENLTKYPFDPALM.. 461
13 -63.6005e5b_A mol:protein length:431 FACT complex subunit SPT16  ali model follow..  17  8AYYRRVKRLYSNWRKVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENKSSFDKMIEAIKESKNGKKIGFSKDKFPGEFMKSLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFEKVRHSKLAESVEKAIEEKKYLAGADEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVD--PSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKLLNKITKNLGFGMGIEFREGSLINSKNQYKLKKGMVFSINLGFSEEKTYALFIGDTVLVDEDGPATVL-TSVKKKVKNV 427
14 -63.0003cb5_A mol:protein length:444 FACT complex subunit spt16  ali model follow..  20  12TFHKRLGILLTSWKNQDCDSILVTSTALHTWLLGYEFPSTLILLEKHRITILTSVNKANMLTKLAETK-AEENKKLFEKIIEYIRATNKKVGVFPKDKTQGKFINEWDSSEFNLVDASLGLAKCLAIKDEQELANIKGASRVSVAVMSKLSTYIDQGITHSKFSDQMESLIDNEDQLEWCYTPIIQSGGSYDLKPSAITDDRNLHGDVVLCSLGFRYKSYCSNVGRTYLFD--PDSEQQKNYSFLVALQKKLFEYCRDGAVIGDIYTKILGLIRAKDLEPNFVRNLGAGIGIEFRESSLVNAKNPRVLQAGMTLNLSIGFSQSKEYALLLIDTIQITRSDPIVFT--DSPKAQGDI 437
15 -60.9003bip_A mol:protein length:467 FACT complex subunit SPT16  ali model follow..  14  12VFKKRIELLYSKYNEGSPNSLLFVTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKDPESKITLELWQRNNKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPNEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAITNAKLSDKIENKIDNFDLLDWTYSPIIQSGKKFDLVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLID--PSEEMANNYDFLLTLQKEIVNILKPGRTPKEVYESVIEYIEKTELVPNFTKNIGSLIGLEFRDSNFIVKNDYRKIQRGDCFNISFGFNSANNYALQLADTVQIPLDETEPPR-TNYTKAKSQI 445
16 -60.8003ig4_A mol:protein length:427 Xaa-pro aminopeptidase  ali model follow..  21  5FFAQNRERLVNTLPDESITIL-FVPNRNFYYVTGIDEPNVIFMLKKFEETLFIEKS-NEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEEELSKYYYHGVSHFLGLDTHD---VGTYKDRVLEEGMVITIEPGLYIEEESGIRIEDDILVTKDGHENLS-KDIIREVEEI 408
17 -55.1001a16_A mol:protein length:440 AMINOPEPTIDASE P  ali model follow..  25  9..QRRRQALVEQMQPGSA-ALIFAAPEVTRYFTGFNEPEAVLVLIKSHSVLFNRVR-QDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAP--GIRIEDDIVITETGNENLT-ASVVKKPEEI 430
18 -54.6004pv4_A mol:protein length:445 Proline aminopeptidase P II  ali model follow..  24  7..QNRRQALLAKMAPGSA-AIIFAAPEATRYLTGFNEPEAVLILVKSHSVLFNRIR-QEAAPTKLAVDRALPFDEINEQLYLLLNRLDVIYHAQGQYEKLRHGFRKNLRAPATLTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVEQLIAEQAHRPFFMHGLSHWLGMDVHDVGDYGSSDRRILEPGMVLTVEPGLYIAP--GIRIEDDIVITATGNENLT-ASVVKDPDDI 429
19 -53.4005ce6_A mol:protein length:480 FACT-Spt16  ali model follow..  17  30..QTRLKAFYSHWDDRSSDAIAVASTALFLWLLGFEFPETIMVFTKKQIHVLCSQKKASILESVKKDAIIRAIRAQSKSDGHDSSTVGHIAREEPEGRLLDLWAEKLKNSKFRLSDVANGFSALFAAKSNEEITYIKRAAYLTGSVMKNFVVTKLENVIDEEKKAKVNCKLKADNVDICYPPIFQSGGKFDLRPSAVSNDEALDSASVIICAVGARYKSYCSNIARTFLID--ADPIQSKAYEVLLKAQEAVIGSLKPGNKLSAAYLAAVSVVEKDDMVSCLTKSAGTGIGIEFRESGNINAKNDQIVKEGMVFNVSLGFQNNKVFSLLLADTIIINKDKTDVVT-SIGSKALKDV 454
20 -51.6002iw2_A mol:protein length:494 XAA-PRO DIPEPTIDASE  ali model follow..  24  49.....LQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDTGKSTLFVPRL-KEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYYSRGGMRHSSYTCICGSGENSAVLHGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERHLQPGMVLTVEPGIYF-GFGGVRIEEDVVVTDSGIELLTCVPRTVEEI.. 476
21 -50.0004qr8_A mol:protein length:443 Xaa-Pro dipeptidase  ali model follow..  22  17......ERTRDALARFKLDALLIHSNPQFKAWVPVTQVPNCWLLNKPKLWFYLPVDYTSFWTEDVEVIALPKADGIGSLLPAARGNIGY------GPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTD-VPYSNIVALNEHAAVLHYTKLDQAPEEMRSFLLDAGAEYNGYAADLTRTWS-----DNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQFEAMVENDLTGPFMPHGIGHPLGLQVHDVAGFMQDDSRILQPGMVLTIEPGIYF-PFGGIRIEDNVVIHENNVENMTRD......... 439
22 -49.1003rva_A mol:protein length:451 Organophosphorus acid anhydrolase  ali model follow..  22  17......ARTREALQREGLDGLVIHSGQGKAWVPVIDNPNCWLVVNGVDKPTLIFYR-NDFWTDSFDIKLLQQADAVEKFLPYDKSRFAYVGEYIEVA-------KALGFDNVNPDRVLHYLHYQRAYKTDYELDCMREANKLAVAGHKAAEQAFREGKSEFDINLAYAAASRQ-GDNDVPYTSIVALNEHASILHYMQCDTVAKESRSFLIDAGANYHGYAADITRTYAQGVHNSAMFRDLIQAVDKVTLTLVDSLKPGVAYTDIHLLAPEIVEMGITRTFFPHGIGHFLGLQVHDVGGLVNDDRRMVEARQVFTIEPGLYF-PFGGIRIEDNIIVHRDKNENMT-RDLDLNL... 444
23 -46.6004zwo_A mol:protein length:440 organophosphate anhydrolase/prolidase  ali model follow..  21  17......KRTREIIERENLDGVVFHSGQAKAWLPVIDNPHCWIVANGTDKPKLIFYR-NEYWADYFDIELLVKPDQVEKLLPYDKARFAYIGEYLEVA-------QALGFELMNPEPVMNFYHYHRAYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQH-SENDTPFGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFT--GEGEFAELVATMKQHQIALCNQLAPGKLYGELHLDCDEIVAKGITSTFFPHGLGHHIGLQVHDVGGFMADEQRKIEANQVFTIEPGLYF-PFGGIRIEDNIIVHEDSLENMT-RELELD.... 440
24 -44.0001qxw_A mol:protein length:252 methionyl aminopeptidase  ali model follow..  25  2.............................................................................................................................IVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISANFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDL-KVIKNLTGHGVGLSLHEAPA-DPKDKTLLTEGMVLAIEPFISSDKSFVAQIEHTVIVTKDGPILTTKIE........ 250
25 -43.6004s2r_P mol:protein length:639 Protein APP-1  ali model follow..  23  194..SKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDSYLFVAMREIHVFIDNEKLDEHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEE--NSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELTEIELADKIDHLRSLQKYVTLSFDTISAVGDHAALPHYKPLNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTN-PPKEFILHNTLVLKGHINLARAKFPGIYGSRLDTLTRDALWKLGLD--FEHGTGHGVGLNVHEGPI-SVPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEATFKSLTLVPIQTSIV.. 582
26 -43.5003l24_A mol:protein length:517 Xaa-Pro dipeptidase  ali model follow..  20  17......KRTREIIERENLDGVVFHSGQAKAWLPVIDNPHCWIVANGTDKPKLIFYRPVDYWADYFDIELLVKPDQVEKLLPYDKARFAYIGEYLEVA-------QALGFELMNPEPVMNFYHYHRAYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLATQH-SENDNPYGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFT--GEGEFAELVATMKQHQIALMNQLAPGKLYGELHLDCDEIVAKGITSTFFPHGLGHHIGLQVHDVGGFMADEQRKIEANQVFTIEPGLYF-PFGGIRIEDNIIVHEDSLENMTRELRLRLTT.. 443
27 -43.4003ctz_A mol:protein length:623 Xaa-Pro aminopeptidase 1  ali model follow..  25  179..KDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDSYAIIGLETIMLFIDGDRIDAPSVKEHLLLVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETI-PKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKGVTEISAADKAEEFRRQQADVDLSFPTISSTGPTGAIIHYAPTNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFET-PTAYEKECFTYVLKGHIAVSAAVFPGTKGHLLDSFARSALWDSGLD--YLHGTGHGVGLNVHEGPSYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVTLEPLTLVPIQTKMI.. 572
28 -41.7003tb5_A mol:protein length:264 Methionine aminopeptidase  ali model follow..  21  1...........................................................................................................................MITLKSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFIESHGGVAAGYKYATCCSINDEICHGFPRKKVLKDGDLIKVDMCVDLKGAISDSCWSYVVGES-TPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGEGYG-VVRDFVGHGIGPTIHESPMIEAGKGLRLKEGMVITIEPMVNTDGGLSCQYEHSLAITKEGPRILTSQGEELTYL.. 255
29 -40.1001o0x_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  25  5.........................................................................................................................KIMIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAGYKYATCVSVNEEVVHGLPLEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGET-DERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFN-VIRDYVGHGVGRELHEDPQITPGTGVVLRKGMTLAIEPMVSEDGSRCAHFEHTILITENGAEILTKE......... 255
30 -38.1003il0_A mol:protein length:131 Aminopeptidase P; XAA-pro aminopeptidase  ali model follow..  24  5..QRRLERFDAKLVQSGLDALLVTGQNNIYYLTDFWGTNATVFITKNRRLFLTDSRYTLIAKQSVHGFDIIESKDPLKDIVKFVEVDKLETIGFD-NQVSFAYYQALQAEGYTLSPQTNFMEELRMIK.................................................................................................................................................................................................................................... 131
31 -37.5001y1n_A mol:protein length:291 Methionine aminopeptidase 1B  ali model follow..  23  41..............................................................................................................................VQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDV-ADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDF-TGHGIGTTFHNGLVVQPAVETIMQPGMTFTIEPMINLDRKWTAQFEHTLLVTDTGVEILT........... 283
32 -37.4003iu7_A mol:protein length:288 Methionine aminopeptidase  ali model follow..  23  44..............................................................................................................................VQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDV-ADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDF-TGHGIGTTFHNGLVVQPAVETIMQPGMTFTIEPMINLDRKWTAQFEHTLLVTDTGVEILT........... 286
33 -36.8003tav_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  25  23.........................................................................................................................KKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSGFPASICSSVNDQVVHGIPSAAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTV-IPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIGHGIGRSMHLDPFLAPGKGPLLAVGSVLAIEPMLTLDGSRAAHWEHTVAVTEAGPRILTMRP........ 280
34 -36.7003ovk_A mol:protein length:132 AMINOPEPTIDASE P, Xaa-Pro dipeptidase  ali model follow..  17  7FLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAATVLITAKRRVLITDSRYTLLAKASVEGFDIIESRTPLKVVAELLEADQIDCLGFE-DQVSFSFYQAMQAEGITLLAQSGFVEHLR....................................................................................................................................................................................................................................... 132
35 -36.4005e2c_A mol:protein length:132 Xaa-Pro dipeptidase  ali model follow..  22  1.SNARRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNGALLVFADEAVLATDGRYRTQAASQAPDLEVAIERAVGRYLAGRAGEAGVGKLGFESHVVTVDGLDALAGANTELVRASGTVESLREV..................................................................................................................................................................................................................................... 132
36 -36.3004fuk_A mol:protein length:337 Methionine aminopeptidase  ali model follow..  23  63..............................................................................................................................SKKTAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRP-DDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCSVVRTY-TGHGVGHLFHTSPTVNNKSLGMMRPGHVFTIEPMINLDGRRSAQFEHTMVVTNGGVEIFTDWVDGV..... 311
37 -36.1002b3h_A mol:protein length:329 Methionine aminopeptidase 1  ali model follow..  22  69..............................................................................................................................LLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSY-CGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDSA..... 317
38 -36.0004fli_A mol:protein length:326 Methionine aminopeptidase 1  ali model follow..  22  51..............................................................................................................................LLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSY-CGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDSA..... 299
39 -35.9004km3_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  21  1...........................................................................................................................MITLKSAREIEAMDKAGDFLASIHIGLRDLIKPGVDMWEVEEYVRRRCKEENFLMMDYPYATCCSLNDEVAHAFPRHYILKDGDLLKVDYTQSYSGGLADSCWAYAVGTP-SEEVKNLMDITKEAMYKGIEQAVVGNRIGDIGAAIQEYAESRGYG-VVRDLVGHGVGPTMHEEPMVIAGRGLRLREGMVLTIEPMINTDGGLSCQYEHQFVITKDGPVILTSQGEEGTY... 286
40 -35.5003mx6_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  24  7.............................................................................................................................KIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGD-VAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYS-VVRDYTGHGIGRVFHDKPSIRNGTGLTLKEGMFFTVEPMINAGNYDSAQFEHTIGVTKDGFEIFTLSPK....... 255
41 -35.4003qoc_A mol:protein length:135 Putative metallopeptidase  ali model follow..  19  9RFLQRRRALSAQLAAKRIDAMLVTHLTHIRYLSGFTGSNAALIINKDSARISTDGRYITQIEQVPDIESLMARNCAPALLSDIN---GPKRVGFEADYLSVSQCEELRKSDVELIPVTGAIEKLR....................................................................................................................................................................................................................................... 135
42 -34.7004fo7_A mol:protein length:280 Methionine aminopeptidase  ali model follow..  25  4.............................................................................................................................TIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGK-TPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFS-VVREYCGHGIGKVFHEEPQVRAGTGIELKEGMIFTIEPMINQ-GRPETRLEHTVLVTADGYEILTLRN........ 251
43 -34.0003s6b_A mol:protein length:368 Methionine aminopeptidase  ali model follow..  26  97..............................................................................................................................VNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINDKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFSVVRSY-SGHGVGKLFHSNPTVKNKAVGIMKPGHVFTIEPMINQDGKLSAQFEHTLLITNNGVEILTKRTQDS..... 348
44 -33.9004mat_A mol:protein length:278 PROTEIN (METHIONINE AMINOPEPTIDASE)  ali model follow..  25  4.............................................................................................................................SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSAYPKSVCISINEVVCHGIPDDKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGK-PTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFS-VVREYCGHGIGQGFHEEPQVSRETNVVLKPGMTFTIEPMVNAGKKESAQYEHTIVVTDNGCEILTLRK........ 252
45 -33.9004iu6_A mol:protein length:384 Methionine aminopeptidase 1  ali model follow..  22  130..............................................................................................................................LLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSY-CGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDSA..... 378
46 -24.7003o5v_A mol:protein length:132 X-PRO dipeptidase  ali model follow..  13  1.SNAKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPFLFVYHDLAPVLFVPALEVARASQAISFPVFGYSENPWEKIKAVLPNTAAKTIYAEFDHLNVNKFHGLQTISGQFNNLTPYVQGMR....................................................................................................................................................................................................................................... 132
47 -24.2002dfi_A mol:protein length:301 Methionine aminopeptidase  ali model follow..  25  2...................................................................................................................................DTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGG-KPAFPVNLSINEIAA--HYTPYTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVG----MEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGF-KPIVNLSGHKIEYKLHAGISIRPHDNYVLKEGDVFAIEP-FATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLL.. 223
48 -22.9003pn9_A mol:protein length:138 Proline dipeptidase  ali model follow..  13  4..MSKLQQILTYLESEKLDVAVVSDPVTINYLTGFYSDPFLFVLADQEPLLFVPALEVERASSTVSFPVVGYVENPWQKIKHALPQLDFKRVAVEFDNLILTKYHGLKTVTAEFDNLTPRIQRMRLIK.................................................................................................................................................................................................................................... 138
49 -22.3003peb_A mol:protein length:137 Dipeptidase  ali model follow..  15  3.AMSKLDRIRHFLNENKSGLAIVSDPVTVNYLTGFDCDPFLFVYENREPALFVPALEVARASSVLDFPVFGYSENPWQKIKAGLASTDIPIIYAEFDNLNVTKFQGLQTVEGRFENLTPFIHKMRVIK.................................................................................................................................................................................................................................... 137
50 -20.6003ooo_A mol:protein length:132 Proline dipeptidase  ali model follow..  11  1.AMSKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPFLFVYEDRDPILFVPALEVSRAKQSVPFPVFGYSENPWQKIASNLPSFSVSKVLAEFDNLNVTKFQGLQTVDGHFENLTPYIQNMR....................................................................................................................................................................................................................................... 132
51 -19.6003fm3_A mol:protein length:358 Methionine aminopeptidase 2  ali model follow..  21  34.........................................................................................................................MEIENFTESDILQDARRAAEAHRRARYRVQSIVRPGITLLEIVRSIEDSTRTLLKGGIGFPAGMSMNSCAATVNPGEQDIVLKEDDVLKIDFGTHSDGRIMDSAFTVAFK----ENLEPLLVAAREGTETGIKSLGVDVRVCDIGRDINEVISSYEVERPISDLHGHSIS-RIHGGPAVNNRDTTRIKGDSFYAVET-FATTGKGSID-PCSHFVLNTYKSRKLFNKDLIKVY.. 281
52 -18.6001b6a_A mol:protein length:478 METHIONINE AMINOPEPTIDASE  ali model follow..  18  136......................................................................................................EYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKEGLAFPTGCS--LNNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYD----TLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVGKTYQNLNGHSIGYRIHAGPIVKGGEATRMEEGEVYAIET-FGSTGKGVVHDDMEYMKNFDVGHVPIRLPRTKHLL.. 403
53 -17.0002v6c_A mol:protein length:353 PROLIFERATION-ASSOCIATED PROTEIN 2G4  ali model follow..  16  3............................................................................................................................QTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKGIAFPTSISVNNCVCSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQGTQVTDVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC-TPIEGMLSHQLK-VIDGEKTIKDHEKAEFEVHEVYAVDV-LVSSGEGKAKDAGQIYKRDPSKQYGLKMKTSRAFF.. 259
54 -16.2003i7m_A mol:protein length:140 Xaa-Pro dipeptidase  ali model follow..  2.HMTKLEQIQQWTAQHHASMTYLSNPKTIEYLTGFGSDPALVVFPDQDPFIFAPALEVEVIKETGWQFPVLDHENPWAMIADQVKQRHVEHVAIEKGQLQVARMEALAAQFSAPLDITSFIEHMRG...................................................................................................................................................................................................................................... 139
55 -15.8005fl8_u mol:protein length:380 ARX1  ali model follow..  14  3............................................................................................................................KNILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKTTQRQLTYYKNKVNERGIAIPTTIDIDQISGCPEIDDVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETGKADAVAAAHIAMETVVALLSSGITGQLIRTIVDTIARSYNCPGSRVRRIRRFL-VAEFTNVSAIPSDDFVVQSGEVYLIDL-KMASLEHKAGELIGAYVRDFAQTHILKLKTSRQLL.. 275
56 -15.3002q8k_A mol:protein length:401 Proliferation-associated protein 2G4  ali model follow..  15  13..............................................................................................................................IAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKGIAFPTSISVNNCVCSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTDVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC-TPIEGMLSHQLK-VIDGEKTIKDHEKAEFEVHEVYAVDV-LVSSGEGKAKDAGQIYKRDPSKQYGLKMKTSRAFF.. 267
57 -12.9004ipa_A mol:protein length:423 Putative curved DNA-binding protein  ali model follow..  14  12............................................................................................................................NVAISVDVLTKYKTAAQISEKVLAEVSKLCVPGAKIIDICEQGDKLMEEELSKGFSHPTTVS--PAAFITPYTPAATEIQPGEPIKIQLGAQIDGYGTIVCDTIVAKNANDPRQADLFLATYYANEVLLRLMVPGLLATGTDEEKAKAAAVKPPSQAIESTTSWLFKKKIILSPGENIKGEGVPEVGDVWGVEV-GCSLGSGKVKQFEQTLHRRTNNTYALKRPTSRKIY.. 286
58 -12.2004v8t_t mol:protein length:614 PROBABLE METALLOPROTEASE ARX1  ali model follow..  14  25.....................................................................................................................TQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKTTQRQLTYYKNKVNERGIAIPTTID--IDQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPIDAVAAAHIAMETVVALLACALTPEKLPASLGGTSSGITGQLTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAERE..................................... 278
59 -12.1005apn_x mol:protein length:616 Probable metalloprotease ARX1  ali model follow..  17  27.....................................................................................................................TQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLINRQLTVPELCLLTDSFILTRLEQGIAIPTTID--IDQISGGWCPVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPIDAVAAAHIAMETVVALLACALTPEKLPASLGGT.................................................................................... 231

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.