current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0010 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst MYNTLNNKEDISLVSNNFGFLRLPVHFNPVETDAEWVITGVPFDASVSGRAGTRFGAEAIRRASVNLAWEHCRFPWDFDVRERLKIVDCGDLVYSFGDNQNFVEELEAHATALLKAGKRCLTFGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENGSRYDHGTMFYHAPNEGLIDAAHSVQIGIRTEFDRNLPFTVLSAPQVNEESVAQTVAKIKEVIGDLPVYLTFDIDCLDPAYAPGTGTPVCGGLSTDRALKILRALKDVNIVGMDLVEVSPAYDQSDITALAGATLALEMLYMQGAKKGLast
1 -101.0001gq6_A mol:protein length:313 PROCLAVAMINATE AMIDINO HYDROLASE  ali model follow..  36  2...ERIDSHVSPRYAQIPTFMRLPHDPQPR--GYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDR--GPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAH. 309
2 -97.4003nio_A mol:protein length:319 Guanidinobutyrase  ali model follow..  36  6..HQPLGGNEMPRFGGIATMMRLPHVQSPELDALDAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMAT--GAAPFDSLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFGIAHGTTFRRAVEEDLLDCDRVVQIGLRAQGSRKQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVV. 317
3 -97.3004dz4_A mol:protein length:324 Agmatinase  ali model follow..  43  18..PSVYGSSIENTYAGVLSFMRRNYTRDLD--GVDVVVSGVPLDLATTFRSGARLGPSAVRAASVQLAELNPYPW-GFDPFDDLAVIDYGDCWFDAHHPLSIKPAIVEHARTILQSDARMLTLGGDHYITYPLLIAHAQKYGPLSLIHFDAHCDTWADDAPLNHGTMFYKAVKDGLIDPKASVQVGIRTWNDDYLGINVLDAAWVHEHGARATLERIESIVGGRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIAAAHVACDLLCLWRQRK. 320
4 -93.9003nip_A mol:protein length:326 3-guanidinopropionase  ali model follow..  34  6..PQPLDAAEIPRFAGIPTFMRLPAFTDPA--ALQVGLIGVPWDGGTTNRAGARHGPREVRNLSSLMRKVHHVS--RIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGR-ERPLGMVHFDAHSDTNDRYNPYTHGTPFRRAIEEGLLDPLRTVQIGIRGSVARECGIRVIHMEEFVELGVEATLAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESA. 314
5 -93.0003lhl_A mol:protein length:287 Putative agmatinase  ali model follow..  27  2...........................SLNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDL---EDYNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYNDIYVIHFDAHTDLREEYNNNSHATVIKRIWD--IVGDNKIFQFGIRSGTKEEFKFATEEKHTYMEIGGIDTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIISNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKI. 278
6 -90.0001wog_A mol:protein length:305 agmatinase  ali model follow..  25  1.....MSGPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGK-TRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFAD-VPDLHVVQLDAHLDFTDTRNDWSNSSPFRRACEA-LPNLVHITTVGLRGLRARARGHTIIPMDDVTADL----AGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHV. 304
7 -88.4003pzl_A mol:protein length:313 Agmatine ureohydrolase  ali model follow..  26  6......NGREKDHASELRSIFSLKKIADAGYEEAKYVVFGIPFDNTSSYRRGSKYAPDSIRGAYVNLESYEYSYGIDLL---ASGMADLGDMEES-EDVEYVIDTVESVVSAVMSDGKIPIMLGGEHSITVGAVRALPK---DVDLVIVDAHSDFRSSYMGYNHACVTRRALD--LLGEGRITSIGIRSVSREEFKVSFISSFDVKKNGIDKYIEEVDR--KSRRVYISVDMDGIDPAYAPAVGTPEPFGLADTDVRRLIERL-SYKAVGFDIVEFSPLYD-NGNTSMLAAKLLQVFIASREKYY. 301
8 -83.8003m1r_A mol:protein length:322 Formimidoylglutamase  ali model follow..  24  12......EAGSSFKDRDVTKMSDLIATWD-GQDIKGPALIGVPLSKSSISHSGASFAPGTIRQALKHSSAYSAELGEHV---VSELLYDLGDIDIHVTDIVKSHHHIFQTMHALLSDHPVPLILGGDNSISYSTIKAIAQTKGTTAVIQFDAHHDVRNTEDGPTNGTPFRRLLDEEIIEGQHLIQLGIREFSNKKHNVNIHTMDMIREKGLIPTIKEILPVVQDDFIFISVDMDVLDQSHAPGCPAIGPGGLYTDELLEAVKYIQQPNVAGIEIVEVDPTLDFRDMTSRAAAHVLLHALKGMKLSP. 320
9 -80.8004rhm_A mol:protein length:351 Arginase  ali model follow..  21  2..........GSSSSGLVPRGSHMF---------SKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDFFCDHYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFDDIVIVHFDAHPDVSD------PRSPLRVLLDKGLL--KGVVSVGNRQVSSEDRKMFYMDMHAIYSKG----LFCIRDIRNDYPVFISIDADVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSIS. 317
10 -78.4004rhi_A mol:protein length:351 Arginase  ali model follow..  20  2..........GSSSSGLVPRGSHMFS-----KFLMNVKGVTPRG----SDWANRLGPVALFGYGAGMPRRAPLLDFFCDHYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFPDIVIVHFSARPSVSD------PRSPLRVLLDKGLL--KGVVSVGNRQVSSEDRKMFYMDMHAIYSKG----LFCIRDIRNDYPVFISIDASVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSIS. 317
11 -77.8002a0m_A mol:protein length:316 ARGINASE SUPERFAMILY PROTEIN  ali model follow..  21  4...........AARTDDPRLLSLFSAQREE--DADIVIIGFPYDEGCGGRAGAKKGPAAFRFFLQRLGSVNNL--ELNVDASHLKLYDAGDITAS--TLEEAHEKLESKVFTVLARGAFPFVIGGGNDQSAPNGRAMLRAFGDVGVINVDSHLDVRPPLQDVHSGTPFRQLLEESSFSGKRFVEFACQGSQVRDHQGHLMWLSEVRKKGAVAALEDAFGLTGK-NTFFSFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAKTPTVMMMDMSELNPLVE-EYRSPRVAVYMFYHFVLGFATRP. 304
12 -72.9001pq3_A mol:protein length:306 Arginase II, mitochondrial precursor  ali model follow..  26  2..................................SVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLSGNLHGQPVSFLLRELCISSASIVYIGLRDVDPPEHDIQYFSMRDIDRLGIQKVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFTREG 306
13 -71.2001t5f_A mol:protein length:314 Arginase 1  ali model follow..  25  2..................................PIEIIGAPFSKGCP-RGGVEKGPAALRKAGLVEKLKE--TEYNVRDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLAVIWVDAHTDINTPLTTSSAGQPVAFLLKELAISAKDIVYIGLRDVDPGELGIKYFSMTEVDKLGIGKVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSAFGTK. 302
14 -71.0001d3v_A mol:protein length:323 PROTEIN (ARGINASE)  ali model follow..  25  1............................MSSKPKPIEIIGAPFSKG-QPRGGVEKGPAALRKAGLVEKLKE--TEYNVRDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLSGNLHGQPVAFLLKELCISAKDIVYIGLRDVDPGELGIKYFSMTEVDKLGIGKVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTK. 307
15 -70.8005ynl_A mol:protein length:362 Arginase  ali model follow..  20  22......RQHMDSPDLGTDDDDKMSPATSPLATPRTAGIVGCPFSGG-QPKAGVHSGPLQLIESGLLNDIENLGWTVGADALAVSIVSDTPDPDIGRLKVSRVTKDVADRVYAHASKGQLTVTLGGDHSLAMGTVSGTFKAYPEACLIWVDAHADINTPHSGRLHGCPVSFLLGLDCLKPERIVYIGLRDIDAGERNIKCFSMFHVDKYGIGKVVEMALDHVRTRPIHLSFDVDALDPSVAPSTGTAVRGGLTFREGHYICEAIETNLLVSLDIMEINPSLGALASVA-QTVDVGRSLVRCALGET. 354
16 -70.7001wva_A mol:protein length:322 Arginase 1  ali model follow..  23  1............................MSAKSRTIGIIGAPFSKG-QPRGGVEEGPTVLRKAGLLEKLKEQECDVK--PFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLSGNLHGQPVSFLLKELCISAKDIVYIGLRDVDPGELGIKYFSMTEVDRLGIGKVMEETLSYLKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLA. 307
17 -70.2002eiv_A mol:protein length:291 Arginase  ali model follow..  26  3..................................RVAVVGVPMDLGAN-RRGVDMGPSALRYARLLEQLED----------LGYTVEDLGDVPVSLARASRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAAR-GRRVGVVWVDAHADFNTPESGNVHGMPLAVLSGLGAVDPKDVVLVGVRSLDPGEAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRI.... 290
18 -66.6001cev_A mol:protein length:299 PROTEIN (ARGINASE)  ali model follow..  27  3..................................PISIIGVPMDLGQT-RRGVDMGPSAMRYAGVIERLERLHYDIDIPIGKAERLHEQGDSRLRNKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAESGNIHGMPLAASLGFGKIKPEHVVLIGVRSLDEGEKGIKIYTMHEVDRLGMTRVMEETIAYLKEDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKL.... 298
19 -66.3001xfk_A mol:protein length:336 Formimidoylglutamase  ali model follow..  21  16...DPEDGQAGRRVHHIACPIQVG---ELANQEPGVALIGFECDAGVKGRTGAKHAPSLIKQALANLAWHH-----------PIPIYDLGNIRCEGDELEQAQQECAQVIQQALPHA-RAIVLGGGHEIAWATFQGLAQHFPRIGIINFDAHFDLRTFESELSSGTPFNQIHHFCQQQDFHYACLGVSRASADKLGVWYVEDKAFSPLSLKDHLTQLQHFIDDDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALAPYFDRILHYKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQV. 330
20 -65.9006dkt_A mol:protein length:296 Arginase  ali model follow..  26  2................................DKTISVIGMPMDLGQA-RRGVDMGPSAIRYAHLIERLSD----------MGYTVEDLGDIPINRNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYDAHGDLNTLESGNIHGMPLAVSLGIGKIKPENVVIIGARSLDEGESGMKVYTMHEIDRLGMTKVIEETLDYLACDGVHLSLDLDGLDPNDAPGVGTPVVGGISYRESHLAMEMLYDAIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKL.... 295
21 -65.2004ity_A mol:protein length:330 Arginase  ali model follow..  23  4.............................SGMAKKMSIVLAPFSGGQP-HSGVELGPDYLLKQGLQQDMEKLGWDTDGKVVEARKASDNGDRIGRVKRPRECTEKIYKCVRRVAEQGRFPLTIGGDHSIALGTVAGVLSVHPDAGVIWVDAHADINTMSSGNLHGCPLSILLGLDVLKPNKIAYIGLRAVDDEELNIAAFSMHHVDRYGIDKVVSMAIEAVGTEPVMVSYDVDTIDPLYVPATGTPVRGGLSFREALFLCERIECGRLVALDVVECNPLLAATESHVNDTISVGCAIARCMMGET. 313
22 -63.6004g3h_A mol:protein length:330 Arginase (RocF)  ali model follow..  18  1...................................MILVGLEAELGAS-KRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFEDYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKKIGILYLDAHADIHTAYSKHIHGMPLGMVLNRVEIDPKCLVYFGVRSTEQSELQIPLFSVDAIRE-NMQEVVQKTKESLAVDIIYLSLDLDIMDGKLFTSTGVRENNGLSFDELKQLLGLLLESRLKAVEVTEYNPTVSIKHNNEKQVLEILDLIINSCKIKD. 313
23 -63.6004q3p_A mol:protein length:385 Arginase  ali model follow..  19  12............GSHMMLKSVATPYDEKPKLLYTSANFLGIPTNRG-QPKIGTYQGPELIRKSNFFQLVAE--DGIQLTDCGDIIPVELNEAEDPQRRVEELMKQSNKHTVELSGSKSTPVIVGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLSGNMHGMPLSFLVKELCLNASNIAYIGLRDLDAHETGIAYFTMLDVDRMGIEAVIKEALLAVLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATKLSVVELAELNPLLGSQEKTQSSAVHILRACLGHCRSGH. 355
24 -59.3003mmr_A mol:protein length:413 Arginase  ali model follow..  20  82...............................INNNDNNNDNNNDNNNDNNNNCYIPNGVIKEKKHDLSNNKMNGYVNYGNYEENNVISTNDKYKNNCEIGIFSKNLFDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPESGNYHGMTLAHTLNLTYLKPENTAIIGIRDIDAYEKNINYYTIFDIEKNGIYNTICTALEKISNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILETKRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGK... 392

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 3 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.