current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] COG0017 Aspartyl/asparaginyl-tRNA synthetases, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MKTTIKQAKDHLNQDVTIGAWLTNKRSSGKIAFLQLRDGTGFMQGVVVKSEVDEEVFKLAKEIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAHDYPITPKNHGTEFLMDHRHLWLRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTASAPEGTSELFHTKYFDQDAFLSQSGQLYLEAAAMAHGKVFSFGPTFRAEKSKTRRHLIEFWMIEGEMAFTNHAESLEIQEQYVTHVVKSVLENCKLELKILERDTSKLEKVATPFPRISYDDAIEFLKAEGFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQRVKEHGLDEEAYSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLLNRLYPLast
1 -124.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  45  11.......KPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVVGEETFEKAKKLGRESSVIVEGIVKADERAPGGAEVHVEKLEVIQAVSEIPENPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGV-NVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPNDPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP 434
2 -119.0003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  32  18IVCNIRDAAGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKEL--CEPEKVKLLTRECSLEITGRLNAYAGKNHNLEMQVTEWKVIGESDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLGKSFCMLSSYRAEQSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLKLPTR---PFKRMTYADAIKYCNDHGDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMP-GVGEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP 456
3 -117.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUT  ali model follow..  32  2.GVKIRDLVKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQ---TYDALTVNTECTVEIYGAIKEVPEGKEGHELIADFWKIIGNAPPDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKK-LLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVETFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLLMP-GVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP 437
4 -89.4001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  35  12........PEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNS---SAFGISQELTQESVIQVRGIVKADKRAPRGIELHAEEITLLSKAAPLPLDVSKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVVERVFEVAPAWRAEESDTPFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKILNYE---PPEVKIPIKRLKYTEAIEILRSKGY-NIKFGDDIGTPELRILNEELKEDYFIVDWPSDARPFYTKSKSENPELSESFDLIY--KFLEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP 429
5 -88.3001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  26  1...................................................................................................................MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLSPITDPLWPDPAGEPAEVEIYGVKMRLTHSMILHKQLIAMGLKKIFVLSPNIRLESKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKTKR-----------FEVFEYSEVLE----------EFGSDEKASQE------MEEPFWIINIP---REFYDREVDG---FWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGKLPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGI... 290
6 -85.1003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related  ali model follow..  26  1...................................................................................................................MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLSPITDPLWPDPAGEGIRVDVYGVRMRLTHSMILHKQAIAMGLEKIFVLSPNIRLESKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGRE-----------------FPRARHFKVYDYKD----ILEEFGSDEKASME------MEEPFWIVNIP---REFYDR---EENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGKLPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGI... 290
7 -84.5001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  35  12........EELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLGFEILPEKIVVLNRAETLPLDPTKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEMMASGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIEEEEVMSFLERLVAHAINYVREHNAKELDILNFE---LEEPKLPFPRVSYDKALEILGDLGK-EIPWGEDIDTEGERLLGKYMMENYFLYQYPSEAKPFYIMKYDNKPEICRAFDLEY--RGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP 438
8 -80.8001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  30  1MRVLVRDLKAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVT----------GGLKLPLPESALRVRGLVVENAKAPGGLEVQAKEVEVLSPALEIPKEEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFERVYEVAPVWRMEEHHTSRHLNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTAGDEIRLLGA---TWPSFPQDIPRLTHAEAKRILKEEL--GYPVGQDLSEEAERLLGEYAKERLFVTRYPRSVRPFYTY--PEEDGTTRSFDLLF-RGL-EITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP 422
9 -77.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  30  67........IQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDASKQMVKFAANINKESIVDVEGVVRKVNQTQQDVELHVQKIYVISLAPRLPLQLDDVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICAFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFCEPFKFLEPTLRLEYCEALAMLREAGVE-MGDEDDLSTPNEKLLGHLVKEKYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMR----EILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP 515
10 -76.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  30  58........PAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSEISKEFVQFCQKISAESICDITGIVKKFLKDNEGKDLTKRPLKDEYAKLLKEKASAKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVEYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGET-IGDYDDFTTPQEVKLGELIKAKYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFV-----EITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP 548
11 -72.1001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  29  35........AKDSDKEVLFRARVHNTRQQGTLAFLTLRQQASLIQGLVKANKISKNMVKWAGSLNLESIVLVRGIVKKVDETVQNLEIHITKIYTISETEALPILLEDANLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVAFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKDGKMVRLTYKEGIEMLRAAGK-EIGDFEDLSTENEKFLGKLVRDKYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRG---EILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP 490
12 -37.6001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  24  11........LSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQ--VFFDPDRADALKLASELRNEFCIQVTGTVRARDEATGEIEVLASSLTIINRADVLPLDSNHVNTEEARKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLSRVHKGKFYALPQSPQLFKQLLMMSFDRYYQIVKCFRDEDLRADRQ-PEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGSDKPDLRNPMELTDVADLLKASLTRKQIDEYGNFVKIYGAKGLAY-EGINSPVAKFLNAE--APLWVIDFPM--HPFTSPKDMTAAELKAAPENAVANAYDEVGGGSVRIHNGDMQQTVFGILGINEEEFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKT...... 557
13 -37.5004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  12........PADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVF----REGDVLAAAHRLRAEFCVAVTGVVEVRPEPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLLMVAMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVEADDVIAISEQVLKAVWATI-------------------DLPLPLPRISYEEAMRRF-GSDKPDLRFGIELVECTEYFKDTTFRAFTWVVDFPAPKPDSVDTFDSDPGNALSDAYDIVCNGN-EIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKS...... 557
14 -37.5004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  23  28........PADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVF----REGDVLAAAHRLRAEFCVAVTGVVEVRPEPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLLMVAMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVEADDVIAISEQVLKAVWATI-------------------DLPLPLPRISYEEAMRRF-GSDKPDLRFGIELVECTEYFKDTTFRAFTWVVDFPAPKPDSVDTFDSDPGNALSDAYDIVCNGN-EIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKS...... 573
15 -37.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  25  14........ESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQ--VVFDPDRAETFAKADRVRSEFVVKITGKVRLRPEASGSIEVLGYELEVLNQAETPPFPLDEYGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLSRTYPGHFFALPQSPQLFKQLLMVAFDRYYQIAKCFRDEDLRADRQ-PEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDSDKPDLRIPLELVDVADQLKASMPRSQIDDYTKFVGIYGAKGLAYALRIKVGHDLKLLTREWAPMWVVDFPTSPKCTPAELEANPGAALSRAYDMVLNGT-ELGGGSIRIHDKSMQQAVFRVLGIDEAEFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKT...... 560
16 -37.3004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  22  73.....KEALEAKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADVGAETYDAFKKWDLGDIVAARGVLFRTNKGE--LSVKCTQLRLLAKA---PLPDKFHGLETRYRQRYVDLIVTETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHLDMEMFLRIAPELYLKRLIVGFERVFEINRNFRNEGVSP-RHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGT--ATIQYQGRELD----LAQPFHRLTITQAIQ-VTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPL-ARESDTVAGITERFELFIANGFSEL---NDPEDQAARFKKQVEQKDAGDEEAMFYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHL...... 519
17 -37.2001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  24  12........ETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVA---HPASPAYATAERVRPEWVVRAKGLVRLRPEATGRVEVELSALEVLAEAKTPPFEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFLPQSPQLFKQMLMVALDRYFQIARCFRDEDLRADRQ-PDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGSYEEAMERYGSDKPDLRALPKALSRKEVAELEEVAKRHKAQGLAWEGGFSGGVAKFLEPVRERFLWVVDFPEEEEAWTYMHHPDPGRVRALAYDLVLNGV-EVGGGSIRIHDPRLQARVFRLLGIGEEEFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKN...... 551
18 -36.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  22  20........SSHLGQEVTLCGWIQYRRQN---TFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAPTGEIEIKVKTAELLNACKKLPFEIKNFTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLNLHGFVDIETPTLFKRTPGGAKELVPSREPGKFYSLPQSPQQFKQLLMVGLDRYFQVARCYRDEGSRPDRQ-PEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDP-----------------VVVPFPTMTFAEVLAACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPRELESAHHLLYTEPKKARSQHYDLVLNGN-EIGGGSIRIHNAELQRYILATLL-DVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKS...... 568
19 -35.8003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  22  49.....KEELEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELFKISDLGDIVGVRGTMFKTKVGE--LSIKVSSYEFLTKA---PLPEKYHGLEQRYRQRYLDLIMNESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHLDMTLYMRIAIELHLKRLIVGLEKVYEIGRVFRNEGIST-RHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTT--KIQYGEHLVD----LTPEWRRLHMVDAIKEYVGVDFWRQMFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPL-AKKNPDDPRFTDRFELFIANAFTEL---NDPIDQRQRFEEQLKEREQGNDEAH-FLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK... 493
20 -34.9001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  21  57.....NEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQKKWDLGDILGAKGKLFKTKTGE--LSIHCTELRLLTKA---PLPDKFHGLEARYRQRYLDLISNESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHLDLDMYLRIAPELYLKRLVVGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGK--TEVTYGDVTLD----FGKPFEKLTMREAIESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPL-ARRNDVNPEITDRFEFFIGNGFSEL---NDAEDQAQRFLDQVAAKDAGDDEAMFYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAM...... 500
21 -34.9001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  22  57.....NQELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQKKWDLGDIIGARGTLFKTQTGE--LSIHCTELRLLTKA---PLPDKFHGLEVRYRQRYLDLIANKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHLDLDMYLRIAPELYLKRLVVGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGT--TKVTYGEHVFD----FGKPFEKLTMREAIESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPL-ARRNDVNPEITDRFEFFIGNGFSEL---NDAEDQAERFQEQVNAKAAGDDEAMFYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAM...... 500
22 -32.1003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  47....LQPGDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYEEEFIHINNKLRRGDIIGVQGNPGKTKKGE--LSIIPYEITLLSPC--HMLPHLHFGLETRYRQRYLDLILNFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYHKMLVVGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDDFTPPFRRINMVEELEKALGMKLPETN-ARLLDKLVGEFLEVTCINPTFICDHPQIMSPL-AKWHRSKEGLTERFELFV-NAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFID-FCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAM...... 505
23 -30.9004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  47....LGNGEHLEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFHNHEKAECYDKIRRGDIVGIVGFPGKSKKGE--LSIFPKETILLSACHMLPMKYGLKDTEIRYRQRYLDLLINSSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHLDLDLYLRIATELPLKMLIVGIDKVYEIGKVFRNEGIDN-THNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKISYNKDGPENQPIEDFTPPYPKVSIVEEIEKVTNTILEQPFDSNETIEKMINIIKEHNDKPFFIVEHPQIMSPL-AKYHRTKPGLTERLEMFI-NAYTELNDPFKQKECFKLQQKDREKGDTEAAQLD-FCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTM...... 504
24 -28.8004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  20  47......EKSQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAYEEDFVSLTKMIYRGDICGFTGHPTRTKTGE--LSLIPISGMILSPC--HMLPSMHYGLETRFRKRYL-IVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHLDIQMYMRIAPELYLKELVVGINRVYEIGRLFRNEGIDQ-THNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGG-STKLEIKDRLMDINNEIPRPFNSAECSKVIEKHCTAPFKRISYVHALEEKFGEKIPRPLDGPTFLKKQAIRFNAILAKYHRSEPELTERFELFI-NAYTELNNPIVQRSNFEQQAKDKAAGDDEAQLVD-FLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTM...... 561
25 -28.3003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  16  9.........................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHFPFETRFVGINLYLMTSPEYHMKLLAAGCGPVFQLCRSFRNEEMGR-HHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLE-IDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIEKPTFIYHFPASQASL-AQISTEDHRVAERFEVYYANGFHELTDAREQQQRFEQDNRKRAARGLPQQPID-LLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFT........ 322
26 -28.1003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  15  22.........................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHVPFETRFVGMNLWLMTSPEYHMKLLVAGCGPVFQLCRSFRNEEMGR-YHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLE-IDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIEKPTFVYHFPASQASL-AQISTEDHRVAERFEVYYANGFHELTDAREQQQRFEQDNRKRAARGLPQHPID-LIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFS........ 335
27 -23.6004gla_C mol:protein length:109 OBody NL8  ali model follow..  16  16........PNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKAKA.......................................................................................................................................................................................................................................................................................................................................... 109
28 -22.6004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  18  14........PNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYRGKTPDHLFKVFAELSREDVVVIKGIVEAPVALDTGVEIFPSEIWILNKAKPLPID...................................................................................................................................................................................................................................................................................................................................... 113
29 -21.3004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  18  14........PNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYRGKTPDHLFKVFAELSREDVVVIKGIVEAVTRWDTGVEIFPSEIWILNKA............................................................................................................................................................................................................................................................................................................................................ 107
30 -21.3004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  17  15........PNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYRGKTPDHLFKVFAELSREDVVVIKGIVEAQYGSATGVEIFPSEIWILNKA............................................................................................................................................................................................................................................................................................................................................ 108
31 -21.2004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  16  18........PNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYYGKTPDHLFKVFAELSREDVVVIKGIVEAAADMHNGVEIFPSEIWILNKAK........................................................................................................................................................................................................................................................................................................................................... 113
32 -12.6002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  16  1................................................MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGK-----------LEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKKIFEIGPCYRKESDG-KEHLEEFTMLNFCQM-CTRENLESIITDFLNHL---------------------IDFKIVGDSCMVYGDTLDVMHG----------------------------------------------------------------ELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 271
33 -12.1004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  15  1................................................MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGK-----------LEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKKIFEIGPCYRKESDG-KEHLEEFTMLSFIQM-CTRENLESIITDFLNHL---------------------IDFKIVGDSCMVYGDTLDVMHG--------DLELSS-----------------------------------AVVGPIPLDREWGIDK----------------------------------------PWIGAGFGLERLLKVKHDFKNIKRA............ 271
34 -11.5004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  19  54..................................................................................................................................NYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKKIFEIGPCYRKESDGKE-HLEEFTMLNFFQM------GSGCTRENLESIITDFLNHLGIDFKIVGDSCS------------VYGDTLDVMHG----------------------------------------------------------------ELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRAA........... 254
35 -11.3003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  13  1...................................................MKGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERE-----------NYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKKIFEIGPCYRKESDG-KEHLEEFTMLVFWQM-CTRENLESIITDFLNHL---------------------IDFKIVGDSCMVFGDTLDVMHG----DLELSSALVGPIPLDREWGIDKPWIGAGFGLE-RLLKVKHDFKNIKRAARSES..................................................................................... 273
36 -9.5804bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  1..............................................................MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKKIFEIGPCYRKESDG-KEHLEEFTMLNFCQM------GSGCTRENLESIITDFLNHLGIDFKIVGDS------------CMVFGDTLDVMHG----------------------------------------------------------------ELSSAVVGPRPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 271
37 -9.3004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  18  55..................................................................................................................................NYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKKIFEIGPCYRKESDG-KEHLEEFTMLNFCQSGCTRENLESIITDFLNHL---------------------IDFKIVGDSCMVFGDTLDVMHG--------DLELSS-----------------------------------AVVGPIPLDREWGIDK----------------------------------------PWIGAGFGLERLLKVKHDFKNIKRA............ 254

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.