current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [F] COG0015 Adenylosuccinate lyase, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MIERYTLPEMGKIWTDTYKLQTWLDVEIAVCEAQAELGYIPQAAVDEIKAKAKFDPQRVLEIEAEVRHDVIAFLTNVNEYVGDAGRYIHLGLTSSDVLDTALALQLVASLDLILEQLEKLIQAIRYQAQQHRYTVMVGRSHGIHAEPITFGFKLAGWLAEVLRNRDRLVRVAQSIAVGKISGAVGTYANIDPKVEAIACQKLGLEPDTASTQVISRDRHAEYVQQLALLAASLERFAVEIRNLQRTDVLEVEEYFSKGQKGSSAMPHKRNPIRSERLTGMARLVRGHAVAALENVALWHERDISHSSVERVAFPDCCILTHFMLKETTDLVKNLLVYPENMKRNMNVYGGVIFSQKVLLALVEKGMNREDAYRVVQGSAHQAWNTEGGNFEELVRADAQVTALLSAEEIDQCFDPQQHLTNLAEIYSRLDILast
1 -135.0001f1o_A mol:protein length:431 ADENYLOSUCCINATE LYASE  ali model follow..  55  1MIERYSRPEMSAIWTDENRFQAWLEVEILACEAWAELGVIPKEDVKVMRENASFDINRILEIEKDTRHDVVAFTRAVSESLGEERKWVHYGLTSTDVVDTALSYLLKQANDILLKDLERFVDIIKEKAKEHKYTVMMGRTHGVHAEPTTFGLKLALWHEEMKRNLERFKQAKAGIEVGKISGAVGTYANIDPFVEQYVCEKLGLKAAPISTQTLQRDRHADYMATLALIATSIEKFAVEIRGLQKSETREVEEFFAKGQKGSSAMPHKRNPIGSENMTGMARVIRGYMMTAYENVPLWHERDISHSSAERIILPDATIALNYMLNRFSNIVKNLTVFPENMKRNMDRTLGLIYSQRVLLALIDTGLTREEAYDTVQPKAMEAWE-KQVPFRELVEAEEKITSRLSPEKIADCFDYNYHLKNVDLIFERLGL 430
2 -135.0002x75_A mol:protein length:431 ADENYLOSUCCINATE LYASE  ali model follow..  51  1MIERYSREEMSNIWTDQNRYEAWLEVEILACEAWSELGHIPKADVQKIRQNAKVNVERAQEIEQETRHDVVAFTRQVSETLGEERKWVHYGLTSTDVVDTALSFVIKQANDIIEKDLERFIDVLAEKAKNYKYTLMMGRTHGVHAEPTTFGVKMALWYTEMQRNLQRFKQVREEIEVGKMSGAVGTFANIPPEIESYVCKHLGIGTAPVSTQTLQRDRHAYYIATLALIATSLEKFAVEIRNLQKTETREVEEAFAKGQKGSSAMPHKRNPIGSENITGISRVIRGYITTAYENVPLWHERDISHSSAERIMLPDVTIALDYALNRFTNIVDRLTVFEDNMRNNIDKTFGLIFSQRVLLALINKGMVREEAYDKVQPKAMISWE-TKTPFRELIEQDESITSVLTKEELDECFDPKHHLNQVDTIFERAGL 430
3 -134.0002pfm_A mol:protein length:444 Adenylosuccinate lyase  ali model follow..  53  4MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDVKKIREHASFDIDRIYEIEKETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTALSYILKQANEIILKDLENFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEMKRNVERFKQAANTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHAHYMSTLALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTGLARVIRGYMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYPENMKRNMTRTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWE-TQVQFKELVEADERITSKLTQEEINECFNYEHHMQHVDTIFERLGL 435
4 -134.0001c3u_A mol:protein length:431 ADENYLOSUCCINATE LYASE  ali model follow..  48  1MVERYSLSPMKDLWTEEAKYRRWLEVELAVTRAYEELGMIPKGVTERIRNNAKIDVELFKKIEEKTNHDVVAFVEGIGSMIGEDSRFFHYGLTSSDVLDTANSLALVEAGKILLESLKEFCDVLWEVANRYKHTPTIGRTHGVHAEPTSFGLKVLGWYSEMKRNVQRLERAIEEVSYGKISGAVGNYANVPPEVEEKALSYLGLKPEPVSTQVVPRDRHAFYLSTLAIVAAGIERIAVEIRHLQRTEVLEVEEPFRKGQRGSSAMPHKKNPITCERLTGLSRMMRAYVDPSLENIALWHERDISHSSVERYVFPDATQTLYYMIVTATNVVRNMKVNEERMKKNIDLTKGLVFSQRVLLKLIEKGLTRKEAYDIVQRNALKTWN-SEKHFLEYLLEDEEVKKLVTKEELEELFDISYYLKHVDHIFERF.. 428
5 -130.0004eei_A mol:protein length:438 Adenylosuccinate lyase  ali model follow..  38  1MIKRYDVAEISKIWADENKYAKMLEVELAILEAL-EDRMVPKGTAAEIRARAQIRPERVDEIEKVTKHDIIAFCTSIAEQFTAEGKFFHFGVTSSDIIDSALSLQIRDSMSYVIKDLEALCDSLLTKAEETKEIITMGRSHGMFAEPMSFGQKFLGAYVEFKRRLKDLKDFQKDGLTVQFSGAVGNYCILTTEDEKKAADILGLPVEEVSTQVIPRDRIAKLISIHGLIASAIERLAVEIRHLHRSDVFEVYEGFSKGQKGSSTMPHKKNPISTENLTGMARMLRSHVSIALENCVLWHERDISHSSAERFYLPDNFGIMVYALRRMKNTIDNLVVQRDIIEDRVRSTSAYLSSFYLHFLVANTPFMREDCYKIVQQVAFDLKQGESFSKKLQKVMHDEHNIILDIPEMDFEGIKKTYLKEIDHVFDRS.. 429
6 -114.0001dof_A mol:protein length:403 ADENYLOSUCCINATE LYASE  ali model follow..  33  6FDWRYGSEEIRRLFTNEAIINAYLEVERALVCALEELGVAERGCCEKVN-KASVSADEVYRLERETGHDILSLVLLLEQKSG--CRYVHYGATSNDIIDTAWALLIRRALAAVKEKARAVGDQLASMARKYKTLEMVGRTHGQWAEPITLGFKFANYYYELYIACRQLALAEE-FIRAKIGGAVGTMASLGLEVRRRVAERLGLPHHVITTQVAPRESFAVLASALALMAAVFERLAVEIRELSRPEIGEVVE----GGGGSSAMPHKANPTASERIVSLARYVRALTHVAFENVALWHERDLTNSANERVWIPEALLALDEILTSALRVLKNVYIDEERITENLQKALPYILTEFHMNRMIKEGASRAEAYKKAKEVKALTFE-YQKWPVERLIEDALSLKLC........................... 403
7 -99.3003c8t_A mol:protein length:451 Fumarate lyase  ali model follow..  29  10..RSFADDKMRELFSAQSFISRCVETEVALARAQARLGIIPEDAAAGITAAARPEMERLRDDTEIVGYPILPLVEQLSAHAGEAGKYLHWGATTQDIMDTATVLQIRDGLALISRRIESVRKALAALARNHRDTPMAGRTHLQHALPVTFGYKAAVWLSAFDRHAARLEEISPRVLVVEFSGASGTLASLGTRVQRELARELNLGVPSITWHS-ARDAVAETVQFLALVSGSLGKLAMDISIMMTTELGEVAEPFVRHRGASSTMPQKQNPVSCELILAGARIVRNHATSMLDAMIHDFERATGPWHLEWSAVPEGFAVASGILYQAEFMLGGLQVFPDRMRENLDHSRGLIVAEAVMMALAPH-TGRKEAHDIVYLGCRRAVE-DKTGLFEVLRTMPEVAKPLGEEALRDLTDPRNYLGSAGAMVDNV.. 439
8 -96.9001q5n_A mol:protein length:454 3-carboxy-cis,cis-muconate cycloisomerase  ali model follow..  28  10..SLFYQRDVTEIFSDRALVSYMVEAEVALAQAQAQVGVIPQSAATVIQRAAKIDFDALATATGLAGNIAIPFVKQLTAIVKDAARYVHWGATSQDILDTACILQCRDALAIVQNQVQQCYETALSQAQTYRHQVMMGRTWLQQALPITLGHKLARWASAFKRDLDRINAIKARVLVAQLGGAVGSLASLQDQVVEAYAKQLKLGQTACTWHG-ERDRIVEIASVLGIITGNVGKMARDWSLMMQTEIAEVFEPTAKGRGGSSTMPHKRNPVAAASVLAAANRVPALMSSIYQSMVQEHERSLGAWHAEWLSLPEIFQLTAGALERTLDVLKGMEVNAENMHQNIECTHGLIMAEAVMMALAPH-MGRLNAHHVVEAACKTAVA-EQKHLKDIISQVDEVKQYFNPSQLDEIFKPESYLGNIQDQIDAV.. 445
9 -96.8001re5_A mol:protein length:450 3-carboxy-cis,cis-muconate cycloisomerase  ali model follow..  32  8..AYFTAPAMREIFSDRGRLQGMLDFEAALARAEASAGLVPHSAVAAIEAACQYDTGALANAIATAGNSAIPLVKALGKVIPEAERYVHLGATSQDAMDTGLVLQLRDALDLIEADLGKLADTLSQQALKHADTPLVGRTWLQHATPVTLGMKLAGVLGALTRHRQRLQELRPRLLVLQFGGASGSLAALGSPVAEALAEQLKLTLPEQPWHT-QRDRLVEFASVLGLVAGSLGKFGRDISLLMQTEAGEVFEPSAPGKGGSSTMPHKRNPVGAAVLIGAATRVPGLLSTLFAAMPQEHERSLGLWHAEWETLPDICCLVSGALRQAQVIAEGMEVDAARMRRNLDLTQGLVLAEAVSIVLAQR-LGRDRAHHLLEQCCQRAVA-EQRHLRAVLGDEPQVSAELSGEELDRLLDPAHYLGQARVWVARA.. 441
10 -74.7002j91_A mol:protein length:503 ADENYLOSUCCINATE LYASE  ali model follow..  27  33LASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLITDEQIREMKSNLNIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQQLDKMVTEKAGFKRAIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLK--EMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAAEGGDNDLIERIQVDAYFS--PIHSQLDHLLDPSSFTGRASQQVQRF.. 476
11 -73.6004ffx_A mol:protein length:487 Adenylosuccinate lyase  ali model follow..  27  20LASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLITDEQIREMKSNLNIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQQLDKMVTEKAGFKRAIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLK--EMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAAEGGDNDLIERIQVDAYFS--PIHSQLDHLLDPSSFTGRASQQVQRF.. 463
12 -72.1001yis_A mol:protein length:478 adenylosuccinate lyase  ali model follow..  26  11LSTRYCKNSLVSILSETNKATLWRQLWIWLAEAEKELGLVTQDAIDEMKSNRDFDWPFIRSEERKLKHDVMAHNHAFGKLCPTAAGIIHLGATSCFVQDNADLIAYRDSIDHILKRFATVIDRLAAFSLKNKEVVTVGRTHYQTASLVTVGKRGVLWAQELLMAFQSLSEFRDKMRFRGIKGATGTQDSFLTALDELVTKKANFSNRLITGQTYSRQQDSQLVFSLSLLGAAAKKVCTDIRVLQAFG--ELLEPFEKDQIGSSAMPYKKNPMKSERCCALSRKLINAPQEALTILADGLERTLDDSAGRRMLIPDVLLTAEALLTTLQNIFEGLSVQTDNVKKIVEDEIAFLGLEKAMMMLTEEGVDRQQAHAVIRKTALEAKQATQKVDIRQTMADPFF-DSVRDRVVGLVNNPINFTGRCVSQTESF.. 454
13 -59.1002fel_A mol:protein length:359 3-carboxy-cis,cis-muconate lactonizing enzyme  ali model follow..  24  15....FGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSADMSALRHGVAKDGVVVPELIRQMRAAVAGQADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNVRADLAKRLGLADR--PQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIG----SEIRLSGGGGSSAMPHKQNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLL----VAERLAAQIDRLGADE...................................................................................... 352
14 -58.5004nle_A mol:protein length:488 Adenylosuccinate lyase  ali model follow..  27  17LANRYASDEMVAIWSPEAKIIAERRLWLAVLRAQAELGVVPDGVVEDYERVLNVDLESIAARERVTRHDVKARIEEFNALAGHE--HVHKGMTSRDLTENVEQLQIRQSLELVFSHGVAVVARLAERAVVYRDLVMAGRSHNVAAQATTLGKRFASAAEETLVALTRLRELIDRYPLRGVKGPMGTAQDM-ADLERRVAEFLGFTEVTSVGQVYPRSLDHDVLSALVQFGAGPSSMAHTIRLMAGHE--LVTEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLRGYASMAAELAG-WNEGDVFCSVVRRVALPDAFFAIDGQTETFLTVLDEFGAYPAVIQRELDRYLPFLATTRILMAAVRAGVGREAAHEVIKEHAVAV-QGREPDLIDRLAGDPRLP--LDKVALEAALE................. 443
15 -31.2003gzh_A mol:protein length:482 Adenylosuccinate lyase  ali model follow..  25  33...RYGDKALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAARIKTIERTTNHDVKAVEYFLKEKLHAVSEFIHFACTSEDINNLSHALMLKTARDVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVE----LGKINGAVGNYAHI-PEVDEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDV---GYIALNHFKQKTIAGEIGSSTMPHKVNPIDFEN-LGLSNAVLQHLASKLP-VSRW-QRDLTDSTVLRNL-----VGIGYALIAYQSTVSKLEVNRDHLLDELDHNWEVL-AEPIQTVMRRYGI--EKPYEKLKELTRRVDAEGMKQFIDGLALPEEEKARLKA......................... 456
16 -31.1002hvg_A mol:protein length:482 Adenylosuccinate lyase  ali model follow..  22  25...RYKKAELSAFFSEHALIKHRIIVEVRWLLFLNEEELFFEKVTDHSVEVLN-DIARVKAIEEETNHDVKAVEYFVKEKLLKIKEYVHYLCTSEDINNVAYATCLKACLNVVIPCLEKIMLKLKDLAVEYSHVPLLSRTHGQPASSTTFGKEMANFYARIHHHVGVIRRVK----CAKFNGAVGNFTDWVNTIGLFLKKHFNLTYSIYCTQIQDHDYICELCDGLARANGTLIDLCVDI---LYISNNLLKLKVKEKEVGSSTMPHKVNPIDFENAEGNLHIANAFFKLFSSKLPT--QRDLSDSTVLRNI-----SSLAYCLIAYKSVLNKIDIDRRNLEEELNQNWSTL-AEPIQIVMKRHNY--VDAYEELKQFT.................................................... 420
17 -30.5004nsl_A mol:protein length:470 Adenylosuccinate lyase  ali model follow..  23  23...RYGDKALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPATLVANFNEEDAARIKTIERTTNHDVKAVEYFLKEKLHDVSEFIHFACTSEDINNLSHALMLKTARDVILPYWRQVINAVKDLATQYRDIPLLSRTHGQPATPSTLGKEMANVAYRMERQFRQLNQVE----LGKINGAVGNY----PEVDEEFVTSLGIQWNPYTTQIEPHDYIAELFDCIARFNTILIDFDRDV---GYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLHHLANKLPV--QRDLTDSTVLRNL-----VGIGYALIAYQSTVSKLEVNRDHLLDELDHNWEVL-AEPIQTVMRRYGI--EKPYEKLKELTKRVDAEGMKQFIDSLALPEAEKTRL........................... 444
18 -30.5004mx2_A mol:protein length:480 Adenylosuccinate lyase  ali model follow..  21  41...RYKRDPLRAYFSEYALFKYRVQVEVLYFEALCQLRGVTDAQLGELRATAVDDAKIIKGIEAVTNHDIKAVEYYLKDKLEAEKEFIHFGLTSQDINNTSIPMLLRDALHHYIPTLDQLIALLKSKLPEW-DVPMLARTHGQPASPTNLAKEFMVWIERLEEQRTMLLSIP----TGKFGGATGNFVNWLDFGELFLSKYLGLRRQRYTTQIEHYDNLAAICDACARLHTILMDLAKDV---QYISLGYFDQKVRAGEVGSSAMPHKVNPIDFENAEGNLGMSNAVLGFLSAKLPI--QRDLTDSTVLRNLGVPLSHAL-IAFASLRRGIDKLLLNKDVIASDLEGNWAVV-AEGIQTVLRREGY--PKPYEALKDLTRGNAHVTEETVHRFVQQLEGITEEVRQE........................ 464
19 -30.4003bhg_A mol:protein length:459 Adenylosuccinate lyase  ali model follow..  22  18...RYVNKALSPYFSEFALTYYRLMVEIKWFESLAANDTIPEVPADLISNFNESEAEKIKEFEKQTNHDVKAVEYYLQDKLKSCVAFIHFACTSEDINNLAYALMIKQAIAVIQPTIAEIMGSITLLGKQHADVAMLSRTHGQPATPTTMGKELVNFVARLKRPQQQLAEVL----PAKFNGAVGNY----PEVDANFVTSLGLSFNAYTTQIEPHDGIAEVSQIMVRINNILLDYTQDI---SYISLGYFKQKTIAEEVGSSTMPHKVNPIDFENAEGNLGLSNALFIHFANKLTQ--QRDLSDSTVLRNL-----VAFSYSLIAYHSVNDKLQINKSALQKDLSENWEVL-AEAIQTVMRRYNE--PNAYEQLKELTQMIDAENLKKFIKTLSIPEEAKAEL........................... 439
20 -30.3002ptq_A mol:protein length:462 Adenylosuccinate lyase  ali model follow..  22  15...RYGDKALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAARIKTIERTTNHDVKAVEYFLKEKLHAVSEFIHFACTSEDINNLSHALMLKTARDVILPYWRQLIDGLKDLAVQYRDIPLLSRTNGQPATPSTIGKEMANVAYRMERQYRQLNQVE----LGKINGAVGNY----PEVDEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDV---GYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEGNLGLSNAVLQHLASKLPV--QRDLTDSTVLRNL-----VGIGYALIAYQSTVSKLEVNRDHLLDELDHNWEVL-AEPIQTVMRRYGIEKPYEKLKELTRGKRVDAEGMKQFIDGLALPEEEKARL........................... 436
21 -30.1004efc_A mol:protein length:472 Adenylosuccinate lyase  ali model follow..  19  30...RYKRQALRAFFSEYGFFRYRVLVEVALCKDVPTIVPLRSVTDEQLQKLRKISAEEIKRLERVTNHDIKAVEYFIKERLSHVTEFVHFGLTSQDINNTAIPMMIRDAIVLYLPALDGIIGSLTSKLVDW-DVPMLARTHGQPASPTNLAKEFVVWIERLREQRRQLCEVP----TGKFGGATGNFVNWRAFADMFLAKYLGLKRQQATTQIENYDHLAALCDACARLHVILIDMCRDV---QYISMGFFKQKVKEGEVGSSTMPHKVNPIDFENAEGNLALSNALLNFFASKLPI--QRDLTDSTVLRNLGVPIGHAC-VAFASISQGLEKLMISRETISRELSSNWAVV-AEGIQTVLRRECY--PKPYETLKKLTQGNTDVTEEQVRNFINGLTDISDDVRAE........................ 453
22 -27.1001tj7_A mol:protein length:457 Argininosuccinate lyase  ali model follow..  19  21..........DSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEEALNVLLEDVRQILESDAEDIHSWVEGLIDKVGQLGKKLHTGRSRNDQVATDLKLWCKDTVSELLTANRQLQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPL-GCGALAGTAYEIDREQLAGWLGFASATRNSSVSDRDHVLELLSAAAIGMVHLSRFAEDL-NTGEAGFVELSDRVTS---GSSLMPQKKNPDALELIRGKCGRVQGAMMMTLKGLPLAYNKDMQE---DKEGLFDALDTWLDCLHMAALVLDGIQVKRPRCQEAAQQ--GYANATELADYLVAKGVPFREAHHIVGEAVVEAIR-QGKPLEDLPLSELQKFSQVIDEDVYPILSLQSCLDK.......... 433
23 -26.8001xwo_A mol:protein length:465 Delta crystallin  ali model follow..  20  25..........TSMSTEQRLSEVDIQASIAYAKALEKAGILTKTELEKI-------LSGLEKISEEWSKGVFVVTRRLKELIGDIAGKLNTGRSRNEQVVTDLKLFMKNSLSVISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKRRINVLPL-GSGALAGNPLDIDREMLRSELDFASISLNSAISERDFVVEFLSVATLLMIHLSKMAEDLIIYSTSEFLTLSDAFST---GSSLMPQKKNPDSLELIRSKAGRVFGRLLMVLKGLPSTYNKDLQE---DKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTP----MLSTDLALYLVRKGMPFRQAHTASGKAVHLA-ETKGITINNLTLEDLKSISPLFSSDVSQVFNFVNSVEQYTAM...... 439
24 -26.7001i0a_A mol:protein length:466 DELTA CRYSTALLIN I  ali model follow..  20  26..........SSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKI-------LSGLEKISEESSKGVLVMTRRLKELIGDIAGKLQTGRSRNEQVVTDLKLLLKSSISVISTHLLQLIKTLVERAAIEIDIIMPGYTHLQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPL-GSGVLAGNPLEIDRELLRSELDMTSITLNSAISERDFVVELISVATLLMIHLSKLAEDLIIFSTTEFVTLSDAYST---GSSLLPQKKNPDSLELIRSKAGRVFGRLLMVLKGIPSTFSKDLQE---DKEAVLDVVDTLTAVLQVATGVISTLQINKENMEKALTP----LLSTDLALYLVRKGMPIRQAQTASGKAVHLA-ETKGITINNLTLEDLKSISPLFASDVSQVFSVVNSVEQYTAV...... 440
25 -26.7001tju_A mol:protein length:474 Delta crystallin II  ali model follow..  20  28..........SSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKI-------LSGLEKISEEWSKGVFVVKRRLKELIGDIAGKLHTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYSHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPL-GSGALAGNPLDIDREMLRSELEFASISLNSAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFLTLSDAFST---GSSLMPQKKNPDSLELIRSKAGRVFGRLLMVLKGLPSTYNKDLQE---DKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTP----MLATDLALYLVRKGVPFRQAHTASGKAVHLA-ETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTAL...... 442
26 -26.7001hy0_A mol:protein length:466 DELTA CRYSTALLIN I  ali model follow..  21  26..........TSISTEQRLSEVDIQASIAYAKALEKAGILTKTELEKI-------LSGLEKISEELSKGVIVVTRRLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPL-GSGALAGNPLDIDREMLRSELEFASISLNSAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFLTLSDAFST---GSSLMPQKKNPDSLELIRSKSGRVFGRLLMVLKGLPSTYNKDLQE---DKEAVIDVVDTLTAVLQVATGVISTLQISKENMEKALTP----MLATDLALYLVRKGMPFRQAHTASGKAVHLA-ETKGIAINNLTLEDLKSISPLFSSDVSQVFNFVNSVEQYTAL...... 440
27 -26.7001u15_A mol:protein length:472 Delta crystallin I  ali model follow..  21  26..........SSIAYDQRLSEVDIQASIAYAKALEKAGILTKTELEKI-------LSGLEKISEEWSKGVFVVKRRLKELIGDIAGKLHTGRSRNEQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTHLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPL-GSGALAGNPLDIDREMLRSELEFASISLNSAISERDFVVEFLSVATLLLIHLSKMAEDLIIYSTSEFLTLSDAFST---GSSLMPQKKNPDSLELIRSKAGRVFGRLLMVLKGLPSTYNKDLQE---DKEAVIDVVDTLTAVLQVATGVISTLQISKENMEKALTP----MLATDLALYLVRKGMPFRQAHTASGKAVHLA-ETKGIAINNLTLEDLKSISPLFSSDVSQVFNFVNSVEQYTAL...... 440
28 -26.6001aos_A mol:protein length:464 ARGININOSUCCINATE LYASE  ali model follow..  19  26..........ASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQI-------LHGLDKVAEEWAQGTFKLNRRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPL-GSGAIAGNPLGVDRELLRAELNFGAITLNSATSERDFVAEFLFWRSLCMTHLSRMAEDLILYCTKEFVQLSDAYST---GSSLMPQKKNPDSLELIRSKAGRVFGRCLMTLKGLPSTYNKDLQE---DKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSP----MLATDLAYYLVRKGMPFRQAHEASGKAVFMA-ETKGVALNQLSLQELQTISPLFSGDVICVWDYRHSVEQYGAL...... 440
29 -26.4001dcn_A mol:protein length:447 DELTA 2 CRYSTALLIN  ali model follow..  19  4IMEKLN----SSIAYDQRLSEVDIQGSMAYAKALEKAGILTKTELEKI-------LSGLEKISEEWSKGVFVVKRRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLQLIKTLVERAAIEIDVILPGYTNLQKAQPIRWSQFLLSHAVALTRDSERLGEVKKRINVLPL-GSGALAGNPLDIDREMLRSELEFASISLNSAISERDFVVEFLSFATLLMIHLSKMAEDLIIYSTSEFLTLSDAFST---GSSLMPQKKNPDSLELIRSKSGRVFGRLLMVLKGLPSTYNKDLQE---DKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTP----MLATDLALYLVRKGVPFRQAHTASGKAVHLA-ETKGITINNLSLEDLKSISPQFSSDVSQVFNFVNSVEQYTAL...... 424
30 -25.8002e9f_A mol:protein length:462 Argininosuccinate lyase  ali model follow..  20  23..........ASLAFDRALWREDLWQNRVHARMLHAVGLLSAEELEAILKGLDRIEEEIEAGTREELEDVMNLEARLTELVGPPGGKLHTARSRNDQVATDLRLYLRGAIDELLALLLALRRVLVREAEKHLDPLYVGYTHLQRAQPVLLAHWFLAYYEMLKRDAGRLEDAKERLNESPL-GAAALAGTGFPIDRHFTARELGFKAPMRNSAVASRDFALEVLSALNIGMLHLSRMAEEL-STEEFGFVEVPDAFAT---GSSIMPQKKNPDILELIRAKAGRVLGALSAVVKGLPLAYNKDLQE---DKEPLLDALATYRDSLRLLAALLPGLKWRRERMWRAAEG--GYTLATELADYLAEKGLPFREAHHVVGRLVRRLVE-EGRALKDLTLEELQAHHPLFAEDALPLLRLETAIHR.......... 436
31 -23.3003rrp_A mol:protein length:471 Probable fumarate hydratase Fum  ali model follow..  21  58.........................LKGACAQVNKDLGLLAAEKADAIIAAA----QEIADGKHDDQFPIDVFQTNANEVIASIAADVNMSQSSNDTFPTATHLATEAAVRDLIPALEYLQQALATKAKAWKTVVKSGRTHLMDAVPVTLGQEFGGYARQIEAGIERVKATLPRLGELPIGGAVGTGLNAPDGFGAKVVEVLKKTASDSFEAQAARDGLVEGSGALKTIAASLTKIANDIRWMPLTGLGEIQ--LPDLQPGSSIMPGKVNPVLPEAVTQVAQVIGNDAAITVGGLSGAFELNVYIPVMARNLLESFTLLANVSRLFVDKCVDGLVANEDHLRTLAESSPSIV-----------TPLNSAIGYEEAAAVAKEALK-ERKTIRQTVIDRGLIGDKLSIEELDKRLDVLAMAKVKD........ 471
32 -23.3003rd8_A mol:protein length:489 Fumarate hydratase class II  ali model follow..  21  70.........................LKAACAQVNKDLGLLDPEKADAIIAAAGEIAE-VFQTGSGTSNEVIASIAAANGVTVHPNDHVNMSQSSNDTFPTATHIATEAAVRHLIPALEVLHASLAAKAKQWRTVVKSGRTHLMDAVPVTLGQEFGGYARQIEAGIERVKATLPRLGELAIGGAVGTGLNAPEGFGAKVVEVLVRTAVDSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMPLTGLAEIQ--LPDLQPGSSIMPGKVNPVLPEAVTQVCQVVGNDAAIAFGGASGAFELNVYIPMMARNLLESFTLLSNVSRLFAERCIDGLVANEERLRELAESSPSIV-----------TPLNSAIGYEEAAKVAKQALA-EKKTIRQTVIDRGLIGDKLSLEELDRRLDVLAMAR........... 478
33 -23.1003qbp_A mol:protein length:478 Fumarase Fum  ali model follow..  21  66.........................LKGACAQVNMDLGLLAPEKAEAIIAAAAEIAD-VFQTGSGTSNEVIASIAGANGVAVHPNDDVNMSQSSNDTFPTATHIATEAAVSHLIPALEILQDALATKALEWQSVVKSGRTHLMDAVPVTLGQEFSGYARQIEAGIERVRATLPRLGELAIGGAVGTGLNAPEGFGVKVVSVLVRTAANSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMPLTGLAEIQ--LPDLQPGSSIMPGKVNPVLPEAVTQVAQVIGNDAAVAWGGANGAFELNVYIPMMARNILESFTLLTNVSKLFAQRCIAGLTANAEHLRELAESSPSIV-----------TPLNSAIGYEEAAAVAKQALK-ERKTIRQTVIDRGLIGDKLSLEELDRRLDVLAMAK........... 474
34 -22.5004adl_A mol:protein length:495 FUMARATE HYDRATASE CLASS II  ali model follow..  21  73.........................LKGACAQVNSDLGLLAPEKADAIIAAAAEIAD-VFQTGSGTSNEVIASIAAKGGVTLHPNDDVNMSQSSNDTFPTATHIATEAAVAHLIPALQQLHDALAAKALDWHTVVKSGRTHLMDAVPVTLGQEFSGYARQIEAGIERVRACLPRLGELAIGGAVGTGLNAPDDFGVRVVAVLVRTAANSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMPLTGLAEIQ--LPDLQPGSSIMPGKVNPVLPEAVTQVAQVIGNDAAIAWGGANGAFELNVYIPMMARNILESFKLLTNVSRLFAQRCIAGLTANVEHLRRLAESSPSIV-----------TPLNSAIGYEEAAAVAKQALK-ERKTIRQTVIDRGLIGDRLSIEDLDRRLDVLAMAK........... 481
35 -20.6003gtd_A mol:protein length:482 Fumarate hydratase class II  ali model follow..  17  66.........................LKKCAAQVNYEFGDLEYKIATSIDKAIDRILANMNEVIASIANEELTGKKGGKFPVHPNDH-VNKGQSSNDSFPTAMHIAVLATKQQLIPALNNLLTYLQDKSKDWDKIIKIGRTHLQDATPLTLKQEFSGYITQIEYALERIEDALKKVYLLAQGGAVGTGINSKIGFDIKFAQKVAKTAPNKFESLAAHDALVEFSGTLNTIAVSLMKIANDIRLLPRCGLGELH--LPENEPGSSIMPGKVNPTQVEALTMVCTQVMGNHVTVTIAGSNGHELNVFKPVIIYNILQSIELLSDSVNSFVTHCVKGLEPNIARINTLRDKSLMLVTVLNPHIGYDNAAKIAKEAHKTLKEAAKKLNFLSEEEFDKIVVPEKMIS.............................. 476
36 -20.3001vdk_A mol:protein length:466 Fumarate hydratase class II  ali model follow..  19  52.........................LKKAAARANLELGELPEEIAKAIIQAA----EEVVQGKWDDHFPLVVFQTNVNEVIANRA--VNRGQSSNDTFPTAMYVAALALHQRLYPAVEGLIRTFTAKAQAFDQIVKVGRTHLMDAVPITLGQEIGSWAAQLKTTLAAVKEMEKGLYNLAIGGAVGTGLNAHPRFGELVAKYLARVAENRFAALAAHDELVNVMGAIRTLAGALMKIGNDVRWLPYAGIGEIT--IPANEPGSSIMPGKVNPTQVEALTMVVRVYGNDHTVAFAGSQGNFQLNVYKPVMAYSTLESINLLADAVASFDAHLAQGIEPNLERIEEYLQKNPMLATALNKAIGYDKAAEIVKKALKTLKQAALELGYLTEEEFDRIVVPMRLA............................... 460
37 -20.1004hgv_A mol:protein length:495 Fumarate hydratase class II  ali model follow..  18  77.........................VKQAAARANMALGRLDPAIGDAIVKAAQEVIDNANEVVSNRAIELLGGVMGSKKPVHPNDH-VNMSQSSNDTYPTAMHIAAERVIHDLLPALKHLHKALEEKVKAFDHIIKIGRTHTQDATPLTLGQEFSGYAAQVASSIKRIEMTLPGLCELAQGGAVGTGLNAPVGFAEKVAEEIATSAPNKFEALAAHDSMVFSHGAINATAAALFKIANDIRFLPRSGLGELS--LPENEPGSSIMPGKVNPTQCEALTQVVQVFGNHAALTFAGSQGHFELNVYNPLMAYNFLQSVQLLADAAISFTDNCVVGIEAREDNIKAALDRSLMLVTALAPKIGYDNAAKIAKTAHKTLREEAVGGGYVTDEEFDAVVRPETMI............................... 486
38 -20.1001fup_A mol:protein length:472 FUMARASE C  ali model follow..  21  51.........................TKRAAAKVNEDLGLLSEEKASAIRQAADEVLANMNEVLANRASELLGGVRGMERKVHPNDD-VNKSQSSNDVFPTAMHVALLALRKQLIPQLKTLTQTLNEKSRAFADIVKIGRTHLQDATPLTLGQEISGWVAMLEHNLKHIEYSLPHVAELALGGAVGTGLNTHPEYARRVADELAVTAPNKFEALATCDALVQAHGALKGLAASLMKIANDVRWLPRCGIGEIS--IPENEPGSSIMPGKVNPTQCEALTMLCCQVMGNDVAINMGGASGNELNVFRPMVIHNFLQSVRLLADGMESFNKHCAVGIEPNRERINQLLNESLMLVTALNTHIGYDKAAEIAKKAHKTLKAAALALGYLSEAEFDSWVRPEQMV............................... 460
39 -19.9003tv2_A mol:protein length:459 Fumarate hydratase, class II  ali model follow..  21  47.........................IKRAAAAVNLELGVLAQDKANAIVAAADEIIANLNEVIANRASELLGGERGESRAVHPNDD-VNRGQSSNDVFPTAMHIAARAIVDHLLPALRTLRATLDAKAAAFADIVKIGRTHLQDATPLTLGQEFSGYVAQLDQGIRHVEAALPHLYELAQGGAVGTGLNAHPKFAAGVAAEIGVSAPNKFEVMAAADALVFAHGALKTVAASLMKIANDIRWLPRCGLGELS--IPENEPGSSIMPGKVNPTQSEAVTMLCCQVFGNDVAVNFGGASGNELNVFRPMIAHNVLQSVRLLADGAQGFNDHCAVGIEPNRARIDALLNESLMLVTALNPHIGYDKAAQIAKKAHKTLKAAALALGYVTDAQFDEWVRPEHMV............................... 456
40 -19.6001yfm_A mol:protein length:488 FUMARASE  ali model follow..  18  77.........................LKKSAAIVNESLGGLDPKISKAIQQAA----DEVASGKLDDHFPLVVFQTNANEVISNRA-HCNQSQSSNDTFPTVMHIASLQIQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGAVGTGLNTKPGFDVKIAEQISQTAPNRFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLPRCGYHELM--LPENEPGSSIMPGKVNPTQNEALTQVVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKTLKESALELGVLTEKEFDEWVVPEHML............................... 485
41 -19.4003e04_A mol:protein length:490 Fumarate hydratase  ali model follow..  20  126.........................................................NVNEVISNRAIEMLGGELGSKIPVHPNDH-VNKSQSSNDTFPTAMHIAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGAVGTGLNTRIGFAEKVAAKVAVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLPRSGLGELI--LPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKTLKETAIELGYLTAEQFDEWVKPKDML............................... 481
42 -19.2001j3u_A mol:protein length:468 aspartase  ali model follow..  18  46...................IKSLGIVKKSAALANMEVGLLDKEVGQYIVKAADFIVDPIQ---NMNANEVIA--NRALELMGEEKSHVNMSQSTNDAFPTATHIAVLSLLNQLIETTKYMQQEFMKKADEFAGVIKMGRTHLQDAVPILLGQEFEAYARVIARDIERIANTRNNLYDINMGAAVGTGLNADPEYISIVTEHLARSAQHLVDATQNTDCYTEVSSALKVCMINMSKIANDLRLMARAGLSEIV--LPARQPGSSIMPGKVNPVMPEVMNQVAQVFGNDLTITSASEAGQFELNVMEPVLFFNLIQSISIMTNVFKSFTENCLKGIKANEERMKEYVEKSIGII-------TAINPHVGYETAAKLAREAYLTGESIRELCIKYGVLTEEQLNEILNPYEM...................... 459
43 -18.7001jsw_A mol:protein length:478 L-ASPARTATE AMMONIA-LYASE  ali model follow..  16  48...................VRGMVMVKKAAAMANKELQTIPKSVANAIIAACDFPVDVYQ---NMNTNEVLA--NIGLELMGHQKDHVNKCQSTNDAYPTGFRIAVYSSLIKLVDAINQLREGFERKAVEFQDILKMGRTQLQDAVPMTLGQEFRAFSILLKEEVKNIQRTAELLLEVNLGAAIGTGLNTPKEYSPLAVKKLAVPAEDLIEATSDCGAYVMVHGALKRLAVKMSKICNDLRLLSRAGLNEIN--LPELQAGSSIMPAKVNPVVPEVVNQVCKVIGNDTTVTMAAEAGQLQLNVMEPVIGQAMFESVHILTNACYNLLEKCINGITANKEVCEGYVYNSIGIV-------TYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAELDDIFSVQNL...................... 462
44 -18.6003ocf_A mol:protein length:478 Fumarate lyase:Delta crystallin  ali model follow..  18  66.........................VKKAAATANYKLRQLPEPKYAAIVAACDFVVDVFQ---NMNANEVIA--NRALEHLGRPRDDVNMSQSTNDVYPTAVRLALLLSQNQVQTALHRLIAAFEAKGREFATVIKIGRTQLQDAVPITLGQEFEAFAATLREDTARLEEVAALFREVNLGGAIGTRINASHAYAEQAIVELSKATGNLVEASWDTGAFVTFSGILRRIAVKLSKIANDLRLLSRSGLGEIR--LPAVQPGSSIMPGKVNPVIPESVNQVCQVIGNDLTVTMAAESGQLQLNAFEPLIVYNILSSMRLLGRAMTNLAERCVDGIEANVERCRAGAEESISLATALVPVVGYARAAEIAKQALA------------SGQTVMEVA-----ISKGLDASALTIMLDPL............... 470
45 -18.5003oce_A mol:protein length:474 Fumarate lyase:Delta crystallin  ali model follow..  18  55.........................VKKAAATANYKLRQLPEPKYAAIVAACDFVVDVFQ---NMNANEVIA--NRALEHLGRPRDDVNMSQSTNDVYPTAVRLALLLSQNQVQTALHRLIAAFEAKGREFATVIKIGRTQLQDAVPITLGQEFEAFAATLREDTARLEEVAALFREVNLGGAIGTRINASHAYAEQAIVELSKATGNLVEASWDTGAFVTFSGILRRIAVKLSKIANDLRLLSRSGLGEIR--LPAVQPGSSIMPGKVNPVIPESVNQVCQVIGNDLTVTMAAESGQLQLNAFEPLIVYNILSSMRLLGRAMTNLAERCVDGIEANVERCRAGAEESISLATALVPVVGYARAAEIAKQALA------------SGQTVMEVA-----ISKGLDASALTIMLDPLRMAF........... 463

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.