current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] COG0011 Uncharacterized conserved protein, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst MPKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYRLast
1 -49.4001vk8_A mol:protein length:106 hypothetical protein TM0486  ali model follow..  100  7MPKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYR 100
2 -46.1002eky_A mol:protein length:100 UPF0045 protein MJ1052  ali model follow..  26  4MRKVVAEVSIIPLGKGASVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAFKEAHSTVLNDVDRVVSSLKIDERKDKETIERKLKAIG 98
3 -43.1002ibo_A mol:protein length:104 Hypothetical protein SP2199  ali model follow..  29  2..KASIALQVLPLVQGIDRIAVIDQVIAYLQTQEVTMVVTPFETVLEGEFDELMRILKEALEVAGQEADNVFANVKINVGEIL-SIDEKLEKYT 92
4 -42.9001yqh_A mol:protein length:109 IG hypothetical 16092  ali model follow..  37  5SQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDVVKRAQQACDAGAEEVITSIKIHYRPSTVTIDEKVWKYR 100
5 -39.7001lxj_A mol:protein length:104 HYPOTHETICAL 11.5KDA PROTEIN IN HTB2-NTH2 INTERGENIC REGION  ali model follow..  18  5..FCLADVCMVPIGTDSSISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGEKGYVRVHTDIRVGTRTDKHTAQDKIDVVL 99
6 -36.0001lxn_A mol:protein length:99 HYPOTHETICAL PROTEIN MTH1187  ali model follow..  21  2...ITAELTVIPLGTCSSLSSYVAAAVEALKKLNVRYEISGMGTLLEADLDELMEAVKAAHEAVQAGSDRVYTTLKIDDRRDARGLRDKVESVK 96
7 -27.7001s7h_A mol:protein length:200 ykoF  ali model follow..  10  114..EAPCQFALYPMNEP-DYMGLIMEAVDIAKAQGTFVQGVHYASELDGDAHDVFSTLEAVFRMAEQQTNHITMTVNLSANSPSRKNRKQ..... 199
8 -5.8404f0h_B mol:protein length:138 Ribulose bisphosphate carboxylase small chain  ali model follow..  16  1MRITQGTFSFLPDLTDEQIKKQIDYMISKKLAIGIEYEMWGLPLFEVTDPAPVLFEINACRKAKSNFYIKVV...................... 83
9 -5.8006ftl_I mol:protein length:139 Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit  ali model follow..  12  1MRLTQGCFSFLPDLTDAQIEKQVAYAMAKGWAMNVEWELWGLPLFDIKDPATVMFELNEARKSCAAGYIRIN...................... 83
10 -5.6701bxn_I mol:protein length:139 PROTEIN (RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN)  ali model follow..  11  1MRITQGTFSFLPELTDEQITKQLEYCLNQGWAVGLEYEMFGLPMFDLRDAAGILMEINNARNTFPNHYIRVT...................... 83

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 2 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25.