current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [H] COG0007 Uroporphyrinogen-III methylase, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MSKADEAAACVIAKSKVALPVMEPGHVWLVGAGPGDPGLLTLHAVNALQQADVIVYDALVDDSCLSLKNATATLEYAGKRGGKPSPRQRDISLRLVELARQGKKVLRLKGGDPFVFGRGAEEALTLVEYHVPFRIVPGVTAGVGGLAYAGIAATHRDINQAVTFLTGHDATGAMPDGVDWAGIARSSPVIVMYMAMKHIGLIAGRLIEAGRSPDEPVAFVCNASLPDQTVLETTLGRAAIEVEAAGLQPPAIVVVGEVVRLRAGLDWIGAMAGKSLVSDPLGKRTQQGVQSALast
1 -104.0001s4d_A mol:protein length:280 Uroporphyrin-III C-methyltransferase  ali model follow..  71  1..........MIDDLFAGLPALEKGSVWLVGAGPGDPGLLTLHAANALRQADVIVHDALVNEDCLKLARPGAVLEFAGKRGGKPSPKQRDISLRLVELARAGNRVLRLKGGDPFVFGRGGEEALTLVEHQVPFRIVPGITAGIGGLAYAGIPVTHREVNHAVTFLTGHDSSGLVPDRINWQGIASGSPVIVMYMAMKHIGAITANLIAGGRSPDEPVAFVCNAATPQQAVLETTLARAEADVAAAGLEPPAIVVVGEVVRLRAALDWIGALDGRKLAADPFANRILRNPA.. 280
2 -99.6002ybo_A mol:protein length:294 METHYLTRANSFERASE  ali model follow..  40  3..ADIGSMNTTVIPPSLLDVDFPAGSVALVGAGPGDPGLLTLRAWALLQQAEVVVYDRLVARELIALLPESCQRIYVGKRCGHHSLPQEEINELLVRLARQQRRVVRLKGGDPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQNDG-RLDLDWAGLARGKQTLVFYMGLGNLAEIAARLVEHGLASDTPAALVSQGTQAGQQVTRGALAELPALARRYQLKPPTLIVVGQVVALFAERAMAHSYLGAGSPVSREAVACA...... 286
3 -99.4002ybq_A mol:protein length:292 METHYLTRANSFERASE  ali model follow..  40  1..GPLGSMNTTVIPPSLLDVDFPAGSVALVGAGPGDPGLLTLRAWALLQQAEVVVYDRLVARELIALLPESCQRIYVGKRCGHHSLPQEEINELLVRLARQQRRVVRLKGGDPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQNDG-RLDLDWAGLARGKQTLVFYMGLGNLAEIAARLVEHGLASDTPAALVSQGTQAGQQVTRGALAELPALARRYQLKPPTLIVVGQVVALFAERAMAHSYLGAGSPVSREAVACA...... 284
4 -89.3001ve2_A mol:protein length:235 Uroporphyrin-III C-methyltransferase  ali model follow..  40  2.......................RGKVYLVGAGFGGPEHLTLKALRVLEVAEVVLHDRLVHPGVLALAK--GELVPVGKEGYGGKTPQEAITARLIALAREGRVVARLKGGDPMVFGRGGEEALALRRAGIPFEVVPGVTSAVGALSALGLPLTHRGLARSFAVATGH----------DPALPLPRADTLVLLMPLHTLGGLKERLLE-RFPPETPLALLARVGWPGEAVRLGRVEDLPGLGE--GLPSPALLVVGKVVGLYGELLPKD....................... 232
5 -87.0001cbf_A mol:protein length:285 COBALT-PRECORRIN-4 TRANSMETHYLASE  ali model follow..  25  3............SSSSGLVPRGSHMKLYIIGAGPGDPDLITVKGLKLLQQADVVLYDSLVSQDLIAKSKPGAEVLKTAG------MHLEEMVGTMLDRMREGKMVVRVHTGDPAMYGAIMEQMVLLKREGVDIEIVPGVTSVFAAAAAAEAELTIPDLTQTVILTRAEGRTPV-PEFEKLTDLAKHKCTIALFLSSTLTKKVMKEFINAGWSEDTPVVVVYKATWPDEKIVRTTVKDLDDAMRTNGIRKQAMILAGWALDPATPLSGLGPAIRAMFVAHLHQALNMAVEEAA 279
6 -83.6004e16_A mol:protein length:253 precorrin-4 C(11)-methyltransferase  ali model follow..  24  1....................SNAMNKVHFVGAGPGDKELITLKGYKLLSNADVVIYGSLVNPELLEYCKEDCQIHNSAH------MDLQEIIDVMREGIENNKSVVRLQTGDFSIYGSIREQVEDLNKLNIDYDCTPGVSSFLGAASSLGVEYTVPEISQSVIITRMEGRTPV-PEKESIQSYAKHQTSMVIFLSVQEIEKVVSKLLEGGYPKDTPIAVIYKATWADEKIVKGTLSDIAVKVKENNINKTALIMVGRFLGEEYNNS---KLYDKDF................ 247
7 -82.6001v9a_A mol:protein length:239 Uroporphyrin-III C-methyltransferase  ali model follow..  41  1........................GRVYLVGAGPGDPELLTLKAYRLLKEAPVVLYDRLVDERVLALAP--GEKVYVGKEEG-ESEKQEEIHRLLLRHARAHPFVVRLKGGDPMVFGRGGEEVLFLLRHGVPVEVVPGVTSLL----ASGLPLTHRGLAHGFAAVSGVLEGGG---YPDLRPFAR-VPTLVVLMGVGRRVWIAKELLRLGRDPREPTLFVERASTPKERRVHARLEEVAEGKV--EVRPPALWILGEVVRVFAEEAPVDALGG................... 239
8 -82.5003nei_A mol:protein length:281 Precorrin-4 C(11)-methyltransferase  ali model follow..  22  3............SSSSGLVPRGSHMTVHFIGAGPGAADLITIRGRDLIASCPVCLYGSLVPEALLAHCPPGAKIVNTAP------MSLDAIIDTIAEAHAAGQDVARLHSGDLSIWSAMGEQLRRLRALNIPYDVTPGVPSFAAAAATLGAELTLPGVAQSVILTRTSGRASAMPAGETLENFARTGAVLAIHLSVHVLDEVVQKLVP-HYGEDCPVAIVWRASWPDQRVVRATLATLQTSL-GAELERTALILVGRSLATEDFDESRAGDYRYRPLGTHPRFPEGS..... 274
9 -80.6001pjq_A mol:protein length:457 Siroheme synthase  ali model follow..  42  192LANADEKAVNATTERLFSEPLDHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKTG---GELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVHGVLTQLGELAQ--QVESPALIIVGRVVALRDKLNWFS....................... 455
10 -63.7002zvb_A mol:protein length:295 Precorrin-3 C17-methyltransferase  ali model follow..  22  2........................GELFLVGMGPGDLPGLTQRAREALEGAEVVIGYSTYVKLLE------EMGLLAGKEVVRKGMTEEDRAEEALERALSGQRVALVSGGDPGIYGMAAPVLELMEERGVFLAVIPGVTAANAVASLLGSPLAHDTCLISLSDLLTPWPLIER----RLHAAGQGDFVVVLYNPQSKRRRKSAEILLEYRPKETPAALVKSAYRKRQEVALTTLEGL----REAEAGMLTTVVIGNRQSRFYEGTFLTPYALKYDLDTKEALPGE...... 276
11 -59.7003nut_A mol:protein length:251 Precorrin-3 methylase  ali model follow..  20  2.......................SGWVTVAGLGPGREDLVTPEVTAALAEATDIVGYIP-------YVARIAPREGLTLHPTDNRV-ELDRATHALEMAAEGRRVVVVSSGDPGVFAMASALFEALEAAGTEIRILPGITAMLAAAAAAGAPLGHDFCAINLSDNLKPFEI-----EKRLRHAARGDFAMAFYNPRSKSRTRVLEILREECEPGRLILFARAVTTPEQAISVVELRDATP----EMADMRTVVLVGNAATRRVGPWVYTP...................... 240
12 -56.3002e0k_A mol:protein length:259 Precorrin-2 C20-methyltransferase  ali model follow..  16  1....................MNNQGSIISVSLGPGDPGLITVKALSQLREADVIYYPGILKEFDLDPSKLRGMLVPMSRSRGAAEASYAANYASMAEEVQAGRRVAVVSVGDGGFYSTASAIIERARRDGLDCSMTPGIPAFIAAGSAAGMPLALQS--DSVLVLAQIDEIG------ELERALVTHSTVVVMKLSTVRDELVSFLERYA----KPFLYAEKVGMAGEFITME-----VDALRSRAIPYFSLLVCSPHCRQSTLSPFASAAALE.................. 253
13 -54.6001vce_A mol:protein length:265 diphthine synthase  ali model follow..  15  3..........................LYFIGLGLYDERDITVKGLEIAKKCDYVFAEFYTSLMAGTTLGRIQKLIGKEIRVLSREDVELNFENIVLPLAK-ENDVAFLTPGDPLVATTHAELRIRAKRAGVESYVIHAPSIYSAV-GITGLHIYKFGKSATVAYPEGNWFPTSYYDVIKLDIKAEKRMYMTANEAMELLLKVEDMKKGGVFTDDTLVVVLARAGSLNPTIRAGYVKDLIR--EDFGDPPHILIVPGKLHIVEAELVEIA....................... 254
14 -52.7002qbu_A mol:protein length:232 Precorrin-2 methyltransferase  ali model follow..  19  2.......................HGKLIGVGVGPGDSELLTLRAVNVLRSVPVICAPRSIVEDILTERRDGCRILDMTDDRDELESHWDSAARMVAAELEDGRDVAFITLGDPSIYSTFSYLQQRIEDMGFKTEMVPGVTSFTACAATAGRTLVEGD--EILLVVPRVDD--------RFERVLRDVDACVIMKTSRHGRRAMEVVESDPR--GKDVVSVANCSMDDEVVERGFASGGG-----------ATTLVRF................................... 228
15 -52.6003i4t_A mol:protein length:292 diphthine synthase  ali model follow..  1..........MAMGTLEAQTQGPGSMLYIIGLGLYDEKDITVRGLEAVKSCDLVFLEHYTA---ILQCDVAKLEEFYGKKVIIGDRDLVETEADQILEPAKTKNVALLVVGDVYGATTHSDIFVRCQKMGIEVKVIHNASIMNAIGCSGLQLYRFGQTVSTLVLLDIKVKERSEESIIKGRDIFEPPRYMTINQCIEQLLEVEKEQHLGVYDEDTMVVGMARVACADQKIVYGKMKDLLH--YDFGAPMHCLLIPAPQVDDPELLEYFK....................... 282
16 -50.4002npn_A mol:protein length:251 Putative cobalamin synthesis related protein  ali model follow..  16  2.......................MRTIYVIGIGTGSPEFLTLQAISGLRHAQAIVALDKGEQKVTDPERDRNPDNYEEEVRRWHAERAHLLASTIRERTPDDGAVAFLVWGDPSLYDSTLEHMRNLEDLHADVKVIPGITAVQVLTAEHGILINRIG--EAIHITTGRNLPE--------TSAKDRRNCVVMLDGKTAWQDVATEH--------TYMWWGAFLGTEQQVLRKGYVHEIGAQVAE--LKQQLRTEHGWIMDT............................... 244
17 -48.4001vhv_A mol:protein length:268 diphthine synthase  ali model follow..  14  2...................GGGHMSLLTFVGLGLWDVKDISVKGLEAVREADEVYVEYYTSKLLSSI--EEMEEFFGKRVVELERSDLEENSFRLIERAK-SKSVVLLVPGDPMVATTHSAIKLEAERKGVKTRIIHGASISTAVCGLTGLHNYRFGKSATVSWHRSQTPVNVIKANRS-IDAHTLLFLDLHPEPMTIGHAVENLIAEDAQMKDLYAVGIARAGSGEEVVKCDRLENLKKI--DFGKPLHVMVVLAKTLHFMEFLREFAPAELERLVAEGGS.......... 262
18 -48.4001wde_A mol:protein length:294 Probable diphthine synthase  ali model follow..  15  2..................ARGREAVTLLLVGWGYA-PGMQTLEALDAVRRADVVYVESYTMPGSSWLYKSVVEAAGEARVVEASRRDLEERSREIVSRAL-DAVVAVVTAGDPMVATTHSSLAAEALEAGVAVRYIPGVSGVQAARGATMLSFYRFGGTVTLPGPWRGVTPISVARRI-YLNLCAGLHTTALLQGVSLLLEADREYARALLARLPSVLVEAGAGGGHRVLYWSSLERLST--ADVEGGVYSIVIPARLSGVEEWLAAARPLEYDRSVYETVEENCKKGV... 289
19 -47.1003nd1_A mol:protein length:275 Precorrin-6A synthase/CobF protein  ali model follow..  15  4............SSSGLVPRGSHMIELSLIGIGTGNPRHITGQAVDAMNAADLILIPLKGADKFALPVRDASNPSYRKGVDDWHAIAETWLSEITAHVPGLEGRVALLVWGDPSLYDSTLRIAERLKSLPLTTKVIPGITAIQALCAAHAIPLNDIG--APVVITTGRQLRD--------HGWPAGTETVVAMLD-------GECSFQSLPPDGLTIFWGACVAMPEEVLIRGPVAEVTDEILQ--ARADLRARHGWVMDLRRNVPA......................... 268
20 -36.3005n0n_A mol:protein length:410 Peptide N-methyltransferase  ali model follow..  18  2.................TSTQTKAGSLTIVGTGIESIGQMTLQALSYIEAAAKVFYDPATEAFILTKNKNCVDLFQYYDNGKSRLNTYTQMSELMVREVRKGLDVVGVFYGHPGVFVNPSHRAAIAKSEGYRARMLPGVSAEDCLFADLCIDPSNPGCLEASDFLIRDRPVSIHSHLVLFQVGCVGIADFNFTGFDNNKFGVLVDRLEQEYGAEHPVVHYIAAMMPDPVTDKYTVAQLREPEIAKRVGGVSTFYIPPKARKASNLDIIRRL..................... 263
21 -33.6006mjg_A mol:protein length:420 fusion protein of dbOphMA and methylated peptide  ali model follow..  18  1............SNAMESSTQTKPGSLIVVGTGIESIGQMTLQALSYIEAASKVFYDPATEAFILTKNKNCVDLYQYYDNGKSRMDTYTQMAELMLKEVRNGLDVVGVFYGHPGVFVNPSHRAAIARSEGYQARMLPGVSAEDCLFADLCIDPSNPGCLEASDFLIRERPVNVHSHLILFQVGCVGIADFNFSGFDNSKFTILVDRLEQEYGPDHTVVHYIAAMMPDPVTDKFTIGQLREPEIAKRVGGVSTFYIPPKARKDINTDIIRLL..................... 267
22 -22.7005hw4_A mol:protein length:248 Ribosomal RNA small subunit methyltransferase I  ali model follow..  15  2........................GQLYIVPTPIGNLADITQRALEVLQAVDLIA-DTRHTGLLLQHFGINARLF------ALHDHNEQQKAETLLAKLQEGQNIALVSAGTPLINDPGYHLVRTCREAGIRVVPLPGPCAAITALSAAGLPSDR--------CYEGFLPAKSKGRRDALKAIEAEPRTLIFYESTHRLLDSLEDIVAV-LGESRYVVLARELTKTWETIHGAPVGELLAWVKEDENRRKGEMVL..................................... 220
23 -22.3002bb3_A mol:protein length:221 cobalamin biosynthesis precorrin-6Y methylase (cbiE)  ali model follow..  15  5.............SSGRENLYFSGHMIWIVGSGTCRGQT-TERAKEIIERAEVIY-----SRRALELAGVVDD----SRARILRSFKGDEIRRIM--EEGREREVAVISTGDPMVAGLGRVLREIAEDVEI--KIEPAISSVQVALARLKVDL------SEVAVVDCHAKDFDA------TELLKYRHLLILADSHFPLERLG----------KRRVVLLENLCMEGERIREGNADSIEL------ESDYTIIFVER................................... 209
24 -22.0003kwp_A mol:protein length:296 Predicted methyltransferase  ali model follow..  18  4............MEQQRSFQTETGGHLYLVPTPIGNLDDMTFRAVKTLTAVDLIA-DTRNTQKLLNHFEITTKQI------SFHEHNTQERIPQLIAKLKQGMQIAQVSAGMPSISDPGHELVNACIDAHIPVVPLPGANAGLTALIASGLAPQP--------YFYGFLDRKPKDRKAEIAGLAQRPETLIFYEAPHRLKKTLQNLAAG-FGDERPAVLCRELTKRYEEFLRGSLAELANWAATDTVRGEFVVLVG.................................... 235
25 -17.6001wyz_A mol:protein length:242 putative S-adenosylmethionine-dependent methyltransferase  ali model follow..  2.......................ETALYLLPVTLGDTPLLPSYNTEIIRGIRHFIVEDVRSARRFLKKVDREIDIDSLTFYPLNKHTSPEDISGYLKPLAGGASMGVISAGCPAVADPGADVVAIAQRQKLKVIPLVGPSSIILSVMASGFNGQSFAFHG---YLPIEPGERAKKLKTLEQRVYAESQTQLFIETPYRNHKMIEDILQN-CRPQTKLCIAANITCEGEFIQTRTVKDWKGHIPELS-KIPCIFLLY.................................... 233
26 -16.5003hh1_A mol:protein length:117 Tetrapyrrole methylase family protein  ali model follow..  21  1...................SNAHKGTLYVVATPLGNLDDMTFRAVNTLRNAGAIA-DTRRTSILLKHFG-----IEGKRLVSYHSFNEERAVRQVIELLEEGSDVALVTAGTPAISDPGYTMASAAHAAGLPVVPVPG.......................................................................................................................................................... 116
27 -11.5003fq6_A mol:protein length:115 Methyltransferase  ali model follow..  12  2.........................................................................................................................................NATAFVPALVASGLPNEK--------FCFEGFLPQKKGRQTRLKALAEEHRTMVFYESPHRLLKTLTQFAEY-FGTERQATVSREISKLHEETVRGSLAELIEHFTATEPRGEIVIVLA.................................... 111
28 -11.5003ffy_A mol:protein length:115 Putative tetrapyrrole (Corrin/porphyrin) methylase  ali model follow..  14  2.........................................................................................................................................NATAFVPALVASGLPNEK--------FCFEGFLPQKKGRMTKLKSLVDEHRTMVFYESPHRLLKTLTQFAEY-FGPERQVSVSREISKIHEETVRGTLSELIEHFTATDPRGEIVIVLA.................................... 111

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 3 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.