current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [F] COG0015 Adenylosuccinate lyase, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MIERYTLPEMGKIWTDTYKLQTWLDVEIAVCEAQAELGYIPQAAVDEIKAKAKFDPQRVLEIEAEVRHDVIAFLTNVNEYVGDAGRYIHLGLTSSDVLDTALALQLVASLDLILEQLEKLIQAIRYQAQQHRYTVMVGRSHGIHAEPITFGFKLAGWLAEVLRNRDRLVRVAQSIAVGKISGAVGTYANIDPKVEAIACQKLGLEPDTASTQVISRDRHAEYVQQLALLAASLERFAVEIRNLQRTDVLEVEEYFSKGQKGSSAMPHKRNPIRSERLTGMARLVRGHAVAALENVALWHERDISHSSVERVAFPDCCILTHFMLKETTDLVKNLLVYPENMKRNMNVYGGVIFSQKVLLALVEKGMNREDAYRVVQGSAHQAWNTEGGNFEELVRADAQVTALLSAEEIDQCFDPQQHLTNLAEIYSRLDILast
1 -123.0002x75_A mol:protein length:431 ADENYLOSUCCINATE LYASE  ali model follow..  51  1MIERYSREEMSNIWTDQNRYEAWLEVEILACEAWSELGHIPKADVQKIRQNAKVNVERAQEIEQETRHDVVAFTRQVSETLGEERKWVHYGLTSTDVVDTALSFVIKQANDIIEKDLERFIDVLAEKAKNYKYTLMMGRTHGVHAEPTTFGVKMALWYTEMQRNLQRFKQVREEIEVGKMSGAVGTFANIPPEIESYVCKHLGIGTAPVSTQTLQRDRHAYYIATLALIATSLEKFAVEIRNLQKTETREVEEAFAKGQKGSSAMPHKRNPIGSENITGISRVIRGYITTAYENVPLWHERDISHSSAERIMLPDVTIALDYALNRFTNIVDRLTVFEDNMRNNIDKTFGLIFSQRVLLALINKGMVREEAYDKVQPKAMISWE-TKTPFRELIEQDESITSVLTKEELDECFDPKHHLNQVDTIFERA.. 428
2 -123.0001c3u_A mol:protein length:431 ADENYLOSUCCINATE LYASE  ali model follow..  48  1MVERYSLSPMKDLWTEEAKYRRWLEVELAVTRAYEELGMIPKGVTERIRNNAKIDVELFKKIEEKTNHDVVAFVEGIGSMIGEDSRFFHYGLTSSDVLDTANSLALVEAGKILLESLKEFCDVLWEVANRYKHTPTIGRTHGVHAEPTSFGLKVLGWYSEMKRNVQRLERAIEEVSYGKISGAVGNYANVPPEVEEKALSYLGLKPEPVSTQVVPRDRHAFYLSTLAIVAAGIERIAVEIRHLQRTEVLEVEEPFRKGQRGSSAMPHKKNPITCERLTGLSRMMRAYVDPSLENIALWHERDISHSSVERYVFPDATQTLYYMIVTATNVVRNMKVNEERMKKNIDLTKGLVFSQRVLLKLIEKGLTRKEAYDIVQRNALKTWN-SEKHFLEYLLEDEEVKKLVTKEELEELFDISYYLKHVDHIFERF.. 428
3 -122.0001f1o_A mol:protein length:431 ADENYLOSUCCINATE LYASE  ali model follow..  55  1MIERYSRPEMSAIWTDENRFQAWLEVEILACEAWAELGVIPKEDVKVMRENASFDINRILEIEKDTRHDVVAFTRAVSESLGEERKWVHYGLTSTDVVDTALSYLLKQANDILLKDLERFVDIIKEKAKEHKYTVMMGRTHGVHAEPTTFGLKLALWHEEMKRNLERFKQAKAGIEVGKISGAVGTYANIDPFVEQYVCEKLGLKAAPISTQTLQRDRHADYMATLALIATSIEKFAVEIRGLQKSETREVEEFFAKGQKGSSAMPHKRNPIGSENMTGMARVIRGYMMTAYENVPLWHERDISHSSAERIILPDATIALNYMLNRFSNIVKNLTVFPENMKRNMDRTLGLIYSQRVLLALIDTGLTREEAYDTVQPKAMEAWE-KQVPFRELVEAEEKITSRLSPEKIADCFDYNYHLKNVDLIFERL.. 428
4 -119.0002pfm_A mol:protein length:444 Adenylosuccinate lyase  ali model follow..  54  4MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDVKKIREHASFDIDRIYEIEKETRHDVVAFTRAVSETPGEERKWVHYGLTSTDVVDTALSYILKQANEIILKDLENFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEMKRNVERFKQAANTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHAHYMSTLALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTGLARVIRGYMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYPENMKRNMTRTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWE-TQVQFKELVEADERITSKLTQEEINECFNYEHHMQHVDTIFERL.. 433
5 -114.0003c8t_A mol:protein length:451 Fumarate lyase  ali model follow..  29  10..RSFADDKMRELFSAQSFISRCVETEVALARAQARLGIIPEDAAAGITAAARPEMERLRDDTEIVGYPILPLVEQLSAHAGEAGKYLHWGATTQDIMDTATVLQIRDGLALISRRIESVRKALAALARNHRDTPMAGRTHLQHALPVTFGYKAAVWLSAFDRHAARLEEISPRVLVVEFSGASGTLASLGTRVQRELARELNLGVPSI-TWHSARDAVAETVQFLALVSGSLGKLAMDISIMMTTELGEVAEPFVRHRGASSTMPQKQNPVSCELILAGARIVRNHATSMLDAMIHDFERATGPWHLEWSAVPEGFAVASGILYQAEFMLGGLQVFPDRMRENLDHSRGLIVAEAVMMALA-PHTGRKEAHDIVYLGCRRAVE-DKTGLFEVLRTMPEVAKPLGEEALRDLTDPRNYLGSAGAMVDNV.. 439
6 -112.0001yis_A mol:protein length:478 adenylosuccinate lyase  ali model follow..  25  11LSTRYKNSPLVSILSETNKATLWRQLWIWLAEAEKELGLKQVTQDAIDEMKSNFDWPFIRSEERKLKHDVMAHNHAFGKLCPTAAGIIHLGATSCFVQDNADLIAYRDSIDHILKRFATVIDRLAAFSLKNKEVVTVGRTHYQTASLVTVGKRGVLWAQELLMAFQSLSEFRDKMRFRGIKGATGTQDSFLAGDESKVEALDELVTKLITGQTYSRQQDSQLVFSLSLLGAAAKKVCTDIRVLQAFG--ELLEPFEKDQIGSSAMPYKKNPMKSERCCALSRKLINAPQEALTILAQGLERTLDDSAGRRMLIPDVLLTAEALLTTLQNIFEGLSVQTDNVKKIVEDEIAFLGLEKAMMMLTEEGVDRQQAHAVIRKTALEAKQ-LQATQKVDIRQADPFFDSVRDRVVGLVNNPINFTGRCVSQTESF.. 454
7 -111.0004eei_A mol:protein length:438 Adenylosuccinate lyase  ali model follow..  38  1MIKRYDVAEISKIWADENKYAKMLEVELAILEALED-RMVPKGTAAEIRARAQIRPERVDEIEKVTKHDIIAFCTSIAEQFAETGKFFHFGVTSSDIIDSALSLQIRDSMSYVIKDLEALCDSLLTKAEETKEIITMGRSHGMFAEPMSFGQKFLGAYVEFKRRLKDLKDFQKDGLTVQFSGAVGNYCILTTEDEKKAADILGLPVEEVSTQVIPRDRIAKLISIHGLIASAIERLAVEIRHLHRSDVFEVYEGFSKGQKGSSTMPHKKNPISTENLTGMARMLRSHVSIALENCVLWHERDISHSSAERFYLPDNFGIMVYALRRMKNTIDNLVVQRDIIEDRVRSTSAYLSSFYLHFLVANTPFMREDCYKIVQQVAFDLKQGESFSKKLQKVMHDEHNIILDIPEMDFEGIKKTYLKEIDHVFDRS.. 429
8 -111.0001q5n_A mol:protein length:454 3-carboxy-cis,cis-muconate cycloisomerase  ali model follow..  28  8YASLFYQRDVTEIFSDRALVSYMVEAEVALAQAQAQVGVIPQSAATVIQRAAKIDFDALATATGLAGNIAIPFVKQLTAIVEDAARYVHWGATSQDILDTACILQCRDALAIVQNQVQQCYETALSQAQTYRHQVMMGRTWLQQALPITLGHKLARWASAFKRDLDRINAIKARVLVAQLGGAVGSLASLQDQVVEAYAKQLKLGQTAC-TWHGERDRIVEIASVLGIITGNVGKMARDWSLMMQTEIAEVFEPTAKGRGGSSTMPHKRNPVAAASVLAAANRVPALMSSIYQSMVQEHERSLGAWHAEWLSLPEIFQLTAGALERTLDVLKGMEVNAENMHQNIECTHGLIMAEAVMMALA-PHMGRLNAHHVVEAACKTAVA-EQKHLKDIISQVDEVKQYFNPSQLDEIFKPESYLGNIQDQIDAV.. 445
9 -110.0005vkw_A mol:protein length:482 Adenylosuccinate lyase  ali model follow..  26  11LSSRYASEEMSKIFSLRNRFSTWRKLWLNLAIAEKGLSVITDEAIEQMKQHLEKEIQDAAVEEAKVRHDVMAHVHVFGETCPSAAGIIHLGATSCFVTDNADLIFLRDAYDVLIPKLVNVIDRLSKFALEYKDLPVLGWTHFQPAQLTTVGKRATLWLQELLWDLRNMVRARNDIGLRGVKGTTGTQASFLSLFHGDHDKVEELDVYPVTGQTYSRKIDIDVLSPLASFGATAHKFATDIRLLANLK--EIEEPFEKSQIGSSAMAYKRNPMRCERVCSLARHLGGLFNDAVQTASQWFERTLDDSAIRRISLPSAFLTVDILLSTMLNITSGLVVYPKVIERRINSELPFMATENIIMAMVEKGGSRQDCHEEIRVLSHQASAVGDNDLIERIKSTEYFK--PIWNDLDTLLDPKTFVGRAPQQTEKF.. 457
10 -109.0005xny_A mol:protein length:489 CreD  ali model follow..  29  36LSPVRAGTPVEALVCDSAWLQAMLDAEAALTRAQARTGFLPAAAAEAITAAARIDLLAVARGARETANPVVGLVAALTAAVPAAAEYVHRGSTSQDVLDTGAMLVARRALRLIGDDLDRAADALAALAADHRDTPMAGRTLALHAVPTTFGLKAAGWLELVSEAAGRVARLRDGLPF-SLGGAAGTLAGLLDRLLDAYAAETGLARPVL-PWHVLRTPVADLAAVLAFTAGALGKIAVDVQSLARTEVAEVAEPAVEGRGASSAMPHKRNPVLSTLIRSAALQVPALATGLTQCLVSEDERSAGAWHAEWQPLRECLRLTGGAARTAVELAAGLEVDAARMRANLDLTDGRIVSESVAVALT-PLLGRQAAKELLTRAAFTAGH-EGRTLGEVLGELPELDGVLPKERWEALLDPARATGVAGALVDGA.. 480
11 -109.0004nle_A mol:protein length:488 Adenylosuccinate lyase  ali model follow..  26  17LANRYASDEMVAIWSPEAKIIAERRLWLAVLRAQAELGVAVPDGVVEDYERVNVDLESIAARERVTRHDVKARIEEFNA--LAGHEHVHKGMTSRDLTENVEQLQIRQSLELVFSHGVAVVARLAERAVVYRDLVMAGRSHNVAAQATTLGKRFASAAEETLVALTRLRELIDRYPLRGVKGPMGTAQDMLDDLERRVAEFLGFTVFTSVGQVYPRSLDHDVLSALVQFGAGPSSMAHTIRLMAGHE--LVTEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLRGYASMAAELAGQWNEGDVFCSVVRRVALPDAFFAIDGQTETFLTVLDEFGAYPAVIQRELDRYLPFLATTRILMAAVRAGVGREAAHEVIKEHAVAVALAREPDLIDRLAGDPRL-PLDKVALEAALEDKQAFTGAAGDQVDGV.. 459
12 -109.0001re5_A mol:protein length:450 3-carboxy-cis,cis-muconate cycloisomerase  ali model follow..  32  6FDAYFTAPAMREIFSDRGRLQGMLDFEAALARAEASAGLVPHSAVAAIEAACQYDTGALANAIATAGNSAIPLVKALGKVIPEAERYVHLGATSQDAMDTGLVLQLRDALDLIEADLGKLADTLSQQALKHADTPLVGRTWLQHATPVTLGMKLAGVLGALTRHRQRLQELRPRLLVLQFGGASGSLAALGSKVAEALAEQLKLTLPEQ-PWHTQRDRLVEFASVLGLVAGSLGKFGRDISLLMQTEAGEVFEPSAPGKGGSSTMPHKRNPVGAAVLIGAATRVPGLLSTLFAAMPQEHERSLGLWHAEWETLPDICCLVSGALRQAQVIAEGMEVDAARMRRNLDLTQGLVLAEAVSIVLA-QRLGRDRAHHLLEQCCQRAVA-EQRHLRAVLGDEPQVSAELSGEELDRLLDPAHYLGQARVWVARA.. 441
13 -107.0005v4l_A mol:protein length:479 Adenylosuccinate lyase  ali model follow..  25  8LSSRYASKEMSKLFSSGARFGTWRKLWLNLAIAEKELGLAISDAAIEQMKANEAQMKVAAEEEKKRRHDVMAHVHTFGTVAPEAAGIIHLGATSCYVTDNADLIFLRDGLDILLPKLATVISRLANFAKQYRDLPTLGFTHFQPAQLTTVGKRATLWIQELLWDLRNLQRARDDLGFRGVKGTTGTQASFLAALDKRVTELFGFPYAPVTGQTYSRKIDADVLGPLSSFGATVHKIATDIRLLANLK--EIEEPFEKDQIGSSAMAYKRNPMRCERACSLARHLMAIYQNTLMTSSQWLERTLDDSANRRVTIPEAFLTADILLTTLQNISEGLVVYPRVIGRRISQELPFMATENIIMAIVKAGGDRQECHEKIRVLSHQAGAVGENDLIDRVKNDEYFK--PIWGQLDALLDPRTFVGRAPEQVDGF.. 453
14 -106.0004ffx_A mol:protein length:487 Adenylosuccinate lyase  ali model follow..  26  20LASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNNIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLEGDDHKVEQLDKMVAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLK--EMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVKQEGGDNDLIERIQVDAYFSHSQLDHLLDPSSFTGRASQQVQRF.. 463
15 -103.0002j91_A mol:protein length:503 ADENYLOSUCCINATE LYASE  ali model follow..  26  33LASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNNIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLEGDDHKVEQLDKMVAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLK--EMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVKQEGGDNDLIERIQVDAYFSHSQLDHLLDPSSFTGRASQQVQRF.. 476
16 -103.0004mx2_A mol:protein length:480 Adenylosuccinate lyase  ali model follow..  17  38LDGRYKTTPLRAYFSEYALFKYRVQVEVLYFEALCKEVPAITQLRGVTDAQLGDDAKIIKGIEAVTNHDIKAVEYYLKDKMSAEKEFIHFGLTSQDINNTSIPMLLRDALHHHYIPTLDQLIALLKSKLPEWDVPMLARTHGQPASPTNLAKEFMVWIERLEEQRTMLLSIPNTGKFGGATGNFNAHLCAYPGGELFLSKYLGLRRQRYTTQIEHYDNLAAICDACARLHTILMDLAKDVWQYI--SLGYFDQKVRAGEVGSSAMPHKVNPIDFENAEGNLGMSNAVLGFLSAKLPISRLQRDLTDSTVLRNLGVPLSHALIAFASLRRGIDKLLLNKDVIASDLEGNWAVVAE---GIQTVLRREGYPKPYEALKDLTRGNAHVTEETVHRFVQQLEGITEEVRQELLA--ITPFTYVGYTAH....... 479
17 -103.0001dof_A mol:protein length:403 ADENYLOSUCCINATE LYASE  ali model follow..  33  6FDWRYGSEEIRRLFTNEAIINAYLEVERALVCALEELGVAERGCCEKVNKAS-VSADEVYRLERETGHDILSLVLLLEQ--KSGCRYVHYGATSNDIIDTAWALLIRRALAAVKEKARAVGDQLASMARKYKTLEMVGRTHGQWAEPITLGFKFANYYYELYIACRQLALAEEFI-RAKIGGAVGTMASWGLEVRRRVAERLGLPHHVITTQVAPRESFAVLASALALMAAVFERLAVEIRELSRPEIGEVVE----GGGGSSAMPHKANPTASERIVSLARYVRALTHVAFENVALWHERDLTNSANERVWIPEALLALDEILTSALRVLKNVYIDEERITENLQKALPYILTEFHMNRMIKEGASRAEAYKKAKEVKALTFE-YQKWPVERLIEDALSLKLC........................... 403
18 -102.0005eyt_A mol:protein length:497 Adenylosuccinate lyase  ali model follow..  26  22LTKRYASREMVCNFGEKRKVILWRQLWIWLAETQKELGFDITDEQINEMKSQSVDFGTAAAEEKARRHDVMAHVYTFALACPKAAPIIHLGATSCFVGDNADLIMLKDGLNILLPKVARCIDRLAKKAMLHKSLICLARTHLQPAQPTTMGRRICMWIQDLLLDLENLERLKNHTIFRGAKGAVGTQASFMDKLDEILTKKSGFQRSCVTGQTYPRKVDIEITNALSNIGATVHKICTDIRLLSSFH--EVEEPFETKQIGSSAMPYKRNPIRSERACSLARYLMHISTSMVSTVSQWLERSLDDSAIRRIVLPEAFLAADACLTLLQNIAEGLIVYPMVMEANLNSELPFLVVERILVKMVSEGANRQECHERLRKHSHEAAAELKNSLMDKLLNDYYFA--PIHSLLPTVLDPSYMIGRAVEQVEVF.. 467
19 -98.0003bhg_A mol:protein length:459 Adenylosuccinate lyase  ali model follow..  18  15IDGRYVTRALSPYFSEFALTYYRLMVEIKWFESLAANDTIPEVPALDNKARKFLEAEKIKEFEKQTNHDVKAVEYYLQDKFKSCVAFIHFACTSEDINNLAYALMIKQAIQVIQPTIAEIMGSITLLGKQHADVAMLSRTHGQPATPTTMGKELVNFVARLKRPQQQLAEVLIPAKFNGAVGNYNAHVAAYPEHCANFVTSLGLSFNAYTTQIEPHDGIAEVSQIMVRINNILLDYTQDIWSYISLG--YFKQKTIAEEVGSSTMPHKVNPIDFENAEGNLGLSNALFIHFANKLTQSRMQRDLSDSTVLRNLGVAFSYSLIAYHSVAKGNDKLQINKSALQKDLSENWEVLAE---AIQTVMRRYNEPNAYEQLKELTRGQMI-DAENLKKFIKTLSIPEEAK---AELMKLTPETYTGLATQLVKAFS. 459
20 -97.1002fel_A mol:protein length:359 3-carboxy-cis,cis-muconate lactonizing enzyme  ali model follow..  24  11LSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSADMSALRHGVAKDGVVVPELIRQMRAAVGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNVRADLAKRLGLA--DRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGS----EIRLSGGGGSSAMPHKQNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQI----DRLGAD....................................................................................... 351
21 -96.4003gzh_A mol:protein length:482 Adenylosuccinate lyase  ali model follow..  19  30VDGRYGVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAARIKTIERTTNHDVKAVEYFLKEKVAAVSEFIHFACTSEDINNLSHALMLKTARDVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALN--HFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHN-WEVLAEPIQTVMRRYG--IEKPYEKLKELTRGKRV-DAEGMKQFIDGLALP---EEEKARLKAMTPANYIGRAITMVDEL.. 473
22 -95.4001aos_A mol:protein length:464 ARGININOSUCCINATE LYASE  ali model follow..  17  11..GRFVGA-NASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTNSNDEDIHTANERLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVD-RELLRAELNFGAITLNDATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFSFVQLS-DAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALS---PDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAET-KGVALNQLSLQELQTISPLFSGDVICVWDYRHSVGTARSSVDWQ.. 451
23 -95.3004nsl_A mol:protein length:470 Adenylosuccinate lyase  ali model follow..  19  20VDGRYGVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADANGYLDAARIKTIERTTNHDVKAVEYFLKEKVADVSEFIHFACTSEDINNLSHALMLKTARDVILPYWRQVINAVKDLATQYRDIPLLSRTHGQPATPSTLGKEMANVAYRMERQFRQLNQVEILGKINGAVGNYNAHIAAYPEFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCIARFNTILIDFDRDVWGYIALN--HFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLHHLANKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELD-HNWEVLAEPIQTVMRRYG--IEKPYEKLKELTRGKRV-DAEGMKQFIDS---LALPEAEKTRLKAMTPANYIGRAVTLVDEL.. 463
24 -95.2001hy0_A mol:protein length:466 DELTA CRYSTALLIN I  ali model follow..  18  11..GRFVGSTSTSISTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLEKISEELSKGVTQSDEDIQTANERLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDID-REMLRSELEFASISLNDAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFGFLTLS-DAFSTGSSLMPQKKNPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVIDVVDTLTAVLQVATGVISTLQISKENMEKALT---PEMLATDLALYLVRKGMPFRQAHTASGKAVHLAET-KGIAINNLTLEDLKSISPLFSSDVSQVFNFVNSVGTAKSSVTTQ.. 451
25 -95.0002ptq_A mol:protein length:462 Adenylosuccinate lyase  ali model follow..  19  12VDGRYGVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAARIKTIERTTNHDVKAVEYFLKEKVAAVSEFIHFACTSEDINNLSHALMLKTARDVILPYWRQLIDGLKDLAVQYRDIPLLSRTNGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYI--ALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHN-WEVLAEPIQTVMRRYG--IEKPYEKLKELTRGKRV-DAEGMKQFIDGLALP---EEEKARLKAMTPANYIGRAITMVDEL.. 455
26 -94.3001u15_A mol:protein length:472 Delta crystallin I  ali model follow..  18  11..GRFVGSTNSSIAYDQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVKQSDEDIHTANERLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDID-REMLRSELEFASISLNDAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFGFLTLS-DAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVIDVVDTLTAVLQVATGVISTLQISKENMEKALT---PEMLATDLALYLVRKGMPFRQAHTASGKAVHLAET-KGIAINNLTLEDLKSISPLFSSDVSQVFNFVNSVGTAKSSVTTQ.. 451
27 -94.0001dcn_A mol:protein length:447 DELTA 2 CRYSTALLIN  ali model follow..  17  4IMEKLN----SSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVKQSDEDIHTANERLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDID-REMLRSELEFASISLNDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLS-DAFSTGSSLMPQKKNPDSLELIRSKSGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALT---PEMLATDLALYLVRKGVPFRQAHTASGKAVHLAET-KGITINNLSLEDLKSISPQFSSDVSQVFNFVNSVGTAKSSVTTQ.. 435
28 -93.8004efc_A mol:protein length:472 Adenylosuccinate lyase  ali model follow..  15  27LDGRYKTKALRAFFSEYGFFRYLVEVEYFTALCKDVPTIVPLRSVTDEQLQKVSSAEEIKRLERVTNHDIKAVEYFIKERMDHVTEFVHFGLTSQDINNTAIPMMIRDAIVTLYLPALDGIIGSLTSKLVDWDVPMLARTHGQPASPTNLAKEFVVWIERLREQRRQLCEVPTTGKFGGATGNFNAHLVAYPSADMFLAKYLGLKRQQATTQIENYDHLAALCDACARLHVILIDMCRDVWQYI--SMGFFKQKVKEGEVGSSTMPHKVNPIDFENAEGNLALSNALLNFFASKLPISRLQRDLTDSTVLRNLGVPIGHACVAFASISQGLEKLMISRETISRELSSN-WAVVAEGIQTVLRREC--YPKPYETLKKLTQGNTDVTEEQVRNFINGLTDISDDV--RAELLAITPFTYVGYVPRFSAK... 472
29 -93.8001i0a_A mol:protein length:466 DELTA CRYSTALLIN I  ali model follow..  19  20IMEIL----SSSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKILSGLEKISEESSKGVTQSDEDIQTAIERLKELIGDIAGKLQTGRSRNEQVVTDLKLLLKSSISVISTHLLQLIKTLVERAAIEIDIIMPGYTHLQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPLGSGVLAGNPLEID-RELLRSELDMTSITLNDAISERDFVVELISVATLLMIHLSKLAEDLIIFSTTEFGFVTLS-DAYSTGSSLLPQKKNPDSLELIRSKAGRVFGRLAAILMVLKGIPSTFSKDLQEDKEAVLDVVDTLTAVLQVATGVISTLQINKENMEKALT---PELLSTDLALYLVRKGMPIRQAQTASGKAVHLAET-KGITINNLTLEDLKSISPLFASDVSQVFSVVNSVGTAKSSVTAQ.. 451
30 -93.4001xwo_A mol:protein length:465 Delta crystallin  ali model follow..  18  10..GRFVGS-STSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVTQSDEDIHTANERLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPLGSGALAGNPLDID-REMLRSELDFASISLNDAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFGFLTLS-DAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALT---PEMLSTDLALYLVRKGMPFRQAHTASGKAVHLAET-KGITINNLTLEDLKSISPLFSSDVSQVFNFVNSVGTAKSSVTTQ.. 450
31 -92.1001tju_A mol:protein length:474 Delta crystallin II  ali model follow..  18  13..GRFSGSLNSSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVKQSDEDIHTANERLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYSHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDID-REMLRSELEFASISLNDAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFGFLTLS-DAFSTGSSLMPQKKNPDSLELIRSKAGRVFGRLASILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALT---PEMLATDLALYLVRKGVPFRQAHTASGKAVHLAET-KGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVGTAKSSVTTQ.. 453
32 -91.4001tj7_A mol:protein length:457 Argininosuccinate lyase  ali model follow..  17  15RFKQFN----DSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEEALNVLLEDVRARPQQIAEDIHSWVEGLIDKVGQLGKKLHTGRSRNDQVATDLKLWCKDTVSELLTANRQLQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYEID-REQLAGWLGFASATRNDSVSDRDHVLELLSAAAIGMVHLSRFAEDLIFFNTGEAGFV-ELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAALVLDGIQVKRPRCQEAAQ--QGYANATELADYLVAKGVPFREAHHIVGEAVVEAIR-QGKPLEDLPLSELQKFSQVIDEDVYPILSLQSCLGVSPQQVAQA.. 448
33 -90.9002e9f_A mol:protein length:462 Argininosuccinate lyase  ali model follow..  19  14.PDALAARFNASLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLDRIEEEIEAGTREELEDVHMNLEALTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDELLALLLALRRVLVREAEKHLDPVLPGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPLGAAALAGTGFPID-RHFTARELGFKAPMRNDAVASRDFALEVLSALNIGMLHLSRMAEELILYSTEEFGFV-EVPDAFATGSSIMPQKKNPDILELIRAKAGRVLGAFVGLSAVVKGLPLAYNKDLQEDKEPLLDALATYRDSLRLLAALLPGLKWRRERMWRAAE--GGYTLATELADYLAEKGLPFREAHHVVGRLVRRLVE-EGRALKDLTLEELQAHHPLFAEDALPLLRLETAIGTAPEAVRER.. 451
34 -85.7002hvg_A mol:protein length:482 Adenylosuccinate lyase  ali model follow..  19  22IDGRYKCGELSAFFSEHALIKHRIIVEVRWLLFLNEFEKVTDHSVEVLNQIATSDIARVKAIEEETNHDVKAVEYFVKEKLKKIKEYVHYLCTSEDINNVAYATCLKACLDVVIPCLEKIMLKLKDLAVEYSHVPLLSRTHGQPASSTTFGKEMANFYARIHHHVGVIRRVKVCAKFNGAVGNFNAHKVASKDIGLFLKKHFNLTYSIYCTQIQDHDYICELCDGLARANGTLIDLCVDIWLYISNNLLKLKVK--EKEVGSSTMPHKVNPIDFENAEGNLHIANAFFKLFSSKLPTSRLQRDLSDSTVLRNIGSSLAYCLIAYKSVLKGLNKIDIDRRNLEEELNQNWSTLAE---PIQIVMKRHNYVDAYEELKQFTRGKVI-DQKIMQEFIKTKCAFLPQDVVDQLLE-LTPATYTGYADYLAKNV.. 468
35 -80.5003rd8_A mol:protein length:489 Fumarate hydratase class II  ali model follow..  18  48AVENFP---ISFRGLERTQIRALGLLKAACAQVNKDLGLLDPEKADAIIAAAGEIAEGKHDDQFPIDNEVIASIAAANGVTVHPNDHVNMSQSSNDTFPTATHIAATEAARHLIPALEVLHASLAAKAKQWRTVVKSGRTHLMDAVPVTLGQEFGGYARQIEAGIERVKATLPRLGELAIGGTAVGTGGFGAKVVEVLVNETGLAELRTAEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGSGPLTGLAEIQPDLQPGSSIMPGKVNPVLPEAVTQVACQVVGNDAAIFGGASGAFELNVYIPMMARNLLESFTLLSNVSRLFAERCIDGLVANEERLRELAESSPSIVTP-------LNSAIGYEEAAKVAKQAL-----AEKKTIRQTVIDRGLIGDKLSLEELDRRLDVLAMARVKDG....... 482
36 -80.4006g3d_A mol:protein length:508 Argininosuccinate lyase  ali model follow..  17  21EFQELYDFDAAALTLTSAVFPYDSQIHRAHVVMLTEQGILTVEESATILSGLA----DELAATDGSLRTYLPYEAALKRTIGSVAGKMHIGRSRNDLANAGKRMFLRDQLLRTIEAVIGYREAVVHKAADHLDTVMVVYTQRKEAQPITLGHYLMAISENLAKNLDRYRELYARINLCPLGAAATAGTGWPLN-RDRTSALLGFDGLVVNEGVAGWDHVAEHAFVNAVFLSGLSRLASEIQLWSTDEYQVA-ELDASFAGTSSIMPQKKNPDSLERSRKAAFAAMGPLVGILTSL---NAIEYQYSAARVELEPRSIDALIAATHAMTGVVRTLHPNKERMRQYAAE--NYSTMTDLTDMLVRVGIDYREAHEIVAHVVITAIEKG-DLVQEAAVAQTGAGINVSADDIKDALDPWQNVMPAPMSVKAS.. 457
37 -75.9004hgv_A mol:protein length:495 Fumarate hydratase class II  ali model follow..  16  73.ALGIVKQAAARANMALGRLDPAIGDAIVKAAQEVIDGKLDEHFPLVVWQTGSGTQSNMNANEVVSNRAIELLGGVMGSKKVHPNDHVNMSQSSNDTYPTAMHIACARVIHDLLPALKHLHKALEEKVKAFDHIIKIGRTHTQDATPLTLGQEFSGYAAQVASSIKRIEMTLPGLCELAQGGAVGTGLNAPVGFAEKVAEEIA-SAPNKFEALAAHDSMVFSHGAINATAAALFKIANDIRFLGSGPRSGLGELSPENEPGSSIMPGKVNPTQCEALTQVCVQVFGNHAALTFAGSQHFELNVYNPLMAYNFLQSVQLLADAAISFTDNCVVGIEAREDNIKAALDRSLMLVTA-----------LAPKIGYDNAAKIAKTAHK-NGTTLREEAVGG----GYVTDEEFDAVVRPETMIGPA......... 489
38 -75.9001vdk_A mol:protein length:466 Fumarate hydratase class II  ali model follow..  17  37..........DRFRMPLEIIRAYGMLKKAAARANLELGELPEEIAKAIIQAAEEVVQGMNVNEVIANRASEILGKPLGSKYAHPNDHVNRGQSSNDTFPTAMYVAVALALQRLYPAVEGLIRTFTAKAQAFDQIVKVGRTHLMDAVPITLGQEIGSWAAQLKTTLAAVKEMEKGLYNLAIGGTAVGTGRFGELVAKYLAEETGLPAENRFAALAAHDELVNVMGAIRTLAGALMKIGNDVRWLASGPYAGIGEITPANEPGSSIMPGKVNPTQVEALTMVVVRVYGNHTVAFAGSQGNFQLNVYKPVMAYSTLESINLLADAVASFDAHLAQGIEPNLERIEEYLQKNPMLATA-------LNKAIGYDKAAEIVKKAL-----KEKKTLKQAALEL----GYLTEEEFDRIVVPMRLAKPHEG....... 465
39 -73.4005f91_A mol:protein length:495 Fumarate hydratase class II  ali model follow..  18  50AVENFP---ISGRGLERTQIRALGLLKGACAQVNSDLGLLAPEKADAIIAAAAEIADGIDVFQTGSGTSSNMNTNEIASIAAKGGVTLHPNDDVNMSQSSNDTFATEAAVAHLIPALQQLHDALAAKALDWHTVVKSGRTHLMDAVPVTLGQEFSGYARQIEAGIERVRACLPRLGELAIGGTAVGTGDFGVRVVAVLVAQTGLSELRTAEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGSGPLTGLAEIQPDLQPGSSIMPGKVNPVLPEAVTQVAAQVIGNDAAIAWGGANGAELNVYIPMMARNILESFKLLTNVSRLFAQRCIAGLTANVEHLRRLAES------SPSIVTPLNSA-IGYEEAAAVAKQAL-----KERKTIRQTVIDRGLIGDRLSIEDLDRRLDVLAMAKAEQLDSDRL.. 489
40 -72.6004adl_A mol:protein length:495 FUMARATE HYDRATASE CLASS II  ali model follow..  18  51AVENFP---ISGRGLERTQIRALGLLKGACAQVNSDLGLLAPEKADAIIAAAAEIADGIDVFQTGSGTSSNMNTNEIASIAAKGGVTLHPNSSNDTFPTATHIAATEAAVAHLIPALQQLHDALAAKALDWHTVVKSGRTHLMDAVPVTLGQEFSGYARQIEAGIERVRACLPRLGELAIGGTANAPDDFGVRVVAVLVAQTGLSELRTAEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGSGPLTGLAEIQPDLQPGSSIMPGKVNPVLPEAVTQVAAQVIGNDAAIAWGGANGAELNVYIPMMARNILESFKLLTNVSRLFAQRCIAGLTANVEHLRRLAES------SPSIVTPLNSA-IGYEEAAAVAKQAL-----KERKTIRQTVIDRGLIGDRLSIEDLDRRLDVLAMAKAEQLDSDR... 489
41 -71.7003rrp_A mol:protein length:471 Probable fumarate hydratase Fum  ali model follow..  19  36AVENFP---ISGRGLERTQIRALGLLKGACAQVNKDLGLLAAEKADAIIAAAQEIADGKTSSNMNANEVIASIAAQTPPVVVHPNDDVNMSQSSNDTFPTATHLAAEAAVRDLIPALEYLQQALATKAKAWKTVVKSGRTHLMDAVPVTLGQEFGGYARQIEAGIERVKATLPRLGELPIGGAVGTGLNAPDGFGAKVVEVLKQSASDSFEAQAARDGLVEGSGALKTIAASLTKIANDIRWMGSGPLTGLGEIQPDLQPGSSIMPGKVNPVLPEAVTQVAAQVIGNDAAIVGGLSGAFELNVYIPVMARNLLESFTLLANVSRLFVDKCVDGLVANEDHLRTLAESSPSIVTP-------LNSAIGYEEAAAVAKEAL-----KERKTIRQTVIDRGLIGDKLSIEELDKRLDVLAMAKVKD........ 471
42 -71.5003tv2_A mol:protein length:459 Fumarate hydratase, class II  ali model follow..  19  26.LQNFK---ISTEKQSPELIHALALIKRAAAAVNLELGVLAQDKANAIVAAADEIIANMNLNEVIANRASELLGGERESRAVHPNDDVNRGQSSNDVFPTAMHIAAARAIDHLLPALRTLRATLDAKAAAFADIVKIGRTHLQDATPLTLGQEFSGYVAQLDQGIRHVEAALPHLYELAQGGAVGTGLNFAAGVAAEIGRLTGLPAPNKFEVMAAADALVFAHGALKTVAASLMKIANDIRWLASGPRCGLGELIPENEPGSSIMPGKVNPTQSEAVTMLCCQVFGNDVAVNFGGASGNELNVFRPMIAHNVLQSVRLLADGAQGFNDHCAVGIEPNRARIDALLNESLMLVTA-----------LNPHIGYDKAAQIAKKAHK-EGTTLKAAALAL----GYVTDAQFDEWVRPEHMVGN.......... 458
43 -69.2003qbp_A mol:protein length:478 Fumarase Fum  ali model follow..  17  44AVENFP---ISGRGLERAQIRALGLLKGACAQVNMDLGLLAPEKAEAIIAAAAEIADGIDVFQTGSGTSSNMNTNEIASIAGANGVAVHPNDDVNMSQSSNDTFATEAAVSHLIPALEILQDALATKALEWQSVVKSGRTHLMDAVPVTLGQEFSGYARQIEAGIERVRATLPRLGELAIGGTAVGTGGFGVKVVSVLVSQTGLPQLRTAEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGSGPLTGLAEIQPDLQPGSSIMPGKVNPVLPEAVTQVAAQVIGNDAAVWGGANGAFELNVYIPMMARNILESFTLLTNVSKLFAQRCIAGLTANAEHLRELAESSPSIVTP-------LNSAIGYEEAAAVAKQAL-----KERKTIRQTVIDRGLIGDKLSLEELDRRLDVLAMAKVEAT....... 478
44 -68.6001fup_A mol:protein length:472 FUMARASE C  ali model follow..  20  35.........ISTEKMPTSLIHALALTKRAAAKVNEDLGLLSEEKASAIRQAADEVLANMNMNEVLANRASELLGGVRGMEKVHPNDDVNKSQSSNDVFPTAMHVAALLALKQLIPQLKTLTQTLNEKSRAFADIVKIGRTHLQDATPLTLGQEISGWVAMLEHNLKHIEYSLPHVAELALGGAVGTGLNTHPEYARRVADELAVIAPNKFEALATCDALVQAHGALKGLAASLMKIANDVRWLASGPRCGIGEISPENEPGSSIMPGKVNPTQCEALTMLCCQVMGNDVAINMGGASGNELNVFRPMVIHNFLQSVRLLADGMESFNKHCAVGIEPNRERINQLLNESLMLVTA-----------LNTHIGYDKAAEIAKKAHK-EGLTLKAAALAL----GYLSEAEFDSWVRPEQMVGSMKA....... 465
45 -67.5001yfm_A mol:protein length:488 FUMARASE  ali model follow..  18  72....HAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVV--TQSNMNANEVISNRAIEILGGKISKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGAVGTGLNFDVKIAEQISKETGLKFQTAPEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAIFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTA-----------LNPKIGYDAASKVAKNAHK-KGITLKESALEL----GVLTEKEFDEWVVPEHMLGP.......... 487
46 -65.4003e04_A mol:protein length:490 Fumarate hydratase  ali model follow..  18  68....KAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTTQTNMNVNEVISNRAIEMLGGELSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTANTRIGFAEKVAAKVAALTGLPFVTAPEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELIPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTA-----------LNPHIGYDKAAKIAKTAHK-NGSTLKETAIEL----GYLTAEQFDEWVKPKDMLG........... 482
47 -61.7003oce_A mol:protein length:474 Fumarate lyase:Delta crystallin  ali model follow..  15  40..........VALNHIPALVRALAMVKKAAATANYKLRQLPEPKYAAIVAACDDIIDNMNANEVIANRALEHLGRPRDYQTIHPNDDVNMSQSTNDVYPTAVRLALLLSQNQVQTALHRLIAAFEAKGREFATVIKIGRTQLQDAVPITLGQEFEAFAATLREDTARLEEVAALFREVNLGGTAIGTRINASH-AYAEQAIVELSQISLVEASWDTGAFVTFSGILRRIAVKLSKIANDLRLLSSGPRSGLGEIRPAVQPGSSIMPGKVNPVIPESVNQVCYQVIGNDLTVTMAAESGQLQLNAFEPLIVYNILSSMRLLGRAMTNLAECVDGIEANVERCRAGAE--ESISLATALVPVVGYARAAEKQALASGQTVMEVAISKG-----------------LDASALTIMLDPLRMAF........... 463
48 -60.1003ocf_A mol:protein length:478 Fumarate lyase:Delta crystallin  ali model follow..  15  51..........VALNHIPALVRALAMVKKAAATANYKLRQLPEPKYAAIVAACDDIIDNMNANEVIANRALEHLGRPRDYQTIHPNDDVNMSQSTNDVYPTAVRLALLLSQNQVQTALHRLIAAFEAKGREFATVIKIGRTQLQDAVPITLGQEFEAFAATLREDTARLEEVAALFREVNLGGTAIGTRAYAEQAIVELSQISGIELKATGEASWDTGAFVTFSGILRRIAVKLSKIANDLRLLSSGPRSGLGEIRPAVQPGSSIMPGKVNPVIPESVNQVCYQVIGNDLTVTMAAESGQLQLNAFEPLIVYNILSSMRLLGRAMTNLAECVDGIEANVERCRAGAE--ESISLATALVPVVGYARAAEKQALASGQTVMEVAISKG-----------------LDASALTIMLDPLR.............. 471
49 -58.5003gtd_A mol:protein length:482 Fumarate hydratase class II  ali model follow..  16  60.........IRALAILKKCAAQVNYEFGDLEYKIATSIDKAIDRILAGEFEDNFPLVVWQTGSGTASIANEELTGKKGKFPVHPNDHVNKGQSSNDSFPTAMHIATVLATQQLIPALNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGTANSKIGFDIKFAQKVAEFTQQPFKTAPESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLGSGPRCGLGELHPENEPGSSIMPGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTLRDKSLMLVTV-----------LNPHIGYDNAAKIAKEAHK-YGITLKEAAKKL----NFLSEEEFDKIVVPEKMIS........... 476
50 -57.2001j3u_A mol:protein length:468 aspartase  ali model follow..  15  31.TENFP---ITGYRIHPELIKSLGIVKKSAALANMEVGLLDKEVGQYIVKAADEVIENMNANEVIANRALELMGEEGNYSKISPNSHVNMSQSTNDAFPTATHIAVLSLLNQLIETTKYMQQEFMKKADEFAGVIKMGRTHLQDAVPILLGQEFEAYARVIARDIERIANTRNNLYDINMGAAVGTGLNADPEYISIVTEHLA-SAQHLVDATQNTDCYTEVSSALKVCMINMSKIANDLRLMASGPRAGLSEIVPARQPGSSIMPGKVNPVMPEVMNQVAFQVFGNDLTITSASEAGQFELNVMEPVLFFNLIQSISIMNVFKSFTENCLKGIKANEERMKEYVE--KSIGIITAINPHVGYETAAKREAYLTGESIRELCIKY----------------GVLTEEQLNEILNPYEMIHPG......... 463
51 -52.0001jsw_A mol:protein length:478 L-ASPARTATE AMMONIA-LYASE  ali model follow..  14  39..........NKISDIPEFVRGMVMVKKAAAMANKELQTIPKSVANAIIAACDEVLNNGKCMDQ-ANIGLELMGHQGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYSSLIKLVDAINQLREGFERKAVEFQDILKMGRTQLQDAVPMTLGQEFRAFSILLKEEVKNIQRTAELLLEVNLGATANTPKEYSPLAVKKLAEVTGFPCVPAEDATSDCGAYVMVHGALKRLAVKMSKICNDLRLLSSGPRAGLNEILPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVTMAAEAGQLQLNVMEPVIGQAMFESVHILTNACYNLLECINGITANKEVCEGYVY--NSIGIVTYLNPFI---------GHHNGDIVGKICAE-TGKSVREVVLER----GLLTEAELDDIFSVQNLMH........... 464

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 3 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.