current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] COG0017 Aspartyl/asparaginyl-tRNA synthetases, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MKTTIKQAKDHLNQDVTIGAWLTNKRSSGKIAFLQLRDGTGFMQGVVVKSEVDEEVFKLAKEIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAHDYPITPKNHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTASAPEGTSELFHTKYFDQDAFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEIQEQYVTHVVKSVLENCKLELKILERDTSKLEKVATPFPRISYDDAIEFLKAEGFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQRVKEHGLDEEAYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLLNRLYPLast
1 -130.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  34  12........EELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLGFEILPEKIVVLNRAETPLPGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEIMMSGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHNAKELDILNFELEE---PKLPFPRVSYDKALEILGDLGKE-IPWGEDIDTEGERLLENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFDLEYR--GVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP 438
2 -129.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  45  4.KVYCQEVPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVVGEETFEKAKKLGRESSVIVEGIVKADERAPGGAEVHVEKLEVIQAVSEFPIPPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVN-VEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPNDPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP 434
3 -122.0003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  32  18IVCNIRDAAGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELCEP--EKVKLLTRECSLEITGRLNAYAGKNLNLEMQVTEWKVIGESPIDLENNKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLGKSFCMLSSYRAEQSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLK---LPTRPFKRMTYADAIKYCNDHGILNKDYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMP-GVGEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP 456
4 -121.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  32  32.CVKIGALEGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQCYN---GVLLSTESSVAVYGMLNLTPKGKQAHELSCDFWELIGLAPAGGAINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELN--PNFQPPKRPFKRMNYSDAIVWLKEHDVKFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMP-NVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP 466
5 -120.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  28  27VKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIQNLEIHITKIYTISETPEALPILLEVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEPKDGKMVRLTYKEGIEMLRAAGKE-IGDFEDLSTENEKFLGKLVTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFM--RGEEILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP 490
6 -119.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  32  2.GVKIRDLVKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQTYD---ALTVNTECTVEIYGAIKEVPEGKNGHELIADFWKIIGNAPPGGILNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHIN-PKFQPPERPFLRMEYKDAIKWLQEHNGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLLMP-GVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP 437
7 -119.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  29  59.LVRVRDLIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHSKQMVKFAANINKESIVDVEGVVRKVNQTQQDVELHVQKIYVISLAEPRLPGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCIADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPEPFKFLEPTLRLEYCEALAMLREAGVE-MGDEDDLSTPNEKLLEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM--RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP 515
8 -119.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  29  1MRVLVRDLKAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL----------KLPLPESALRVRGLVVENAKAPGGLEVQAKEVEVLSPALEPTPEEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFERVYEVAPVWRMEEHHTSRHLNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTAGDEIRLLGATWPS---FPQDIPRLTHAEAKRILKEELGYPVG-EEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTY--PEEDGTTRSFDLLFR--GLEITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP 422
9 -118.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  33  12........PEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKN---SSAFGISQELTQESVIQVRGIVKADKRAPRGIELHAEEITLLSKAKAPLPGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVVERVFEVAPAWRAEESDTPFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKILNYEPPE---VKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPELRILNEELKEDLYFIVDWPSDARPFYTKSKSENPELSESFDLIY--KFLEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP 429
10 -110.0003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  31  50.YTEIEELPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETSKEFVQFCQKISAESICDITGIVKAVEKTQQDVEIHVTSIAVVSLAEYPLPMQIEVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETYDDFTTPQEVKLGELIAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVR--GQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP 548
11 -90.7001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  24  2....................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIMGLKKIFVLSPNIRLEQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTK-----------RFEVFEYSEVLEEFGS----------------DEKASQEMEEPFWIINIPREFYDREVDGFWRN------YDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPA. 292
12 -87.4003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  23  2....................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPIPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIMGLEKIFVLSPNIRLERKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFP-----------RARHFKVYDYKDILEEFGS----------------DEKASMEMEEPFWIVNIPREFYDREEN------GVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAV 293
13 -85.7001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  24  12........ETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYAT---AERVRPEWVVRAKGLVRLRPEATGRVEVELSALEVLAEAKTPPFEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHGLFYALPQSPQLFKQMLVAGLDRYFQIARCFRDEDLRADRQ-PDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGV----------------ELPLPFPRLSYEEAMERYREGFRFLWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLL---EKDPGRVRALAYDLVL--NGVEVGGGSIRIHDPRLQARVFRLLGIGEEEFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDP 557
14 -84.3003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  47....LQPGDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKEEFIHINNKLRRGDIIGVQGNPGKTKKGE--LSIIPYEITLLSPCLHMLPHLHFKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYHKMLVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVFTPPFRRINMVEELE-KAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPL-AKWHRSKEGLTERFELFV--MKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 508
15 -83.2003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  22  49.....KEELEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELFKISDLGDIVGVRGTMFKTKVGE--LSIKVSSYEFLTKALRPLPEKYHKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHLDMTLYMRIAIELHLKRLVGGLEKVYEIGRVFRNEGIST-RHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHLVDLT------PEWRRLHMVDAIKEHGVEVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPL-AKKNPDDPRFTDRFELFI--VGREHANAFTELNDPIDQRQRFEEQLKEREQ-EDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK... 493
16 -83.1006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  19  56......PVDARTGEIVGVTGRVVFARNSGKLCFATLQEGDGQLQAMISLAEVGQEALDNWKTVDIGDIVFVHGEVITSKRGE--LSVLADSWQMAAKALRPLPVAHKMSEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSLDTELYLRIAPELFLKRCVGGFERVFELNRVFRNEGADS-THSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQ-----VPLPDGTVYDLDGEWESIQMYPSLS-LDIPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPL-TRSHRSIPGVTEKWDLYV--RRIELATGYSELTDPIIQRERFEAQARAAAA-EDFLAALEYGMPPSTGTGMGIDRLMMTLTG-LSIRETVLFPIVKPR... 502
17 -82.7005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  49....LEKDVILNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHDEAFDNLHDRIKRGDIIGVNGYPARSKSGE--LSIIPYEIIQLTPCLHMLPHTHFKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHLDMDLYLRVAPELYLKMLVGGIDRVYEIGRVFRNEGIDQ-THNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYHPNGIVENPVYEVTPPFRKVNIYDGLQ-NNVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPL-AKWHRSIPGLTERFELFV--VTKEIVNAYTELNDPLTQRLRFDEQAKQKQA-ENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPD... 511
18 -82.4005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  19  56....VENGYIDKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMEHDGEFSVSHSEIRRGDVVGFTGFPGKSKRGE--LSLFSKSVVLLSPCYHMLPTAISKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHLETQLYMRIAPELYLKQLVGGLDKVYEIGKNFRNEGIDL-THNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYHPDGPEGKCIEDFTTPWKRFSFVEEIE-HEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPL-AKWHREKPEMTERFELFV--LGKELCNAYTELNEPLQQRKFFEQQADAKAS-ETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNV... 516
19 -82.4004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  21  73.....KEALEAKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADVGAETYDAFKKWDLGDIVAARGVLFRTNKGE--LSVKCTQLRLLAKALRPLPDKFHADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHLDMEMFLRIAPELYLKRLVGGFERVFEINRNFRNEGVSP-RHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQYQGRELDLA------QPFHRLTITQAIQ-VTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPL-ARESDTVAGITERFELFI--TGREIANGFSELNDPEDQAARFKKQVEQKDA-ADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRE... 522
20 -82.2001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  22  57.....NQELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQKKWDLGDIIGARGTLFKTQTGE--LSIHCTELRLLTKALRPLPDKFHQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHLDLDMYLRIAPELYLKRLVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFG------KPFEKLTMREAIESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL-ARRNDVNPEITDRFEFFI--GGREIGNGFSELNDAEDQAERFQEQVNAKAA-EDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQ... 503
21 -81.8005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  20  53......PTDSATEDIVGVAGRVVFARNTGKLCFATLQDGDGQLQAMISLDEVGRESLDRWKAVDIGDVVYVHGTVISSRRGE--LSVLADSWRMAAKALRPLPVAHKMSEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSLDIDLYLRIAPELFLKRCVGGFDRVFELNRVFRNEGSDS-THSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMPD-----GSVYDIDGEWATMEMYSSLSEA-EIDNSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPL-TRQHRSIPGVTEKWDLYV--RGVELATGYSELNDPVVQRDRFADQARAAAA-EDFLTALEYGMPPCTGTGMGIDRLLMCLTG-LSIRETVLFPIVRPH... 498
22 -81.4001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  21  57.....NEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQKKWDLGDILGAKGKLFKTKTGE--LSIHCTELRLLTKALRPLPDKFHQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHLDLDMYLRIAPELYLKRLVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTLDFG------KPFEKLTMREAIESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPL-ARRNDVNPEITDRFEFFI--GGREIGNGFSELNDAEDQAQRFLDQVAAKDA-EDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPV... 503
23 -80.2004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  14........ESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDR--AETFAKADRVRSEFVVKITGKVRLRPEGAGSIEVLGYELEVLNQAETPPFPLDEYGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTGHFFALPQSPQLFKQLLVAGFDRYYQIAKCFRDEDLRADRQ-PEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDV-----------------EFDEFPHMPFEEAMRRYGSD-TREWAPMWVVDFPMFEENDDGSLSALHHPFTSPKCTPA-ELEANPGAALSRAYDMVL--NGTELGGGSIRIHDKSMQQAVFRVLGIDEAEFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDV 566
24 -80.2004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  47....LGNGEHLEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFHNHEFAECYDKIRRGDIVGIVGFPGKSKKGE--LSIFPKETILLSACLHMLPMKYGKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHLDLDLYLRIATELPLKMLVGGIDKVYEIGKVFRNEGIDN-THNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKISYNKDGPENQPIEDFTPPYPKVSIVEEIE-HKIELPNPPTAAKLLDQLASHFIENKNDKPFFIVEHPQIMSPL-AKYHRTKPGLTERLEMFI--CGKEVLNAYTELNDPFKQKECFKLQQKDREK-SAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPA... 507
25 -78.7004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  12........PADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAA----AHRLRAEFCVAVTGVVEVRPEGTGQIEVNATELTVLGESAPLPFQDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLLVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD-----------------LPLPLPRISYEEAMRRFGSDKPDAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTF---DSDPGNALSDAYDIVC--NGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDP 563
26 -78.5005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  28........EGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQ-DTEVLAQAHRLRAEFCVSVAGVVEIRPEGNGEIEVNATSLTVLGECAPLPFQDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFLPQSPQLFKQLLVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYR-----------------IPTPIPRIGYAEAMRLVAEDGTLGGPVAKNLTEAERTGLADHVGAFVWVVDPPAVHHAFTAIESDTGSVLADAYDIVC--NGHEIGGGSVRIHRRDIQERVFAVMGLDKAEFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGG.... 578
27 -77.9004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  23  28........PADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAA----AHRLRAEFCVAVTGVVEVRPEGTGQIEVNATELTVLGESAPLPFQDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLLVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD-----------------LPLPLPRISYEEAMRRFGSDKPDAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTF---DSDPGNALSDAYDIVC--NGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGG.... 575
28 -77.7006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  18  115....LQPGDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKEEFIHINNKLRRGDIIGVQGNPGKTKKGE--LSIIPYEITLLSPCLHMLPHLHFKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYHKMLVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDDFTPPFRRINMVEELE-KAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPL-AKWHRSKEGLTERFELFV--MKKEICNAYTELNDPMRQRQLFEEQAKAKAA-ENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 576
29 -76.8004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  19  49........SQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAYEEDFVSLTKMIYRGDICGFTGHPTRTKTGE--LSLIPISGMILSPCLHMLPSMHYGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHLDIQMYMRIAPELYLKELVGGINRVYEIGRLFRNEGIDQT-HNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGG-----STKLEIKDRLMDINNEEDIKMLEKFFK--FTAPFKRISYVHALEEKFGEKIPRPLDGPEALTFQPQLMSPL-AKYHRSEPELTERFELFI--LKREIANAYTELNNPIVQRSNFEQQAKDKAADEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPE... 564
30 -76.7004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  22  20........SSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQGEIEIKVKTAELLNACKKLPFEIKNFTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGG-AKEFLVPS-GKFYSLPQSPQQFKQLLVGGLDRYFQVARCYRDEGSRPDRQ-PEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDP-----------------VVVPFPTMTFAEVLATYGTDGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPSAHHPFTALYTEPKKARSQHYDLVL--NGNEIGGGSIRIHNAELQRYILATLLKEDVKLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFR.... 570
31 -76.1001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  21  11........LSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR--ADALKLASELRNEFCIQVTGTVRARDEKNGEIEVLASSLTIINRADVLPLDNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFLPQSPQLFKQLLMSGFDRYYQIVKCFRDEDLRADRQ-PEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFA-AEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKFEDDGEGGLTAMHHPFTSPKDMTAA-ELKAAPENAVANAYDMVI--NGYEVGGGSVRIHNGDMQQTVFGILGINEEEFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACL 563
32 -69.7004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12  1................................................................................................................MGDDGYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDEKAVQVPVKAIPNASFEVVHSLAKWKRRTLAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPIHAEHLLLAYPNLTAKEREREIAREYGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMN-SLSSLKGLNGDILL-DDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQVWPEEIRKKHN 349
33 -67.9003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  14  4...........................................................................................................SSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLVPFETRFQGMNLWLMTSPEYHMKRLLAGCGPVFQLCRSFRNEEMGR-YHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLD-LSNVADTEEDRDTLLQLLFTFGVEPNIGKPTFVYHFPASQASL-AQISTEDHRVAERFEVYY--KGIELANGFHELTDAREQQQRFEQDNRKRAA-QNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA.... 339
34 -67.3003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  16  9.........................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLFPFETRFQGINLYLMTSPEYHMKRLLAGCGPVFQLCRSFRNEEMGR-HHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLD-LSNIADTEEDRDTLLQLLFTMGVEPHIGKPTFIYHFPASQASL-AQISTEDHRVAERFEVYY--KGIELANGFHELTDAREQQQRFEQDNRKRAA-QNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA.... 326
35 -64.60011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  12  5.........................................................................................................................YIAKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHEGLYTHMKALRDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLA----PFLPDQIHFVHSQELLSRYPDLDAKGRE--RAIAKDLGAVFLVGIVRAPDYDDWSTPSELGHAGLNGD---ILVWNPVL--EDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVGVWPAAVRESVP 327
36 -35.6004gla_C mol:protein length:109 OBody NL8  ali model follow..  16  16........PNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKAKA.......................................................................................................................................................................................................................................................................................................................................... 109
37 -32.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  13  3........................................................SSSSGLVPRGSHMFLTRRDPPLYQRLKELNASGEQLEMGFSDALSRDRAFQEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTIITKSTIGEDHPLFSQVFDGKKCLRLAPNLYTERLWDKPIRIFEIGTCYRKESQGA-QHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAM-EIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVR........................................................................................................... 298
38 -32.3004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  16  18........PNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEKTPDHLFKVFAELSREDVVVIKGIVEASKAAADGVEIFPSEIWILNKAK........................................................................................................................................................................................................................................................................................................................................... 113
39 -32.2004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  18  14........PNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVDTGVEIFPSEIWILNKAKPLPID...................................................................................................................................................................................................................................................................................................................................... 113
40 -32.1004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  16  15........PNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYATGVEIFPSEIWILNKA............................................................................................................................................................................................................................................................................................................................................ 108
41 -31.5004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  16  14........PNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRTGVEIFPSEIWILNKA............................................................................................................................................................................................................................................................................................................................................ 107
42 -27.9005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  16........EKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPS---SKAYEKALEVRSEFVLVAKGKVRLRGAGTGKIEIVLEELIIENKS............................................................................................................................................................................................................................................................................................................................................ 109
43 -23.8002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  7............................................................GLVPRGSHMASAPALTKSQTDR--LEVLLNPKDEISLNSG---KPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRPMLAPNLYNYLRKLDKIFEIGPCYRKESDGK-EHLEEFTMLNFCQMGSGRENLESIITDFLNHL--------------------GIDFKIVGDSCMVYGDTLDVMHG--------------------------------------------------------------DLELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 271
44 -23.6004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  3........................................................SSSSGLVPRGSHMASAPALTKSQTDR--LEVLLNPKDEISLNSG---KPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRPMLAPNLGNYLRKLDKIFEIGPCYRKESDG-KEHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDRE--------------------WGIDKPWIGAGFGLERLLK-VKHDFKNIKRAARSESYYNGISTNL............................................................................ 285
45 -23.4004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  18  7............................................................GLVPRGSHMASAPALTKSQTDR--LEVLLNPKDEISLNSG---KPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLKLDRALPDPIKIFEIGPCYRKESDGKE-HLEEFTMLSFIQMGSGRENLESIITDFLNHLGIDFKIVGDS--------------------CMVYGDTLDVMH--------------------------------------------------------------GDLELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 271
46 -21.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  18  5.............................................................................TKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERE---NYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLKLDRALPDPIKIFEIGPCYRKESDGKE-HLEEFTMLAFAQ--MGSGCTRENLESIITDFLNHLGIDFKIVGDSC----------------MVYGDTLDVMH--------------------------------------------------------------GDLELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 254
47 -19.4004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  16  1..............................................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-QIFRVDKNFCLRVAPNIFNYARKLDRAKIFEIGPCYRKESDGKE-HLEEFTMLNFFQ--MGSGCTRENLESIITDFLNHLGIDFKIVGD----------------SCSVYGDTLDVMH--------------------------------------------------------------GDLELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 253
48 -18.2003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  15  6..............................................................VPRGSHGASAPAL--TKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERE---NYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKKIFEIGPCYRKESDG-KEHLEEFTMLVFWQMGSGRENLESIITDFLNHL......................................................................................................................................................................................... 198
49 -16.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  5.............................................................................TKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERE---NYLGKLEREITRFFVDRGFLEIKSPILIPLEIDNDTELSKIFRVDKNFCLRPMLAPNLANYLRKLDKIFEIGPCYRKESDG-KEHLEEFTMLNFCQMGSGRENLESIITDFLNHL......................................................................................................................................................................................... 184
50 -13.2002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  3.........................................................................................SSSSGLVPRGSHMGTELMEKLNQQLAEETIDVTLPSRQGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNKIICPGKVYRRDSDDAT-HSHQFTQIEGLVV-IKMSDLKGTLELVAKKLFGADRE-----------------------------------------------------------------LRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGM------VHPNVLEMAGFDSNEYSGF------------AFGMGPDRIAMLKYGIEDIRYF............ 269
51 -12.7001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  12  2...................................LEEALAAIQNARDLEELKALKARYLGK-LLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWLTVEGRLLLRTHTSPMQRIVVPGRVFRFEQTDAT-HEAVFHQLEGLVV-IAMAHLKGAIYELAQAL-----------------------------------------------------------------------FGPDSKVRFQPVYFP---VEPGAQFAVWWPEGGKWLELGGAGM--------PKVFQAVDAYRERLGLPPAYRGVTG----AFGLGVERLAMLRYGIPDIRYF............ 335
52 -12.3003kf6_A mol:protein length:159 Protein stn1  ali model follow..  19  48.............RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINS----RSEVELIAQSFEELRDPND.......................................................................................................................................................................................................................................................................................................................................... 131
53 -12.0004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  11  1....MENLDALVSQALEAVRHTEDVNALEQIRVHYLGKKGELTQVMKTLGDLPAEERPKV------------GALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSGGLHP---------TRTLERIEQCFSRIGYEVAEGPEVEDDGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQRIVCPGRVYRCDSDLT--HSPMFHQVEGLLV-VSFADLKGTIEEFLRAFFEK-----------------------------------------------------------LEVRFRPSFFPFTEPSAEVDIQCVICSG-----NGCRVCKQTGWLEVMGCGM------VHPNVLRMSNIDPEKFQGF------------AFGMGAERLAMLRYGVNDLRLF............ 326
54 -12.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  11  11.........................................................QMAERAALEELVKLQGERVRGLKQQKASAELIEE---VAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKEGEDSKLIYDLDQGGELLSLRYDLTVPFARYLAMNKKRYHIAKVYRRDNPAMTRRYREFYQCDFDIPMIPDAECLKIMCEILSSL-RRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLLGDLKLLFEYLTLFGIDDDLSLARGLDYYTPLGVGSVAAGG----RYDGLVGMFDPKGRK---------------VPCVGLSIGVERIFSIV..................... 404
55 -11.9001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  17  26..TTVESAKSLDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWNG------VTVTPKDTVEIQGEV---DKDWNSVEIDVKQIRKVNP............................................................................................................................................................................................................................................................................................................................................. 109
56 -11.7003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  37.................................................................................................................................MRCRRHLFDVFHATAKTFGFEEYDAPVLESEELEITEQMFNFTKGGHRVALRPEMTPSLARLLLGKGKWYSIPQCWRYEAITRGRR-REHYQWNMDIVGVK--ELVCAACWAMRSL-RKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIVFEGFDREGKFRALCGGGRYDNLLTTYGSPTP---IPCAGFGFGDCVIVELLQEKRLLPDI............ 352
57 -11.3005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  14  20.................................................................................................................................TAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYLTLRPEGTAGCVRALVERVWYMGPMFRYEKPQKGRY-RQFHQFGVETFGVA--ELIMLTARLWKRM--GVDHMVQLELNTLGETDERTEYRNALVAFLN-TNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVI----NQKLVRGLDYYNKTSQGTVCAGG----RYDGLVGQLKGKADQS--------------VPAVGFAMGMERLLLLLEQVEQAEI............. 330
58 -11.3003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  13  1....MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAA------------GAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHP---------TRTIDRIESFFGELGFTVATGPEIEDDGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQP-IIAPGRVYRNDYDQT-HTPMFHQMEGLIV-ISFTNLKGTLHDFLRNF-----------------------------------------------------------------------FEEDLQIRFRPSYF------PFTEPSAEVDV-GKWLEVLGCGM---------NVLRNVGIDPEVYSGF------------AFGMGMERLTMLRYGVTDLRSF............ 315
59 -11.2001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  12  16.................................................................................................................................SKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYITLRPEGTAAVVRSYIEKLYYNGPMFRYERKQKGRY-RQFNQFGVEAIGAE--EVLAMVMHIYQSFVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYTE----DPNLVRGLDYYYDGAITTLCGGGR---------------------YNGLLELLDGPSETGIGFALSIERLLLAL..................... 317
60 -11.1003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  37.................................................................................................................................MRLRKYLFDVFHSTARKFGFEEYDSPVLESEELEITEQMFNFTKGGHRVALRPEMTPSLARQLLAKGKWYSIPQCWRYEAITRGRR-REHYQWNMDIIGVK--ELVCAACTAMQSL-RKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYYTGIVFEGFDRDGNFRALCGGGRYDNLLTTY-------AVPCVGFGFGDCVIVELLNEKKLLPE............. 351
61 -11.1004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  2.......................................................................................................PGSEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKEGEDSKLIYDLDQGGELLSLRYDLTVPFARYLAMNKKRYHIAKVYRRDNPAMTRRYREFYQCDFDIPMIPDAECLKIMCEILSSL-RRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLLGDLKLLFEYLTLFGIDDDLSLARGLDYYTPLGVGSVAAGG----RYDGLVGMFDPKGRK---------------VPCVGLSIGVERIFSIV..................... 351
62 -11.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  37.................................................................................................................................AKRRRAVETRLLSFVEDAGYEPVTSGLFEARSPESSRDWIRLDGGGDAVALRPEMTPSIARMAAP--RWCYCERVYRRTDDPASLKAAESTQVGIERSVDVDMDVLRLLHEASAAA-ARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLA--RYLCRLAEALHDSGLASDVVTFDLALH--DYYT------------FEMFAPGVGAPIAQGG----RYDELLAQFGAG------------------APAVGFAFEVERVMAVLEAQEEGEGEC........... 373
63 -11.0004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  15  37.............GQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDS-SSDDSSKASEIRNNVYVRVLGTLKSFQNRR---SISSGHMRPVIDYNE.......................................................................................................................................................................................................................................................................................................................................... 119
64 -10.7002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  12  4...........................................................................................................YQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYLTLRPEGTAGCVRAGIERLWYIGPMFRHERPQKGRY-RQFHQLGCEVFGLQ--ELIMLTARWWRAL--GISEHVTLELNSIGSLEARANYRDALVAFLE-TNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTV----NQRLVRGLDYYNRGSQGTVCAGGR---------------------YDGLVEQLGGRATPAVGFAMGLERLVLLV..................... 323
65 -10.5003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  26.................................................................................................................................KRLELYLLDTIRRVYESYGFTPIETPAVERLENQGDNIIYGLDTGSEARALKFDQTVPLAAYIAR--ARYQMDVVFRGERAKDGRF-RQFRQCDIDVSLLYDAQMPAIITEIFEAV-RKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDDLAIARGLNYYTHEALGSICSGG----RYEELVGTFIGEKM-----------------PGVGISIGLTRLISRLLKAGILNTL............ 367
66 -10.4003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  110..................NKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLP-LHPLLKVRSQFRQIFLEMGFTEMPTDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSKYFSIDRVFRNETLDAT-HLAEFHQIEGVVA-LTLGHLMGVLREFFTKLGIT-------------------------------------------------------------------------QLRFKPAYN----TEPSMEVFSYHQGLKKWVEVGNSGV------FRPEMLLPMGLPENVSVI-------------AWGLSLERPTMIKYGINNIREL............ 477
67 -10.3004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  11  7................................................................................................EAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYLTLRPENTAAVVRAAIERLWYIGPMFRHERPQRGRY-RQFHQVGVEALGFA--EIVMMCQRLWEDLLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTI----NPRLVRGLDYYNLGAQGTVAAGGR---------------------YDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE............. 345
68 -10.1004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  12  9AKLYIRDILDMKEKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAKTKIEIGDTIRVRGSIRT----REEREIHATTYYKVDDP--------VWNIQIARMLELPTIYRKVYDQPFH........................................................................................................................................................................................................................................................................................................... 165
69 -10.1001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  12  20.................................................................................................................................MDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLELLQQTYSFDKGGREVTLIPEATPSTVRMVTSRKRWYSFPKVWRYEEPQAGRY-REHYQFNADIFGSD-AEVIALASSILDRLFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGL-----SYYTGI----------FEAYDRSGQFRAILGGGR--------------------YDNLASLMSGESVPAVGFGMGDAVISLLL..................... 321
70 -10.1004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  13  19.................................................................................................................................LRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFLTLRPEGTAAMVRAYLERLWMAGPMFRAERPQKGRY-RQFHQVNYEALGSE--EAVVLLYECLKEL-----GLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVER-EPALVRGLDYYVRGAQSALGGGGR---------------------YDGLSELLGGPRVPGVGFAFGVERVALAL..................... 318
71 -9.8903od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  24.................................................................................................................................YKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVQLFKLDQQGNTLVLRPDMTAPIARLVAS--RLAYQSNVYRAQQNEGGKP-AEFEQLGVELIGDG--EVIALMIAALKRA-VGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSR--AEMTKLYEVLESYGASEYVKFDLTLVLHMSYYT------------FEGYGNRLGVPLCSGG----RYDELLSKF-------------------RPAQATGFGVRIDLLVEAL..................... 327
72 -9.8401z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  30.................................................................................................................................VKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFITLRYDFTLPLVRLYSQRYSYFGKIFRKEKRHKGRS-TENYQIGIELFGESFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVSSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYT------------FKAYSSAANQPILSGG----RYDQLLSNF-------------------EEAFAIGFCCHMDTILKALERQELEED............. 336
73 -9.8406FTT Entity 1(prereleased)  ali follow..  15.................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMIEGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEISIAADIELIDVLFSMINSLFKRLAELAALSASDTEQANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQAHLQVQWQCAVSIDVTELSGYHYHT------------FNGYINSETQPLVRGG----RFDGMKSNQLATNQPR---------------QATGFSMDVSRLLAHT..................... 319
74 -9.8405m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15.................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMIEGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEISIAADIELIDVLFSMINSLFKRLAELAALSASDTEQANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQAHLQVQWQCAVSIDVTELSGYHYHT------------FNGYINSETQPLVRGG----RFDGMKSNQLATNQPR---------------QATGFSMDVSRLLAHT..................... 319
75 -9.6902pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  12  47VPCTISQLLSATLSQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTS-SENTVVPPETYVKVAGHLRSFQNKK---SLVAFKIMPLEDMN----EFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLLIKACPRPEGLNFQDL--------KNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDD------HFKSTDAE............................................................................................................................................................................................................. 270

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 2 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25.