current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] COG0009 Putative translation factor (SUA5), from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MKTKRWFVDVTDELSTNDPQIAQAAALLRENEVVAFPTETVYGLGANAKNTDAVKKIYEAKGRPSDNPLIVHIADISQLEDLTGPAPEKAKTLMKRFWPGALTLILPCKPDALSPRVTAGLETVAIRMPDHPLALALIRESGLPIAAPSANLSGKPSPTKAEHVAHDLDGRIAGIVDGGPTGIGVESTVLSCADDIPVLLRPGGITKEQIEAVIGPIHVDKGLSDQNEKPISPGMKYTHYAPTAPLAICEGSPERIQHLIQEYQQGGRRVGVLTTEEKAGVYSADYVKSCGRRAQLETVAAGLYDALRSFDENKVDFIIAESFPDTGVGLAIMNRLMKAAGGRVIRLast
1 -105.0002eqa_A mol:protein length:352 Hypothetical protein ST1526  ali model follow..  44  1....MTQIIKIDPLNPEIDKIKIAADVIRNGGTVAFPTETVYGLGANAFDGNACLKIFQAKNRPVDNPLIVHIADFNQLFEVAKDIPDKVLEIAQIVWPGPLTFVLKKTER-VPKEVTAGLDTVAVRMPAHPIALQLIRESGVPIAAPSANLATRPSPTKAEDVIVDLNGRVDVIIDGGHTFFGVESTIINVTVEPPVLLRPGPFTIEELKKLFGEIVIPEFGKKEAEIALAPGMKYKHYAPNTRLLLVEN--RNIFKDVVSLLSKKYKVALLIPKELSKEFEGLQQIILGSDENLYEVARNLFDSFRELDKLNVDLGIMIGFPERGIGFAIMNRARKASGFSIIK 341
2 -99.9006f89_A mol:protein length:346 Threonylcarbamoyl-AMP synthase  ali model follow..  48  2..TIIINVRE----RIEEWKIRIAAGFIREGKLVAFPTETVYGLGANALDENAVKRIFEAKGRPADNPLIIHIASFEQLEVLAKEIPEEAEMLAKRFWPGPLTLVLPKSE-VVPRVITGGLDTVAVRMPAHEIALKLIELSERPIAAPSANISGKPSPTSAHHVAEDFYGKIECIIDGGETRIGVESTVIDLTEWPPVLLRPGGLPLEEIEKVIGEIRIHPAYGKSVDTAKAPGMKYRAAAPSAEVIVVEGPRDKVRRKIEELIAKFKEEGKKV--GVIGSGSYDADEVFYLGDTVEEIARNLFKALRHMDRTGVDVILAEGVEEKGLGLAVMNRLRKASGYRIIK 339
3 -77.3001jcu_A mol:protein length:208 conserved protein MTH1692  ali model follow..  25  1.....MLIRKITRKNPSPDVLEEAISVMEGGGIVIYPTDTIYGLGVNALDEDAVRRLFRVKGRSPHKPVSICVSCVDEIPRFS-RPSGDAMELMERILPGPYTVVLERNE-LIPDVITGGSSRVGIRVPDDEICRRIAA--RFPVTATSANISGKPPSPRLEEIVRDL-DAVDLVLDAGDCLDMEPSTVIDLTVNPPRVLRRGKGPLDPVLLRGAGDV................................................................................................................................ 208
4 -70.4002mx1_A mol:protein length:189 Threonylcarbamoyl-AMP synthase  ali model follow..  29  3..............NLQRDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPYIDDLTDVQRETIFSRWPGPVTFVFPAPAT-TPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFGAAFP-VVPGETGGRLNPSEIRDALTG--ELFRQG............................................................................................................................................... 189
5 -69.1001kk9_A mol:protein length:221 probable translation factor yciO  ali model follow..  24  15IMSQFFYI---HPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELSTYS-FVDNVAFRLMKNNTPGNYTFILKGTKEVPRRLLQEKRKTIGMRVPSNPIAQALLEALGEPMLSTSLMLPGSETESDPEEIKDRLEKQVDLIIHGGYLG-QKPTTVIDLTDDTPVVVREGVGDVKPF........................................................................................................................................ 220
6 -63.8003l7v_A mol:protein length:295 Putative uncharacterized protein smu.1377c  ali model follow..  13  22..QQMGRGSMTKHIHWDGNLSQEGFEIVKEGGVIVCPTKVGYIIMTS--DKKGLERKFEAKKRNRNKPGVVLCGSMEELRALA-QLTPEIDAFYQKHWDEDILLGCDGREELMTDIRGTSCFVIKFGVAGEQIAKEMWEKEGRMVYASSANPSGKGNRGKVEGIGERIESMVDLVIEADDYVASIQETRYEQGVMVSMVDKDGKLIPQQGADSRSVEPCPVDKIMMHLSDQFNSWNYRQ........................................................................................................... 285
7 -28.0002yv4_A mol:protein length:105 Hypothetical protein PH0435  ali model follow..  36  1................................................................................................................................................................................................................................................APNAEVIVVEGPREKITELVKELKERGKKVGVIGSESYNA------DEFFFLGSSVEEVAKNLFKALRYMDKAGVDVVIAEGVEERGLGLAVMNRLRKASGYKIVK 104
8 -20.6003vth_A mol:protein length:761 Hydrogenase maturation factor  ali model follow..  22  199..............GCFDDEIKCVAKALKEGKIVAIKGIGGFHLAVNALDDEAVATLRRRKKRYG-KPFAVMMRDVEEVKKYCIVSPEEERLLLSQRRP---IVLLKKKGEKLAKGIADDLDTLGVMLPYAPIHYLLMEEIDFPIVMTSGNVSEEPICKDNEEALEKLKDIADVFLNNRDIVNRIDDSVTSFNAGAERIIRRA............................................................................................................................................... 384
9 -20.5004g9i_A mol:protein length:772 Hydrogenase maturation protein HypF  ali model follow..  16  188.....YRLYTSDGQEIYGDPLRKAAELIDKGYIVAIKGIGGIHLACDAANEEVVAELRRRTFRPQ-KPFAIMAKDIETVKSFAYVSPEEEEELTSY--RRPIITLRKKEPFPLPENLAPGLHTIGVMLPYAGTHYILFHWSKTPYVMTSANYPGMPMVKDNERAFEELKDVADYFLHNRKILNRADDSVIRFVDGKRAVIRRSGFVPLPIEIPFEYNGLAVGAELMNAFGVAKNYPSQYIGNTGKVEVLEFMREAIAHFRKILRVKNLDLIIADLHPAYNTTKLAMEMANELDVELLQVQHHYAHIASVMAEKNLDSVIGIALDGVGYG................. 514
10 -20.4003tsq_A mol:protein length:658 Transcriptional regulatory protein  ali model follow..  23  99.....LEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPA-KPLAVMLPVADGLPDAARQLLTTPAA--------PIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLHNRDIVQRMDDSVVRESGEMLRRSR................................................................................................................................................. 286

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 2 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25.