current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0019 Diaminopimelate decarboxylase, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MTFERLGTMNVNAEGHLEIGGVDTLKLTEKYGTPLYVYDVALIRDRARGFKKTFEELGVKAQVAYASKAFSAVAIYQLMAEEGLSLDVVSGGELYTAIKANFPPERIHFHGNNKSAEEIHMALDYGIGCFVIDNYYEISLLEDILIERNEKAAVLIRVTPGIEAHTHDYILTGQDDSKFGFGLTNGQAEKAIKQVLHASASFDLIGLHCHIGSQIFETTGFKLAARRIMDKLVEWHGTLGFDSKVLNLGGGFGVRYTAEDEPLEPSEYVRQIMDEVRDVANSNDIAIPEIWIEPGRSLVGEAGTTLYKVGSRKEVPGIRNYIAVDGGMSDNIRPALYDAHYDAVLAANPEKVAEETVAIAGKCCESGDMLIWDLPLPKSDAGEILAVFCTGAYGYAMASNYNRIPRPPVVFVENGMDKLIVARETYENLVQNDLSLLast
1 -125.0001hkv_A mol:protein length:453 DIAMINOPIMELATE DECARBOXYLASE  ali model follow..  40  12....WPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAF---GSGANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRVFA-TDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFGAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGTITLYEVGTVKDVTAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARLVLRRETVDDLLSLEV.. 446
2 -124.0002o0t_A mol:protein length:467 Diaminopimelate decarboxylase  ali model follow..  40  14....WPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAF---GSGANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAVRRVFA-TDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFGAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGTITLYEVGTVKDVTAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARLVLRRETVDDLLSLEVR. 449
3 -93.0001tuf_A mol:protein length:434 Diaminopimelate decarboxylase  ali model follow..  37  10............KDGRFFIDGYDAIELAEKFGTPLYVMSEEQIKINYNRYIEAFKRTGKEFIVAYAYKANANLAITRLLAKLGCGADVVSGGELYIAKLSNVPSKKIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVESGIAMKAIKMALEM-EYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVVELKEE-GIEIEDVNLGGGLGIPYYKDKQIPTQKDLADAIINTMLKY--KDKVEMPNLILEPGRSLVATAGYLLGKVHHIKETPV-TKWVMIDAGMNDMMRPAMYEAYHHIINCKVKNEK--EVVSIAGGLCESSDVFGRDRELDKVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTSKKGVFLIRERETYADLIAKDI.. 428
4 -75.8002j66_A mol:protein length:428 BTRK  ali model follow..  25  1................MNLDQAEITALTKRFETPFYLYDGDFIEAHYRQLRSRTNP---AIQFYLSLKANNNIHLAKLFRQWGLGVEVASAGELALARHAGFSAENIIFSGPGKKRSELEIAVQSGIYCIIAESVEELFYIEELAEKENKTARVAIRINPDKSFGSTA-IKMGGVPRQFGMDESM---LDAVMDAVRSLQFTKFIGIHVYTGTQNLNTDSIIESMKYTVDLGRNIYERYGIVCECINLGGGFGVPYFSHEKALDIGKITRTVSDYVQE-ARDTRFPQTTFIIESGRYLLAQAAVYVTEVLYRKASKG-EVFVIVDGGMHHHAASTFRGRSMRIPVREDSGRRELEKVTIAGPLCTPEDCLGKDVHVPALYPGDLVCVLNSGAYGLSFSPHFLGHPTPIEILKRNGSYELIRRKGTADDIVATQ... 416
5 -75.4002yxx_A mol:protein length:386 Diaminopimelate decarboxylase  ali model follow..  32  3......................ILRKVAEIHGTPTYVYFEETLRKRSRLVKEVFE--GVNLLPTFAVKANNNPVLLKILREEGFGMDVVTKGELLAAKLAGVPSHTVVWNGNGKSRDQMEHFLREDVRIVNVDSFEEMEIWRELN---PEGVEYFIRVNPEVDAKTHPHISTGLKKHKFGIPL------EDLDSFMERFRSMNIRGLHVHIGSQITRVEPFVEAFSKVVRASE------RYGFEEINIGGGWGINY--SGEELDLSSYREKVVPDLKR--------FKRVIVEIGRYIVAPSGYLLLRVVLVKRRHN-KAFVVVDGGMNVLIRPALYSAYHRIFVLGK--QGKEMRADVVGPLCESGDVIAYDRELPEVEPGDIIAVENAGAYGYTMSNNYNSTTRPAEVLVRENGRISLIRRETEMDIFKDV... 384
6 -73.9002p3e_A mol:protein length:420 Diaminopimelate decarboxylase  ali model follow..  37  14............RDGELFIEGVSLKELAQTFGTPLYVYSSNFIKERFEAYRKAFP----DALICYAVKANFNPHLVKLLGELGAGADIVSGGELYLAKKAGIPPERIVYAGVGKTEKELTDAVDSEILMFNVESRQELDVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQKSKFGVDIREAQ---KEYEYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQK-GFDIKYLDIGGGLGIKYKPEDKEPAPQDLADLLKDLLENV---------KIILEPGRSIMGNAGILITQVQFLKDKGS-KHFIIVDAGMNDLIRPSIYNA-YHHIIPVETKERKKVVADIVGPICETGDFLALDREIEEVQRGEYLAVLSAGAYGFAMSSHYNMRPRAAEVLVENGSVKLIRKRENYDYIVEPSLDI 420
7 -72.5003n2b_A mol:protein length:441 Diaminopimelate decarboxylase  ali model follow..  33  25...........QEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVG--DYPHLICYAVKANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIKCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA---QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAE-GIHIRHLDVGGGLGVVY-RDELPPQPSEYAKALLDRLERHRD-------ELIFEPGRAIAANAGVLVTKVEFLKHTEH-KNFAIIDAAMNDLIRPALYQA-WQDIIPLRPRQGEAQTYDLVGPVCETSDFLGKDRDLV-LQEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALE... 430
8 -71.9002qgh_A mol:protein length:425 Diaminopimelate decarboxylase  ali model follow..  32  17......................NYEELFQTHKTPFYLYDFDKIKQAFLNYKEAFK--GRKSLICYALKANSNLSILSLLAHLESGADCVSIGEIQRALKAGIKPYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVGEKEA---LEMFLWAKKSAFLEPVSVHFHIGSQLLDLEPIIEASQKVAKIAKSLIAL-GIDLRFFDVGGGIGVSY-ENEETIKLYDYAQGILNALQGL---------TIICEPGRSIVAESGELITQVLYEKKAQN-KRFVIVDAGMNDFLRPSLYHAKHAIRVITPSKGREISPCDVVGPVCESSDTFLKDAHLPELEPGDKIAIEKVGAYGSSMASQYNSRPKLLELALEDHKIRVIRKREALEDLWRLE... 412
9 -71.1003vab_A mol:protein length:443 Diaminopimelate decarboxylase 1  ali model follow..  31  23............RNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFA--DMDTLVTYALKANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIYCFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDKAR---AAYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQAD-GHNIRHVDVGGGLGIPYRTPNTPPPPVAYAQIVAKHIKPL---------KTVFEPGRLIVGNAGLLVTEVIFVKEGDA-KNFVIVDAAMNDLIRPTLYDAFHDIRVIMPNDNAPRIRADFVGPVCETGDYLGLDREVAKPAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLGDGERYHVVRPRRTYEELLALD... 431
10 -70.1001knw_A mol:protein length:425 Diaminopimelate decarboxylase  ali model follow..  28  11.................DLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQF-------DVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPDDIVFTADVIDQATLERVSELQI-PVNAGSVDMLDQLGQVSPG----HRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQ----RHHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQV-----IEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPV-KLEIEPGRFLVAQSGVLITQVRSVKQMGS-RHFVLVDAGFNDLMRPAMYGSYHHISALAALEHAPTVETVVAGPLCESGDVFTQQEALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALEL.. 419
11 -68.7004xg1_A mol:protein length:427 Diaminopimelate decarboxylase  ali model follow..  31  7...........QNDGRLFVEGLPVEQVVKKTGTPAYIYSRATIERHWQAFDSAAGKH--PHLICYAVKANSNLAVLNLMARMGSGFDIVSVGELMRVIQAGGDPKKIVFSGVGKTEIEISAALQANIMCFNVESISELYRINSVAKALNVKAPISIRINPNIDAGTHPYISTGLKENKFGIEIEQAL---DVYKIASDLEFLEIKGVDCHIGSQLTEIAPFIEALDKLLILIDLLAEK-GITISHLDLGGGLGVPY-DDETPPEPAEYMTAIINRMAGR---------KLIFEPGRAIMANAGVLVTKVEFLKLNDY-KNFAIVDAAMNDLIRPALYSAWQNIIPLNTGQDRPVRSYDIVGPICETGDFLGKERQLA-LAEGDYLVIRSTGAYGSTMSSNYNSRCRAAEILVDGEKAFIVREREELKDLWRGE... 416
12 -43.6002plj_A mol:protein length:419 lysine/ornithine decarboxylase  ali model follow..  20  40.......................IEASVEQFGAPLLLLDCDVIRQQYRALKNAL----PNVTLHYALKPLPHPVVVRTLLAEGASFDLATTGEVELVASEGVPADLTIHTHPIKRDADIRDALAYGCNVFVVDNLNELEKFKAYRDD----VELLVRLS------FRNSEAFADLSKKFGCSPEQALVIIETAKEW----NIRIKGLSFHVGSQTTNPNKYVEAIHTCRHVMEQVVERGLPALSTLDIGGGFPVNYTQQVM--PIDQFCAPINEALSLL-----PETVHVLAEPGRFICAPAVTSVASV-MGQAEREGQIWYYLDDGIYGSFSGLMFDDARYPLTTIKQGGELIP-SVLSGPTCDSVDVIAENILLPKLNNGDLVIGRTMGAYTSATATDFNFFKRAQTIALNE...................... 403
13 -41.0002nv9_A mol:protein length:372 A207R protein, arginine decarboxylase  ali model follow..  18  7......................NILKAHPHQTKSFYVSSPKIVEDLIDQWTILF----PRVTPHYAVKCNNDEVLLKTMCDKNVNFDCASSSEIKKVIQIGVSPSRIIFAHTMKTIDDLIFAKDQGVDIATFDSSFELDKIHTYHPN----CKMILRIR------CDDPNAAVQLGNKFGANEDEIRHLLEYAKQL----DIEVIGISFHVGSGSRNPEAYYRAIKS-SKEAFNEAISVGHKPYILDIGGGL----ADIDEGELSTYMSDYINDAIKDFFPEDTV---TIVAEPGRFFAEHYSVLATQVIGKRVRDGLYEYF-FNESTYGGFSNVIFEKSVPTLLRDVPDDEEYVPSVLYGCTCDGVDVINHNVALPELHIGDWVYFPSWGAYTNVLTTSFNGFGEYDVYYI........................ 372
14 -40.2001f3t_A mol:protein length:425 ORNITHINE DECARBOXYLASE  ali model follow..  22  29.......................ISMNTCDEGDPFFVADLGDIVRKHETWKKCL----PRVTPFYAVKCNDDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIRYARDSGVDVMTFDCVDELEKVAKTHPK----AKMVLRIS------TDDSLARCRLSVKFGAKVEDCRFILEQAKKL----NIDVTGVSFHVGSGSTDASTFAQAISD-SRFVFDMGTELGFNMHILDIGGGF----GTRDAPLKFEEIAGVINNALEKHFPPDL----TIVAEPGRYYVASAFTLAVNVIAKKVTPGVQTMYYVNDGVYGSFNCILYDVVRPLPQREPIPNEKLYPSSVWGPTCDGLDQIVERYYLPEMQVGEWLLFEDMGAYTVVGTSSFNGFQSPTIYYVVSGLPDHVVRE............. 419
15 -38.5007odc_A mol:protein length:424 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  21  24..................LDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKAL----PRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPK----AKLVLRIA------TDDSKAVCRLSVKFGATLKTSRLLLERAKEL----NIDVIGVSFHVGSGCTDPDTFVQAVSD-ARCVFDMATEVGFSMHLLDIGGGF----GSEDTKLKFEEITSVINPALDKYFPSDS----RIIAEPGRYYVASAFTLAVNIIAKKTVWEQTFMYYVNDGVYGSFNCILYDHAHVKLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLMK.............. 418
16 -37.4002oo0_A mol:protein length:471 Ornithine decarboxylase  ali model follow..  22  34..................LDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKAL----PRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPK----AKLVLRIA------TDDSKAVCRLSVKFGATLRTSRLLLERAKEL----NIDVVGVSFHVGSGCTDPETFVQAISD-ARCVFDMGAEVGFSMYLLDIGGGF----GSEDVKLKFEEITGVINPALDKYFPSDS----RIIAEPGRYYVASAFTLAVNIIAKKIVLEQTFMYYVNDGVYGSFNCILYDHAHVKLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQ............. 429
17 -37.4004zgz_A mol:protein length:438 Antizyme inhibitor 1  ali model follow..  20  30.......................VYEHTLTGKNAFFVGDLGKIVKKHSQWQNVV----AQIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKIARNHPN----AKVLLHIA------TEDNIGGEEGNMKFGTTLKNCRHLLECAKEL----DVQIIGVKFHVSSACKESQVYVHALSD-ARCVFDMAGEIGFTMNMLDIGGGF------TGTEFQLEEVNHVISPLLDIYFPEGS---VKIISEPGSYYVSSAFTLAVNIIAKKVVENPAFMYYMNDGVYGSFASKLSEDLNTIVHKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQ.............. 417
18 -37.2003btn_A mol:protein length:448 Antizyme inhibitor 1  ali model follow..  20  29.......................VYEHTLTGKNAFFVGDLGKIVKKHSQWQTVV----AQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPN----AKVLLHIA------TEDNIGGEDGNMKFGTTLKNCRHLLECAKEL----DVQIIGVKFHVSSACKEYQVYVHALSD-ARCVFDMAGEFGFTMNMLDIGGGF------TGTEIQLEEVNHVISPLLDIYFPEGS----QIISEPGSYYVSSAFTLAVNIIAKKVVEEPAFVYYMNDGVYGSFASKLSEDLNTIVHKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDWYEMQ.............. 416
19 -35.3004aib_A mol:protein length:395 ORNITHINE DECARBOXYLASE  ali model follow..  18  12..................ALNLISQFEPENQPLGFWIFDTEGVEKAVERWKKNM----PTVRPCFAVKCNPEPHLVKLLGELGCGFDCASLNEIKEVLDLGFNPEDITYSQTFKPYNQLIEASHLGINHTIVDSIDEVQKIAKYAPK----MGIMIRIM------ENDTSAGHVFGEKFGLHDDEVEIVLKEIKDK----GLNLDGVHFHVGSDSHNSEVFTKALTK-ARNTVTLAEQFGMKPYLIDIGGGF-------SQVAPFEEFAATIEKTIKELEFPERT---RFIAEPGRYMASNAFHLVSSLHGKRVRIQNGKYTSGDGGSFGCCIWFEKQKSCECITQKVNENTKMYESIIYGPSCNGSDKVATQELPEMEPGKDWLLFPNMGAYTISMATNFNGFEERNHVI......................... 381
20 -24.5003mt1_A mol:protein length:365 Putative carboxynorspermidine decarboxylase p  ali model follow..  16  4................................TPYYLIDKAKLTRNMERIAHVREKSG--AKALLALKCFATWSVFDLMRD---YMDGTTSSSLFEVLGRERFGKETHAYSVAYGDNEIDEVVSH-ADKIIFNSISQLERFADKAAG----IARGLRLNPQVSSSSFDLADPARPFSRLGEWDVP----------KVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDW----VSLGGGIHFTGDDYP--------VDAFSARLRAFSDRYGV---QIYLEPGEASITKSTTLEVTV--LDTLYNGKNLAIVDSSIEAHM-LDLLIYRETAKVLP---NEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADY....... 360
21 -23.9003n2o_A mol:protein length:648 Biosynthetic arginine decarboxylase  ali model follow..  19  29.........GIDDQGEMYVHQIQLSKIVKQLNVPVLVRFPQILHQRVHSICDAFNQYPNKYLLVYPIKVNQQREVVDEILASQLGLEAGSKPELLAVLAMAQHASSVIVCNGYKDREYIRLALGEKLGHIVLEKMSELDLVLREAKSLGVTPRLGIRIRLASQG-AGKWQASGGEKSKFG--LSASQVLNVISRLKKENQLDTLQLVHFHLGSQMANIRDVRNGVNESARFYCELR-TLGANITYFDVGGGLAIDYSSNSMNYGLVEYARNIVNTVGDVCKDYKQPMPVIISESGRSLTAHHAVLISNVIGTETYKPEQTSLRIYYELNRLMSTSLFQS-FPVLPLSGLQNAADRRAVMLDITCDSGQGIESTLPVPAWNEDELMGFFLVGAYQEILGDMHNLFGDTHSVVVDQGEINIINEGDTVEDMMR..... 594
22 -23.5003nzq_A mol:protein length:666 Biosynthetic arginine decarboxylase  ali model follow..  21  50.........DVNELGHISVARVDLAQLVKTQRLPALFCFPQILQHRLRSINAAFKRYNGDYFLVYPIKVNQHRRVIESLIHSGLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYIRLALGEKMGHLVIEKMSEIAIVLDEAERLNVVPRLGVRARLASQG-SGKWQSSGGEKSKFG--LAATQVLQLVETLREAGRLDSLQLLHFHLGSQMANIRDIATGVRESARFYVELH-KLGVNIQCFDVGGGLGVDYSDCSVNYGLNEYANNIIWAIGDACEENGLPHPTVITESGRAVTAHHTVLVSNIIGVERNEYTVPYLSMCHEVQKQLDPSLFQS-FPVLPLEGLDQVPERRAVLLDITCDSGDGIATTMPMPEYDPENMLGFFMVGAYQEILGNMHNLFGDTEAVDVPDGSVEVSDEGDTVADMLQ..... 611
23 -23.3003nzp_A mol:protein length:619 Arginine decarboxylase  ali model follow..  19  19......GKVCINYEKKPAIIDIVKELRDDGYKGPLLLRFPHLIQKQIENIYGNFNKYKGGFNAVYPLKVNQYPGFVKNLVKLGYGLEAGSKAELLLAMAYNNEGAPITVNG--KDRELINIGFAAEMGHLTIEGLNELEAIIDIAKERKPKPNIGLRVRLHSAG-VGIWAKSGGINSKFG--LTSTELIEAVNLLKENKLLEQFTMIHFHLGSQITEIHPLKKALNEAGNIYTELRKMGAKNLKAINLGGGLAVEYNEKSRNYTLREYANDVVFILKNIAEQKKDLEPDIFIESGRFVAANHAVLIAPVLELFSQEYAENKLILKKQNPKLIDESLFQS-FPIMPLDRLDEEPTRSASIWDITCDSDGEISYSKDVDVEKENYFLGFFLVGAYQEVLGMKHNLFTHPTEAIISINEKGYIIEAQSILDTLE..... 561
24 -23.1003n29_A mol:protein length:418 Carboxynorspermidine decarboxylase  ali model follow..  15  34............................EKIQTPAYILEEDKLRKNCELLASVGEKSG--AKVLLALKGFAFSGAMKIVGE---YLKGCTCSGLWEAFAKEYMDKEIHTYSPAFKEDEIGEIASLS-HHIVFNSLAQFHKFQSKTQK----NSLGLRCNVEFSLAPKELYNPCGRYSRLGIRAKD----------FENVDLNAIEGLHFHA----------EESADALEAVLKVFEEKFG-QMKWVNFGGGHHITKKGYD--------VEKLIALCKNFSDKYGV---QVYLEPGEAVGWQTGNLVASV--VDIIENEKQIAILDTSSEAHM-PDTIIMPYTSEVLNARILATREAYLLTGNTCLAGDVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLDHKNELQMIREFSYKDYSLRN... 412
25 -12.0003llx_A mol:protein length:376 Predicted amino acid aldolase or racemase  ali model follow..  13  9...........................IAHPDTPYLLIDEAKLKSNINYLKQRVESLGSHLRPHL--KTLRTLEAAGYLLDSKSPATVSTLAEAEAYAKAGYTDLLYAVGIAPAKLKRVAALRQQGINHILLDNITQAQAVVDYAAEFGQDFSVFIEIDSDDH--------------RGGIKPSDSKLLT-----IAKTLGEHFTGLMTHAGGSY-GLKNFAKQECDAVRIARNNLETAGIHCAITSVGS-------------TPTAHFGEDFSDISE-------------VRAGVYTTFDLHIAMSVVTTVIGHNKEKNWLLTDSGLSRDSGTAGQNRDFGYGQVCKIDGSVLDGLCVNSTSQEHGVIELSDYQLEDFPVGHQLRIMPNHA............................................ 348
26 -12.0003wqc_A mol:protein length:390 D-threo-3-hydroxyaspartate dehydratase  ali model follow..  14  1...................GAMSMQDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHV--KTSKSVPVAAAQRAAGAGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGH--------------RSGVGADDTPLLLAIGR-TLHDGGMRLGGVLTHAGSSY-ALQALAERERAGCVQAAEALRAAGLPCPVVSVGS-------------TPTALAASRLDGVTE-------------VRAGVYVFFDL-VALSVLATVIGHQADKGWAIVDAGMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADDIATRFPLGTRLRILPNHA............................................ 356
27 -11.8003anu_A mol:protein length:376 D-serine dehydratase  ali model follow..  12  7...........................LDTLPTPALTIDRTTARRNAERMRERCRALGVRLRPHV--KTHKTLEGGLLATGGTRGIAVSTLAEARFFADGGFDDILLAYPVPTARLEECAGLARRLDAHVLLDRPEALASLRQRPLGHGKRWLVWLKLDCG--------------NGRAGVRPTDPAALELAQAIANAPEEVTLVGVYAHCGNTY-TIQAIARTTTNAVLSFVAALRQAGVPCPQASIGSTPSCSHPIPEMSQLTE-------------------------LHPGNYIFYDL-VAIRVLTRVIGHYAHRGQLLVDCGWLHGAGAGQGPQGCAAIDGH-------PELRLVGLTQEHGLLEHAGMDFGRFPVGSVLALIPYHA............................................ 348
28 -11.6001vfh_A mol:protein length:386 alanine racemase  ali model follow..  12  1..........................MNETPTRVYAEIDLDAVRANVRALRARAPRSALMAVVKSNAYGHGAVPCARAAQEAGAALGTATPEEALELRAAGIQGRIMCW---WTPGGPWREAIETDI-DVSVSGMWALDEVRAAARAAGRTARIQLKADTGL--------------GRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPAT-----TLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALV-VSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKI--------RRAAGRIA---DQFVVDLGEDLAEAGDEAVILGAHTIAYEIVTRIGRVPR---VYLGGLE.................... 380
29 -10.6004v15_A mol:protein length:379 D-THREONINE ALDOLASE  ali model follow..  15  21...........................LARVDTPSLVLDLPAFEANLRAMQAWADRHEVALRPH--AKAHKCPEIALRQLALGRGICCQKVSEALPFVAAGIRDIHISNEGPAKLALLGQLARAAKI-SVCVDNAENLAQLSAAMTRAGAEIDVLVEVDVGQ--------------GRCG--VSDDATVLALAQQARALPGLNFAGLQAYHGSV--ERAAVCRQAARIAASYAQLLRESGIACDTITGGG-------------TGSVEFDAASGVYTELQAGSYAFMDSDYGANEWNGPLKFQNSLFVLSTVMSTPA-PGRVILDAGTTAECGPPAVYGEPGLTYAAINDEHGVVRVEPGAQAPALGAVL.................................................................. 341
30 -10.4001xfc_A mol:protein length:384 Alanine racemase  ali model follow..  13  15....................................MVDLGAIEHNVRVLREHAGHAQLMAVVKADGYGHGATRVAQTALGAGAALGVATVDEALALRADGITAPVLAW---HPPGIDFGPALLADV-QVAVSSLRQLDELLHAVRRTGRTATVTVKVDTGL--------------NRNGVGPAQFPAMLTALRQAMAEDAVRLRGLMSHMVYADKPDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSAT------------ARPDLTFDLVRPGIAVYGLALGDMGLVPAMTVKCAVALV-VSYGHTWIAPRDTNLALLPIGYADGV-FRSLGGRLEVLINGR-------RCPGVGRICMDQFMVDLGPGPLDVAEGDEAILFGVGTIHYEVVTSPRRITR---TYREAENR................... 384
31 -10.4004dza_A mol:protein length:407 lysine racemase  ali model follow..  15  47.....................................ISRSALDFNVKKVQSLLGKQSSLCAVLKGAYGHDLSLVAPIMIENNVKIGVTNNQELKEVRDLGFKGRLMRV--RNATEQEMAQATNYNV-EELIGDLDMAKRLDAIAKQQNKVIPIHLALNSG---------------SRNGLEVDNKSGLEKAKQ-ISQLANLKVVGIMSHYPEEDANKVREDLARFKQQSQQVLEVMGLERNNVTLHMANTFAT------------TVPESWLDMVRVGGIFYGDTIASTDYKRVMTFKSNI-ASINYYPKGNTVGYDRTYTLKRDSVLANI-PVGYADGYRRVFSNAGH--AGQRVPVLGKTS-MNTVIVDITSLNNIKPGDEVVFFGSGALFTEMSILWGTNQRVLV........................... 406
32 -10.4004bf5_A mol:protein length:417 ALANINE RACEMASE  ali model follow..  14  46.....................................VDLGAFEHNIQTLKDRLGDKGPKICAIMKADAY-IDLLVPSVVKAGIPIGIASNEEARVAREKGFTGRLMRV--RAATPAEVEQALPYKM-EELIGSLVSAQGIADIAQRHHTNIPVHIALSAGM--------------SRNGIDLRLADSKEDALAMLKL-KGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITIHAANSFAT------------EVPDAYFDMVRPGGLLYGDIPSYTEYKRVMAFKTQV-ASVNHYPAGNTVGYDRTFTLKRDSWLANL-PLGYSDGYRRALSNKAY--QGQKVPVVGKTS-MNTIMVDVTDLKGVKPGDEVVLFGNGALLADMYTIWGY---PKKIKRSSG..................... 411
33 -10.3004beu_A mol:protein length:392 ALANINE RACEMASE  ali model follow..  13  24.....................................ISLGQFQSNIEQFKSHMNANTKICAIMKAAYGNGIRGLMPTIIAQGIPVGVASNAEARAVRESGFKGELIRV--RSASLSEMSSALDLNI-EELIGTHQQALDLAELAKQSGKTLKVHIALN-----------DGGM--GRNGIDMTTEAGKKEAVS-IATQPSLSVVGIMTHFPNYNADEVRAKLAQFKESSTWLMQQANLKREEITLHVANSYTA------------NVPEAQLDMVRPGGVLFGDLPTNPEYPSIVSFKTRV-SSLHHLPKDSTVGYDSTFTTSRDSVLANL-PVGYSDGYPRKMGNKAE--NGQRAKVVGVTS-MNTTVVDVTEIKGVLPGQEVVLFGAELIFPELYTLWGSNPR---FYVKSS..................... 386
34 -9.5203gwq_A mol:protein length:426 D-serine deaminase  ali model follow..  15  40..........................LNEDVSLPAAVLYADRVEHNLKWMQAFVAEYGV--KLAPHGKTTMAPQLFRRQLETGAGITLATAHQVRAAYHGGVSANQLVGRRNMMMVAELLSDPEFEF-FCLVDSVEGVEQLGEFFKSVNKQLQVLLEL--------------GVPGGRTGVR-DAAQRNAVLEAITRYPDTLKLAGVELYEGV-LKEEHEVREFLQSAVAVTRELVEQERFARAPAVLSGA--------------SAWYDVVAEEFVKASETGKV---EVVLRPGCYLTHDVG--IYR----KAQTDIFARNPVAKKMGEGLLPALQ------LWAYVQSIPEPDRAIILGK-------SAFDAGMPEPAEAPRDIAASEGWEIFGLMDQHAYLRIPAGADLKVGD.................... 390
35 -9.3404kbx_A mol:protein length:388 Uncharacterized protein YhfX  ali model follow..  12  1.XMFVEALKRQNPA----ISAALSLWQQGKIAPDSWVIDVDQILENGKRLIETARLYGI--ELYLMTKQFG--WLAEKLLALGYGIVAVDYKEARVMRRAGLPVAHQGHLVQIPCHQVADAVEQGTD-VITVFTLDKAREVSAAAVKAGRIQSVLLKVYSD--------------DDFLYPGQESGFALKVLPEIIQNLPGLHLAGLTHFPCLLWDEAVGKVLPTPNLHTLARDQLAKSGIALEQLNAPSATSCTSLPLLAQYGVTH------------------------AEPGHALTGTIPANQQGDQPERIAMLWLSEISHHFRGDSYCYGGGYYRRGHAQHALVFTPENQKITETNLKTVDDSSIDYTLPLAGEFPVSSAVVLFVTRSDVVLVSGIHRGEPEIVGRYDSLGN.................... 384
36 -9.2404lus_A mol:protein length:385 Alanine racemase  ali model follow..  15  12.....................................INLDNLRFNLNNIKNLLEEDIKICGVIKAAYGHGAVEVAKLLEKEKVDYLAVARTAEGIELRQNGITLPILNLGYTPD-EAFEDSIKNKI-TMTVYSLETAQKINEIAKSLGEKACVHVKIDSGM--------------TRIGFQPNEESVQEIIE--LNKLEYIDLEGMFTHFATADEVSKEYTYKQANNYKFMSDKLDEAGVKIAIKHVSNSAAI------------DCPDLRLNMVRAGIILYGH-YPSDDVFKDRLELRPAMKLKSKIGHIKQVEP-LKYTTTGKETIATV-PIGYADGFTRIQKNPKVLIKGEVFDVVGRIC-MDQIMVRIDKDIDIKVGDEVILFGLGTINYEVLCMISRVDR---VYMENNE.................... 375
37 -9.1904dyj_A mol:protein length:409 broad specificity amino acid racemase  ali model follow..  13  48.....................................VSASALQHNIRTLQAELAGKSRLCAVLKAAYGHGIGLVMPSIIAQGVPVAVASNEEARVVRASGFTGQLVRV--RLASLSELEDALQYDM-EELVGSAEFARQVDAIAARHGKTLRIHMALSSGM--------------SRNGVEMATWSGRGEALQITDQ-KHLKLVALMTHFAVEDKDDVRKGLAAFNEQTDWLIKHAKLDRSKLTLHAANSFAT------------EVPEARLDMVRTGGALFGDVPARTEYQRAMQFKSHV-AAVHSYPAGNTVGYDRTFTLARDSRLANI-TVGYSDGYRRVFTNKGH--NGHRIPVVGKVS-MNTLMVDVTDFPDVKGGNEVVLFGNGALLADLYTVWGSNPKILV........................... 408

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.