current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] COG0011 Uncharacterized conserved protein, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst MPKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYRLast
1 -55.7001vk8_A mol:protein length:106 hypothetical protein TM0486  ali model follow..  100  7MPKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYR 100
2 -50.9002ibo_A mol:protein length:104 Hypothetical protein SP2199  ali model follow..  29  1.MKASIALQVLPLVQGIDRIAVIDQVIAYLQTQEVTMVVTPFETVLEGEFDELMRILKEALEVAGQEADNVFANVKINVGEI-LSIDEKLEKYT 92
3 -48.9001yqh_A mol:protein length:109 IG hypothetical 16092  ali model follow..  37  5SQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDVVKRAQQACDAGAEEVITSIKIHYRPSTVTIDEKVWKYR 100
4 -48.8002eky_A mol:protein length:100 UPF0045 protein MJ1052  ali model follow..  26  4MRKVVAEVSIIPLGKGASVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAFKEAHSTVLNDVDRVVSSLKIDERKDKETIERKLKAIG 98
5 -42.8001lxj_A mol:protein length:104 HYPOTHETICAL 11.5KDA PROTEIN IN HTB2-NTH2 INT  ali model follow..  18  4.IFCLADVCMVPIGTDSSISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGEKGYVRVHTDIRVGTRTDKHTAQDKIDVVL 99
6 -38.3001lxn_A mol:protein length:99 HYPOTHETICAL PROTEIN MTH1187  ali model follow..  23  2...ITAELTVIPLGTCSSLSSYVAAAVEALKKLNVRYEISGMGTLLEAELDELMEAVKAAHEAVQAGSDRVYTTLKIDDRRDARGLRDKVESVK 96
7 -25.2001s7h_A mol:protein length:200 ykoF  ali model follow..  13  9.RIAGFRFSLYPM--TDDFISVIKSALKKTDTSKVWTKTDHISTVLRGSIDHVFDAAKAIYLHAANSEQHIVMNGTFS................ 83
8 -6.7603ctv_A mol:protein length:110 3-hydroxyacyl-CoA dehydrogenase  ali model follow..  18  23FTFVEINEAVKLVEMGVATPQDIDTAIKL----GLNRPFGPFELAKQFGAEQIAKRLEELAKQFGKKIFEPAKTLKEGKLEELLKAGKAEGS.. 110
9 -5.9204lub_A mol:protein length:276 Putative prephenate dehydratase  ali model follow..  22  34......................ITEVIKAYESKQVCFAIVPVENSIEGSVHETFDYL..................................... 68
10 -5.8904zhe_A mol:protein length:209 ASPR2 protein  ali model follow..  11  21.....................FKETVHKLEQESGFFFNMKYFEEKVAGEWDEVEKYLSGFTKVDDN............................ 66

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.