current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MREQLEALRDDAIKKIEQAQEKKVVQEIRVKYLGKKGPVTEVLRGMGKLSPEERPVIGQLANDVREAIGKAIESKMEALEQAEIHRKLQEETIDVTLPGRPVLKGGAHPLTATITEVEDLFIGLGFSVAEGPQIETDYYNFEALNLPKDHPARDMQDSFYFTDELLLRTQTSPVQARTMEKYKGKGPIKIICPGKVFRRDDDDATHSHQFMQIEGLYVDHGVRMSDLKGVLQAFAKSFFGEERSIRLRPSFFPFTEPSVEVDVSCGICHGDGCRVCKQTGWIEILGAGMVHPRVLEMSGFNPNEYSGFAFGMGVERLSMLKYGIDDIRHFYTNDRRFLAQFKRVLast
1 -125.0004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  53  2..ENLDALVSQALEAVRHTEDVNALEQIRVHYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQP--PIRIVCPGRVYRCDS-DLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCVICSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR.. 338
2 -125.0003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  49  2..SHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQ---PPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMG-----------KNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK.. 327
3 -117.0001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  41  1.......MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEGLLRTHTSPMQVRYMV--AHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYFPFVEPGAQFAVWWPEG----------GKWLELGGAGMVHPKVFQAVDAYREGVTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKFLEQFKGV 349
4 -115.0002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  68  1........................................................MGSSSSGLVPRGSHMGTELMEKLN-----QQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNGQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMAGFDSNEYSGFAFGMGPDRIAMLKYGIEDIRYFYTNDVRFLEQFKAV 283
5 -104.0003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  22  119.AADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQFTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQL--RFKPAYNPYTEPSMEVFSYH----------QGLKKWVEVGNSGVFRPEMLLPMGLP-ENVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDS. 490
6 -76.6002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  18  1MKFDPQKYRELAEKDFEAARSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIGSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPKPNVGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDDLS--YLIAEVLDVDDITAVKILDEVFPISSTLTLRSHMTTGWFITLSHDKLPLPIKLFSIDRCFRREQEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIP---YPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSD. 359
7 -73.6005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  18  15MRFDIKKVLELAEKDFETAKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDE--MEIYKQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDFEIAKALNVSNEMGLKVLETAFPESTTLTLRSHMTSGWFITLSIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKKSKYYTPETQTEVY--------AYHPKLGEWIEVATFGVYSPIALAKYNID---VPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYEYRLSDR. 367
8 -64.6003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  29  3...........................................................AECATQRAPGSVVELLGKSYPQDD----SNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLL----HAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINF------------HGEWLEVLGCGVMEQQLVNSAGAQDR--IGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFC.. 308
9 -56.5004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  15  1......................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPL-EYIERMGIDNDTELSKQIFRV--DKNFCLRPMVAPNIFNYARKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCSVYGDTLDVMH-----------------GDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY....... 260
10 -54.3004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  13  2..................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGFRELESELLSRRKKDLQQIYAEERENEREITRFFVVDKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCMVYGDTLDVM-----------------HGDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY....... 278
11 -53.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  15  2......................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEY-IERMGIDNDTELSKQIFRV--DKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCMVYGDTLDVMH-----------------GDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY....... 261
12 -43.1002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  13  2..................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGFRELESELLSRRKKDLQQIYAEERENYLEITRFFVVDKNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCMVYGDT-----------------LDVMHGDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSGSYY....... 278
13 -32.9004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  8................................LVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILI-----------PLEYIERMGIDNFRVDKNFCLRPMLAPNLGNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHL-------------------GIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSES-YYNGIS.. 282
14 -32.3004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  1..........................................MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILI-----------PLEYIERMGIDNFRVDKNFCLRPMLAPNLANYLRKLDRADPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHL-------------------GIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKP----IGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
15 -32.2003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  16  3..............................GGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILIPL---IERMGIDNDTELSKQIFR--VDKNFCLRPMLTPNLYNYLRKLDRADPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHL-------------------GIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRA-ARSESYYNGIS.. 279
16 -24.5002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  13  13..............................SHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPA-----LLELEEKLAKALHQQGFVQVVTPTIITKS--LAKMTIGEDHPLFSQVFW--LDGKKCLRPMLAPNLYTLWRELERDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIREFELVTESS------------------VVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDP---WVGLGFGLERLLMIREGTQHVQSMARS--LSYLDGVRL 299
17 -16.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  15  19..............................................................................................................TKILEYMTDFFVKEGFKWLLPVIISPI----DPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK----KIFVLSPNIRLESRQKRHAYEFTQLDFEVE---AKMEDIMRLIERLVYGLFRKAEEINIPREFYDREVDGFWRNYDLILPYGYG----------EVASGGE---AKIRKAGLNEDSFRPYGAGIGVERLVRFIVGAKHIAEV.............. 281
18 -16.0003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  15  19..............................................................................................................TKILDYMTKFFTDRGFKWLLPIMLSPI----DPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE----KIFVLSPNIRLESRDGRHSYEFTQLDFEIE---AKMKDVMRLIEELIYGLFRKAEEVNIPREFYDREENGVWKNYDLILPYGYG----------EVSSGGE---AKIRAAGLKEDSFRPYGAGIGVERLVRFIVGAKHIAEV.............. 281
19 -15.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  11  63LRQQASLIQGLVKANKEGTISKNMVKWAGSSIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTV-AGVCELFREYLATKKFTEVHTPKLLGA----------PSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFE----RVYEIGPVFRAENSNTHHMTEFTGLDMEMAFEE-HYHEVLDTLSELFVFIFGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFEILSGAQLLQERMKAHGLSPEDPG--GGGIGLERVVMFYLDLKNIRRA.............. 478
20 -14.4004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  12  94LRQQQFNVQALVAVGDHASKQMVKFAA-KESIVDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTS-SGICHLFRETLINKGFVEIQTPKIISA----------ASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFE----KVFSIGPVFRAEDSNTRHLTEFVGLD-IEMAFNYHYHEVMEEIADTMVQIFGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFEILSGAQLLTERALHHGIDLEKIKAYGGGIGLERVTMLFLGLHNVRQT.............. 503
21 -14.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  15  39IRDRDGIVQITAPKKKVDPELFKLIPKLRSEVVAVEGVVNFTPKAKLGFEILPEKI------VVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVM---AIFKIRSSVFKAVRDFFHENGFIEIHTPKIIAT----------ATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLD----RVYEIAPIFRAEEHNTTHLNEAWSID-SEMAFIEDEEEVMSFLERLVAHAINDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDID--EISSGGQILVEQIKEKGLNPESFEFYGFGLGAERLIKQMLDLPNIREV.............. 426
22 -14.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  16  68.........RDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSK--LKARSMVTRCFRDHFFDRGYYEVTPPTLVQT----------QVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALG-----DVFCIAQSYRAEQSRTRHLAEYTHVEAECP---LTFDDLLNRLEDLVCDVVDRSIVHELNPNFQPPKRPPVEIKSFYMQRCPEDSRLTESVDVLEIVGGSM---AGYKREGIDPTPYYWYGYGLGLERFLTWILNRYHIRDV.............. 454
23 -13.7003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  14  62..........QCVIFGKELCEPEKVKLLTRESLEITGRLNAYAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQ---QVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKT----------QCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLG-----KSFCMLSSYRAEQSRTVHLAEYLHLEAELP---ISFEDLLNHLEDLVCTVFMIHFPSKMKAFYMPDLTESVDLLM---------------PGVGEIVGGSM---GAYKANGLNPDPYYWYGYGLGVERLVMWLLGEDHIRKV.............. 444
24 -13.6001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  12  39IRDSTGIVQAVVAKNVVGEETFEKAKKLGRE---------SSVIVEGIVKADERAPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASA--MKVKETLIMAAREWLLKDGWHEVFPPILVTG----------AVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE-----KVWSLTPSFRAEKSRTRHLTEFWHLELEAA---MDLWDIMKVEEELVSYMVQRTLRISYDEAIYP-IKAFYMKEDPNDPRKVLASDMLAPEGYGEIIGGSQREDDYILEEGMDPKDYEWYGFGLGVERLVAWVLKLDHIRWA.............. 422
25 -13.5002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  13  38.........RDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKIIGNAPPGGIDNVLNEEASVDKMLDNRHLVIRGENAAA--LRLRAAATRAMREHFYNAGYVEVAPPTLVQT----------QVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLG-----DVFCIAQSYRAEKSRTRHLAEYAHVEAECP---ITLDDLMEKIEELVCDTVDR-LRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERGVGEIVGGSM---KAFKNVEIDPKPYYWYGYGLGLERFICWLTNTNHIRDV.............. 425
26 -13.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  15  248..............................................................................................................SACCGLFREFLTSQKFVEIHTPKLIGC----------SSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFR----KVFEVGPVFRAENSNTRHLTEFEGLD-IEMEIVENYHECIDVMEKLFTFIFDE-LRLTYKEAIFP-----AAIRPFYTMPDIDDPNYSNSYDVFEITSGAQFLMKRCIEKGVDPATLKDYGCGIGLERITMLYLGIPNIRKV.............. 536
27 -13.3001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  12  39LRDKTGLGQVVVDKNSSAFGISQELT--QESVIQVRGIVKADKRAPRGIELHAEEI------TLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQ---AVIKIQSLALKAFRETLYKEGFIEIFTPKIIAS----------ATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVVE-----RVFEVAPAWRAEESDTPHLAEFISMDVEMA---ADYNDVMQLLEKILHNIVKT-KRLKYTEAIEILRSKGYNIKFGDDIGTPELRILNEELKFLEIVSGSTVLEEALKKKGLKPESFEFFGFGMGLARLMVMLTGIQSVKEI.............. 417
28 -13.2003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  16  21..............................................................................................................AAIMAEIRRFFADRGVLEVETPCMSQA--HLFPFETRFVGPGHSQGINLYL----------MTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCQPAESLSYQLQLLFTMGVEPHIHFPASQASLAQISTEDHRVAERFEVYYKGIIDQNLLDALAAGLPDCSGV--ALGVDRLVMLALGAESLADV.............. 318
29 -13.2001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  13  1MRVLVRDLKAHVGQEVELLGFLHWRRDLGLLLRDRSGVVQVVTGGLKLPLPESALRVGLVVENAKAPGGLEVQAKEVEVLSPALEPTPVEIPKEEWRANPDTLLEYRY--AALVRGFRRYLDRQDFTEIFTPKVVRA----------GAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFE-----RVYEVAPVWRMEHHTSRHLNEYLSLD-VEMGFIADEEDLMRLEEALLAEMFVTRYPRSVRPFYTYPEEDGTTRSFDLLFRGL------------EITSGGQ---ESLKAKGMDPEAFHGYGFAIGAERLTQKLLGLPNVRYA.............. 410
30 -13.1003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  11  283...TVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIVEDAAIAYGYNNIQMTLP-KTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPKGGYVIKASEGPAFFPGRCAEIFAR----------------SVGKLGVLHPDVITKFELT---MPCSSLEINIGPFL.......................... 589
31 -12.5003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  16  34..............................................................................................................AAIMAEIRRFFADRGVLEVETPCMSQA--HLVPFETRFVGPGHSQGMNLWL----------MTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCPAAESLSYQLQLLFTFGVEPNIHFPASQASLAQISTEDHRVAERFEVYYKGIIDQNLIEALKVGMPDCSGV--ALGVDRLVMLALGAETLAEV.............. 331
32 -12.4006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  15  82....FATLQEGDGTQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSKRGELSVLADSWQM-AAKALRPLPVAHKEMSEESRVRQRYVDLIVRDQARKVARQR--IAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKR-------------------RVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDAVVTRELIQEVADEAIGTRQVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPWEHTVGAKLWAPTFVEAMALDEDFLAALGTGMGIDRLMMTLTGIRETVLF.............. 496
33 -12.2004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  10  1......................................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADK------------LFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRLKSFPNLLGCVCGLHGTERETTSLSPADLVLSPAACYPVYPIAASRPKGGLRFDVAADCFRREP-HLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDGLTFRVDYASDPFFGRAGKMLANNQRDQQLKFELRSEEQPTACMSFNYHREHFGTTWGINGEPAHTGCVAFGMDRLAMFHTHGTDLSAWPAKVRDILGLQPHV 330
34 -12.1003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  10  1......................................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADK------------LFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRLKSFPNLLGCVCGLHGTEREI-SLSPADLVLSPAACYPVYPIAASRPKGGLRFDVAADCFRREP-HLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDGLTFRVDYASDPFFGRVGQMKAVSQKQQQLKFELRSEEQPTACMSFNYHREHFGTTWGINGEPAHTGCVAFGMDRLAMFHTHGTDLSAWPAKVRDILGLQPHV 330
35 -12.1003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  14  79IQDVTGQIQIYVRQDDVGEQQYELFKISDLDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKD------------IEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKR-------------------KVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSFEQKVEDKLIQPTFIEAHEMDEDFLEALGLGIGVDRLVMLLTNSPSIRDV.............. 484
36 -12.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  16  79....FATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSRRGELSVLADSWRM-AAKALRPLPVAHKEMSEESRVRQRYVDLIVRPQAREVARQR--IAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKR-------------------RVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDALITRELIQEVADEAIGTRQLSMPDGSVYDIDGEWATMEMYSSLSEALGEQITPETTWEHAVGNKLTAPTFVEAMQLDEDFLTALGTGMGIDRLLMCLTGIRETVLF.............. 492
37 -11.9004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  13  103VQDGSGQIQFFVTPADVGAETYDAFKKWDLDIVAARGVLFRTNKGELSVKCTQLRLLAKALRPLPDKFHGLAD------------QETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNA--------LDMEMFLRIAPELYLKRLIVGGFE----RVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLIRQAAVDALGTATIQYQGRELDLAQPFHRLTITQAIQKYAPSYTDGQLSFEETAEAQLWEPTFIEAMFFDADYIRALGCGIGIDRLVMLLTDSPTIRDV.............. 513
38 -11.9001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  13  88.........QDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVR--SKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKR-------------------RVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDFDEVAEAHLIQPTFIEAMFYDEDYVTALGLGIGIDRMIMLFTNSHTIRDV.............. 494
39 -11.8001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  13  88.........QDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDESRNTFKVR--SQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKR-------------------RVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDFEEVAEAHLIQPTFIEAMFYDEDYVTALGLGIGIDRMVMLFTNSHTIRDV.............. 494
40 -11.8004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  11  12.........................................................................................................LQEQILTVKRSFSEALEKLNLVEVRAPILFRVGDGTQDNLSGFEKAV-QVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDDLDNIHSVVVDQWD-VMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKPETIQFVHAEHLLLAYPNLTAKEREREIAREY-LEVSSMGILRHQISLTGDDSLLKSEWHGGGIGQSRMVMFMLRKKHIGEVQCS---WPEEIRKK 347
41 -11.20011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  8.........................................................................................................KQRQISFVKSHFSRQLEELGLIEVQAPILSRVGDGTQDNLSGAEKAV-QVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDELSPLHSVYVDQWERVMGDGERQFSTLKSTVEAIWAGI-SQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGEDAFELSSMGILKHQLALTGDEDRLELEWHGGGIGQSRLTMLLLQLPHIGQVQAG........... 316
42 -11.0005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  15  94...KVQIIANIMEHDISTGEFSVSHSEIRRDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYHMLPTAISGLKD------------QEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNE--------LETQLYMRIAPELYLKQLIVGGLD----KVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYAD--YYDLMDLTEELISGLVLEPDGPEGKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDAGHFVETKCTNPSFIEACPIDETFCLALGWGLGIDRLIMFLADKNNIKEV.............. 507
43 -10.9003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  14  78...DLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHML-----PHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKM-------------------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMVKHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLVGEFLEVTCINPTFIEAMFIDENFCTALGWGMGIDRVAMFLTDSNNIKEV.............. 499
44 -10.7004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  13  92.YSFHNHEKGNFAECYDKIRRGDIVGIVGFPGKSKKGELSIFPKETILL-------------------SACLHMLPMKYGLKDTEIRYRQRYLDLLINESSRHTFVTR--TKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKM-------------------KVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQLVYHKDGPENQPIEIDFTPPYPKVSIVEEIEKVTNTILEQAAKLLDQLASHFIENKYNEAAQLDSAFCTSLGLGLGIDRITMFLTNKNSIKDV.............. 498
45 -10.6005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  15  80...DLHGEGTRLQVLANARFHSGDEAFDNLHDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLHML-----PHTHFGLKNQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHND--------LDMDLYLRVAPELYLKMLVVGGID----RVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYELMKITEDMLARMVYYMHGTYKIQYHPN-VDFTPPFRKVNIYDGLQEKLGIQFPPADTIGEFLEPTFISPTFLEAQNIDENYCTALGWGMGIDRLAMILTDSNNIKEV.............. 502
46 -10.4006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  14  146...DLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHML-----PHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNE--------LDMNLYMRIAPELYHKMLVV--------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMVKHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLVGEFLEVTCINPTFIEAMFIDENFCTALGWGMGIDRVAMFLTDSNNIKEV.............. 567
47 -10.1003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  12  1........................................................................................................SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSY-YEGLKSHPREMAVELMNPL--QELNCMRQTFGGLETLSHNLRRKHLSLYLFEWGKCYRAKRTDETPLAAYAEDDRLGIEEPTSVFELKAVVEQVLCRVGIETGAYTLKTAD-NDLYASAMEVKTRS----------------LLGTFGTVSTELIKRFEIEQP---VYFAELLWDALM.......................... 213
48 -9.8703ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  1........................................................................................................SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAY-YDGLESYPSKNLVMLLNPL--ADLNCMRQTFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKEDYHLGLWVTGENTSVYELKAYVENIFKRLGLDLHSL-VVGNLSDDIYSTALTVNT--------------KGGKRLATFGVVTKKMLKAFDVDNE---VYYADLNWKELM.......................... 213
49 -9.7304g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  10..............................RQMAERAALEELVKLQGERVRGLKQQ-----KASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELK----ETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVNDDY--YTGVIYEAVLLQTPAQAGE----EPLGVGSVAAGGRYD-GLVGMFDPKGRKVPCVGLSIGVERIFSIV....................... 404
50 -9.6202cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  11  129...KVPYIKSMENIEGGIQLELEVGEAEMKNRVPDR-ILTLLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGP----------QSARIFRTFEKIVLELGYREMIFPKLVTW-----EVWMKSGHAKGVYPEIYYVAEPIGGMCYAQCPPFAGETLPNEEIPVKVFDRGTSHRYES-GIERVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDIEWRKARVTPWF--TVGTTDYEACLPYRGPDG-------EWLEFQNVSINGDKYPKGFNVSGDELWSGCSGVGLERWALAQKGLD................... 494
51 -9.5603w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  13  110FDREVTYDYVGYVPVADDVVVEDGTVRLTFQDVDEEMLRRHVIDRVIRLVAWAVEERSELVERVTKVEPGTVVDESGPRRIRFRGDVTEE--KEFPGRGQWIYTPPMAALFEVLRDLERVTRKLGFEPALFPKLIPLLHGLPDGMYYVCPPKRDPELKEKLRDPGYVLAPAQCEPFRDEVVDPERLPIKLYDCGWTYRWEG-GLERVNEFQRIEHVWIAEPEEAYRIRRELLEATKRVAEEELEWKVVVSDDPFDVPSYEFEVYLPFKG----ERSSEEAWISVGSFNVHGEHFVDGFNVKEKSGRTLCAGLGVTRWVLAQHGFYP.................. 498
52 -9.5504up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  13  76...DLHDSQTKLQIMLNKSAYENKEDFVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLHML-----PSMHYGLGDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATA---PFITHHNQLDIQMYMRIAPELYLKELVVG-------------RVYEIGRLFRNEGIDQTHNPEFTTCE-AYADYNDIMKMTEELLGNMVKDITGGSTKLEIKDRLMDINNEEDIKML................................................................................. 320
53 -9.4305e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  16  24..............................................................................................................RRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMFDKGNPPESLTLRPEGTAGCVRALVEHLRGATPRVWYMGPMFRYEKPQKGRYRQFHQVETFGVATPDIDAELIMLTARLWKRMGVDHVQLELNPKLHDFLNQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGMERLLLLL....................... 322
54 -9.3601efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  18  39LRDREGLVQLVAHPASPAYATAERVRP--EWVVRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFP-RGEEEKEASEELRLKYRYLDLRRRRMQENLRLRH---RVIKAIWDFLDREGFVQVETP----------FLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAG----RYFQIARCFRDEDLRADRQPDFTQLD--LEMSFVEVEDVLELNERLMAHVFREEEEEAWTYMHHPFTSPHPE--LEKDPGRVRALAYDLVLNGVEVGGGSILQARVFRLLGIGEEELEALEYGWGLDRLLALMTGSPSIREVI............. 546
55 -9.1404rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  55VLAAAHRLRAEFCVAVTGVVEVRPEGNENPEI--PTGQIEVNATELTVLGESAPLPF-----DEQAGEEARLKYRYLDLRREGPGNALRLR-------------------SKVNAAARSVLAEHDFVEIETP----------TLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAG----RYYQIARCYRDEDFRADRQPEFTQLD--MEMSFVEADDVIAISEQVLKAVWATVGSGAWTAMHHAFTAPKPD--FDSDPGNALSDAYDIVCNGNEIGGGSIIQERVFAMMGIDHDELDAFSYGFGWDRITALLAGVDSIREVI............. 552

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.