current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0019 Diaminopimelate decarboxylase, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MTFERLGTMNVNAEGHLEIGGVDTLKLTEKYGTPLYVYDVALIRDRARGFKKTFEELGVKAQVAYASKAFSAVAIYQLMAEEGLSLDVVSGGELYTAIKANFPPERIHFHGNNKSAEEIHMALDYGIGCFVIDNYYEISLLEDILIERNEKAAVLIRVTPGIEAHTHDYILTGQDDSKFGFGLTNGQAEKAIKQVLHASASFDLIGLHCHIGSQIFETTGFKLAARRIMDKLVEWHGTLGFDSKVLNLGGGFGVRYTAEDEPLEPSEYVRQIMDEVRDVANSNDIAIPEIWIEPGRSLVGEAGTTLYKVGSRKEVPGIRNYIAVDGGMSDNIRPALYDAHYDAVLAANPEKVAEETVAIAGKCCESGDMLIWDLPLPKSDAGEILAVFCTGAYGYAMASNYNRIPRPPVVFVENGMDKLIVARETYENLVQNDLSLLast
1 -110.0002o0t_A mol:protein length:467 Diaminopimelate decarboxylase  ali model follow..  39  13...VWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAFGS---GANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAV-RRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGTITLYEVGTVKDVDAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARLVLRRETVDDLLSLEV.. 448
2 -109.0005x7m_A mol:protein length:453 Diaminopimelate decarboxylase  ali model follow..  41  14...VWPRNAVRQEDGVVTVAGVPLPDLAEEYGTPLFVVDEDDFRSRCRDMATAFGG---PGNVHYASKAFLTKTIARWVDEEGLALDIASINELGIALAAGFPASRITAHGNNKGVEFLRALVQNGVGHVVLDSAQELELLDYVAAGEGKIQDVLIRVKPGIEAHTHEFIATSHEDQKFGFSLASGSAFEAA-KAANNAENLNLVGLHCHVGSQVFDAEGFKLAAERVLGLYSQIHSELGVALPELDLGGGYGIAYTAAEEPLNVAEVASDLLTAVGKMAAELGIDAPTVLVEPGRAIAGPSTVTIYEVGTTKDVDKTRRYIAVDGGMSDNIRPALYGSEYDARVVSRFAEGDPVSTRIVGSHCESGDILINDEIYPDITSGDFLALAATGAYCYAMSSRYNAFTRPAVVSVRAGSSRLMLRRETLDDILSLEA.. 445
3 -109.0001hkv_A mol:protein length:453 DIAMINOPIMELATE DECARBOXYLASE  ali model follow..  39  11...VWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAAFGS---GANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAV-RRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEFTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPGTITLYEVGTVKDVDAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARLVLRRETVDDLLSLEVR. 447
4 -106.0001tuf_A mol:protein length:434 Diaminopimelate decarboxylase  ali model follow..  36  2....LGNDTVEIKDGRFFIDGYDAIELAEKFGTPLYVMSEEQIKINYNRYIEAFKRWGKEFIVAYAYKANANLAITRLLAKLGCGADVVSGGELYIAKLSNVPSKKIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVESGIAM-KAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVVELKEE-GIEIEDVNLGGGLGIPYYKDKQIPTQKDLADAIINTMLKYKDK--VEMPNLILEPGRSLVATAGYLLGKVHHIKETPV-TKWVMIDAGMNDMMRPAMYEAYHHIINCKV--KNEKEVVSIAGGLCESSDVFGRDRELDKVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTSKKGVFLIRERETYADLIAKDI.. 428
5 -104.0003vab_A mol:protein length:443 Diaminopimelate decarboxylase 1  ali model follow..  31  18.......NHFEYRNGVLHAENVSLPEIAKAVGTPFYVYSRATIERHFRVFHDAFADM--DTLVTYALKANSNQAVLTALAKLGAGADTVSQGEIRRALAAGIPANRIVFSGVGKTPREMDFALEAGIYCFNVESEPELEILSARAVAAGKVAPVSLRINPDVDAKTHAKISTGKSENKFGIPRDK---ARAAYARAASLPGLNVVGIDMHIGSQIIDLEPFDNAFALMAELVKELQAD-GHNIRHVDVGGGLGIPYRTPNTPPPPVAYAQIVAKHIKPL-------GLKTVFEPGRLIVGNAGLLVTEVIFVKEGDA-KNFVIVDAAMNDLIRPTLYDAFHDIRPVIMPNDNPRIRADFVGPVCETGDYLGLDREVAKPAPGDLIAICTTGAYGAVLSSTYNSRLLIPEVLGDGERYHVVRPRRTYEELLALDS.. 432
6 -102.0002p3e_A mol:protein length:420 Diaminopimelate decarboxylase  ali model follow..  36  9.......PYLEYRDGELFIEGVSLKELAQTFGTPLYVYSSNFIKERFEAYRKAFP----DALICYAVKANFNPHLVKLLGELGAGADIVSGGELYLAKKAGIPPERIVYAGVGKTEKELTDAVDSEILMFNVESRQELDVLNEIAGKLGKKARIAIRVNPDVDPKTHPYIATGMQKSKFGVDIRE---AQKEYEYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLYESLTQK-GFDIKYLDIGGGLGIKYKPEDKEPAPQDLADLLKDLLENV-------KAKIILEPGRSIMGNAGILITQVQFLKDKGS-KHFIIVDAGMNDLIRPSIYNAYHHIIPVET-KERKKVVADIVGPICETGDFLALDREIEEVQRGEYLAVLSAGAYGFAMSSHYNMRPRAAEVLVENGSVKLIRKRENYDYIVEPSLDI 420
7 -102.0002qgh_A mol:protein length:425 Diaminopimelate decarboxylase  ali model follow..  31  1........MGSSSSGLVPRGSFNYEELFQTHKTPFYLYDFDKIKQAFLNYKEAFKGR--KSLICYALKANSNLSILSLLAHLESGADCVSIGEIQRALKAGIKPYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVGEKE---ALEMFLWAKKSAFLEPVSVHFHIGSQLLDLEPIIEASQKVAKIAKSLIAL-GIDLRFFDVGGGIGVSYE-NEETIKLYDYAQGILNALQGL-------DLTIICEPGRSIVAESGELITQVLYEKKAQN-KRFVIVDAGMNDFLRPSLYHAKHAIRVITPSKGREISPCDVVGPVCESSDTFLKDAHLPELEPGDKIAIEKVGAYGSSMASQYNSRPKLLELALEDHKIRVIRKREALEDLWRLEEEG 415
8 -101.0004xg1_A mol:protein length:427 Diaminopimelate decarboxylase  ali model follow..  31  2......DHFNYQNDGRLFVEGLPVEQVVKKTGTPAYIYSRATIERHWQAFDSAAGKH--PHLICYAVKANSNLAVLNLMARMGSGFDIVSVGELMRVIQAGGDPKKIVFSGVGKTEIEISAALQANIMCFNVESISELYRINSVAKALNVKAPISIRINPNIDAGTHPYISTGLKENKFGIEIEQ---ALDVYKIASDLEFLEIKGVDCHIGSQLTEIAPFIEALDKLLILIDLLAEK-GITISHLDLGGGLGVPYDDETPPEP--------AEYMTAIINRMAGRSLKLIFEPGRAIMANAGVLVTKVEFLKLNDY-KNFAIVDAAMNDLIRPALYSAWQNIIPLNTGQDRPVRSYDIVGPICETGDFLGKERQLA-LAEGDYLVIRSTGAYGSTMSSNYNSRCRAAEILVDGEKAFIVREREELKDLWRGEH.. 417
9 -99.5003n2b_A mol:protein length:441 Diaminopimelate decarboxylase  ali model follow..  32  14FQSNAMDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDY--PHLICYAVKANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIKCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDR---AAQVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAE-GIHIRHLDVGGGLGVVYRDEL-PPQPSEYAKALLDRLERH------RDLELIFEPGRAIAANAGVLVTKVEFLKHTEH-KNFAIIDAAMNDLIRPALYQAWQDIIPLRP-RQGEAQTYDLVGPVCETSDFLGKDRDLV-LQEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALES.. 431
10 -97.9002j66_A mol:protein length:428 BTRK  ali model follow..  25  1................MNLDQAEITALTKRFETPFYLYDGDFIEAHYRQLRSRTNP---AIQFYLSLKANNNIHLAKLFRQWGLGVEVASAGELALARHAGFSAENIIFSGPGKKRSELEIAVQSGIYCIIAESVEELFYIEELAEKENKTARVAIRINPDKSFGST-AIKMGGVPRQFGMDESM---LDAVMDAVRSLQFTKFIGIHVYTGTQNLNTDSIIESMKYTVDLGRNIYERYGIVCECINLGGGFGVPYFSHEKALDIGKITRTVSDYVQEA-RDTRFPQTTFIIESGRYLLAQAAVYVTEVLYRKASKG-EVFVIVDGGMHHHAASTFRGRSMRIPVREDSGRRELEKVTIAGPLCTPEDCLGKDVHVPALYPGDLVCVLNSGAYGLSFSPHFLGHPTPIEILKRNGSYELIRRKGTADDIVATQL.. 417
11 -96.6001knw_A mol:protein length:425 Diaminopimelate decarboxylase  ali model follow..  28  3.........HSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQFDV-------VRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPDDIVFTADVIDQATLERVSELQI-PVNAGSVDMLDQLGQVSPG----HRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQR----HHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQV-----IEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLG-HPVKLEIEPGRFLVAQSGVLITQVRSVKQMGS-RHFVLVDAGFNDLMRPAMYGSYHHISALAADEHAPTVETVVAGPLCESGDVFTQQRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALEL.. 419
12 -96.2002yxx_A mol:protein length:386 Diaminopimelate decarboxylase  ali model follow..  33  4.......................LRKVAEIHGTPTYVYFEETLRKRSRLVKEVFEG--VNLLPTFAVKANNNPVLLKILREEGFGMDVVTKGELLAAKLAGVPSHTVVWNGNGKSRDQMEHFLREDVRIVNVDSFEEMEIWRELN---PEGVEYFIRVNPEVDAKTHPHISTGLKKHKFGIPLED------LDSFMERFRSMNIRGLHVHIGSQITRVEPFVEAFSKVVRASE------RYGFEEINIGGGWGINY--SGEELDLSSYREKVVPDLKRF--------KRVIVEIGRYIVAPSGYLLLRVVLVKRRHN-KAFVVVDGGMNVLIRPALYSAYHRIFVLGK--QGKEMRADVVGPLCESGDVIAYDRELPEVEPGDIIAVENAGAYGYTMSNNYNSTTRPAEVLVRNGRISLIRRRETEMDIFKDVV.. 385
13 -82.7005gjo_A mol:protein length:394 Lysine/ornithine decarboxylase  ali model follow..  21  1............AMKNFRLSEKEVKTLAKRIPTPFLVASLDKVEENYQFMRRHL----PRAGVFYAMKANPTPEILSLLAGLGSHFDVASAGEMEILHELGVDGSQMIYANPVKDARGLKAAADYNVRRFTFDDPSEIDKMAKAVPG----ADVLVRIAVRNNKALVDL------NTKFGAPVEEALDLLKAAQDA----GLHAMGICFHVGSQSLSTAAYEEALLVARRLFDEA-EEMGMHLTDLDIGGGFPVPDC-KGLNVDLAAMMEAINKQIDRL-----FPDTAVWTEPGRYMCGTAVNLVTSVIGTKTRGE-QPWYILDEGIYGCFSGIMYDHWCYPLHCFG--KGNKKPSTFGGPSCDGIDVLYRDFMAPELKIGDKVLVTEMGSYTSVSATRFNGFYLAPTIIFEDQPEYAARLTED-DDVKKKAA.. 393
14 -82.2002plj_A mol:protein length:419 lysine/ornithine decarboxylase  ali model follow..  19  23.......DIHSLTSPVLSAEEIHIEASVEQFGAPLLLLDCDVIRQQYRALKNAL----PNVTLHYALKPLPHPVVVRTLLAEGASFDLATTGEVELVASEGVPADLTIHTHPIKRDADIRDALAYGCNVFVVDNLNELEKFKAYRDDVELLVRLSFRNSE----------AFADLSKKFGCSPEQALVIIETAKEW----NIRIKGLSFHVGSQTTNPNKYVEAIHTCRHVMEQVVERGLPALSTLDIGGGFPVNY--TQQVMPIDQFCAPINEALSLLPET-----VHVLAEPGRFICAPAVTSVASVMGQAEREG-QIWYYLDDGIYGSFSGLMFDDARYPLTTIK-QGGELIPSVLSGPTCDSVDVIAENILLPKLNNGDLVIGRTMGAYTSATATDFNFFKRAQTIALNEFVASSERMI............. 412
15 -81.9002oo0_A mol:protein length:471 Ornithine decarboxylase  ali model follow..  20  7FQSLMNNFGNEEFDCHFLDEGFTAKDISSDDKDAFYVADLGDILKKHLRWLKAL----PRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHP----------KAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKEL----NIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMG-AEVGFSMYLLDIGGGFPGSEDVKL---KFEEITGVINPALDKYFPSD--SGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKETFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAQLMQQFQNPDFPPEVE... 440
16 -81.1003btn_A mol:protein length:448 Antizyme inhibitor 1  ali model follow..  18  5.......IDDANYSVGLLDEGTNLGNVIDNGKNAFFVGDLGKIVKKHSQWQTVV----AQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNH----------PNAKVLLHIATEDNIGGEDGNMKFGTTLKNCRHLLECAKEL----DVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMA-GEFGFTMNMLDIGGGFTGTEIQLE------EVNHVISPLLDIYFPEG--SGIQIISEPGSYYVSSAFTLAVNIIAKKVVENDKKNGSDEPAFVYYMNDGVYGSFASKLHKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDEMQDAGITSDAMMKNFF.. 430
17 -80.3003n29_A mol:protein length:418 Carboxynorspermidine decarboxylase  ali model follow..  14  4.SGMASMTGGQQMGRDLYDKDHPFTMFYEKIQTPAYILEEDKLRKNCELLASVGEK--SGAKVLLALKGFAFSGAMKIVGEYLKGCTCSGLWEAKFAKEYM--DKEIHTYSPAFKEDEIGEIASLSH-HIVFNSLAQFHKFQSKTQK----NSLGLRCNVEFSLAPKELYNPCGRYSRLGIRAKD----------FENVDLNAIEGLHFHALCEESA-----DALEAVLKVFEEKFGKWIGQMKWVNFGGGHHITKKGYD----VEKLIALCKNFSDKY-------GVQVYLEPGEAVGWQTGNLVASVVDIIENEK-QIAILDTSSEAHMPDTIIMPYTSEVLNARILAKENEFAYLLTGNTCLAGDVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLDHKNELQMIREFSYKDYSLRN... 412
18 -80.2004zgz_A mol:protein length:438 Antizyme inhibitor 1  ali model follow..  19  8.........DANYSVGLLDEGTDLGNVIDNGKNAFFVGDLGKIVKKHSQWQNVV----AQIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKIARNHPN----AKVLLHIA------TEDNIGGEEGNMKFGTTLKNCRHLLECAKEL----DVQIIGVKFHVSSACKESQVYVHALSDARCVFDMA-GEIGFTMNMLDIGGGFTGTEFQLEEVNHVISPLLDIYFPEG--------SGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPSGDEPAFMYYMNDGVYGSFASKLHKKYKEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSYEMQDAGITSDSMMKNFFFV 433
19 -79.3003mt1_A mol:protein length:365 Putative carboxynorspermidine decarboxylase protein  ali model follow..  15  2..............................IETPYYLIDKAKLTRNMERIAHVREKS--GAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRERFGK--ETHAYSVAYGDNEIDEVVSHAD-KIIFNSISQLERFADKAAG----IARGLRLNPQVSSSSFDLADPARPFSRLGEWDVP----------KVERVMDRINGFMIHNNCENKDFGLFDRMLGEIEERFGAL----IARVDWVSLGGGIHFTG----DDYPVDAFSARLRAFSDRY-------GVQIYLEPGEASITKSTTLEVTVLDTLYN-GKNLAIVDSSIEAHMLDLLIYRETAKVL-----PNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSL... 364
20 -77.8003nzq_A mol:protein length:666 Biosynthetic arginine decarboxylase  ali model follow..  15  56..HISVCPDPDVPEARVDLAQLVKTREAQGQRLPALFCFPQILQHRLRSINAAFKRANGDYFLVYPIKVNQHRRVIESLIHSGEPLGLEAGAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKMYLVIEKMSEIAIVLDEAERLNVVPRLGVRARLASQG-SGKWQSSGGEKSKFGLAATQVLQLVETLREAGRLDSLQ--LLHFHLGSQMANIRDIATGVRESARFYVELH-KLGVNIQCFDVGGGLGVDYEGTRSQSDLNEYANNIIWAIGDACEENGLPHPTVITESGRAVTAHHTVLVSNIIGVERNE--YTVPTAPAEDAPRALQSMWETWQEMHEPGTRRSLREWLHDQMDLHDIHIGYSSGIFSLQERAWAEQLYLSMCHEVQKQLDPQNRAHRPIIDELQERMADKMYVNFSLFQSMPDAWG.. 500
21 -77.8007odc_A mol:protein length:424 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  20  6.........KDEFDCHILDEGFTAKDISSDDKDAFYVADLGDILKKHLRWLKAL----PRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHP----------KAKLVLRIATDDSKAVCRLSVKFGATLKTSRLLLERAKEL----NIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMA-TEVGFSMHLLDIGGGFPGSE---DTKLKFEEITSVINPALDKYFPSD--SGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKETFMYYVNDGVYGSFNCILYDHAHVKALLQKRPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMQLMKQIQSHG......... 424
22 -77.3001f3t_A mol:protein length:425 ORNITHINE DECARBOXYLASE  ali model follow..  21  28......................KISMNTCDEGDPFFVADLGDIVRKHETWKKCL----PRVTPFYAVKCNDDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIRYARDSGVDVMTFDCVDELEKVAKTHPK----AKMVLRIS------TDDSLARCRLSVKFGAKVEDCRFILEQAKKL----NIDVTGVSFHVGSGSTDASTFAQAISDSRFVFDMG-TELGFNMHILDIGGGFPGTR---DAPLKFEEIAGVINNALEKHFPPD--LKLTIVAEPGRYYVASAFTLAVNVIAKKVTPG-VQTDVGAHAESNYVNDGVYGSFNCILQREPIPNEKLYPSSVWGPTCDGLDQIVERYYLPEMQVGEWLLFEDMGAYTVVGTSSFNGFQSPTIYYVVSGLPHVVRELKSQKS........ 425
23 -77.2002nv9_A mol:protein length:372 A207R protein, arginine decarboxylase  ali model follow..  17  7......................NILKAHPHQTKSFYVSSPKIVEDLIDQWTILF----PRVTPHYAVKCNNDEVLLKTMCDKNVNFDCASSSEIKKVIQIGVSPSRIIFAHTMKTIDDLIFAKDQGVDIATFDSSFELDKIHTYHPN----CKMILRIRCDDPN------AAVQLGNKFGANEDEIRHLLEYAKQL----DIEVIGISFHVGSGSRNPEAYYRAIKSSKEAFNEA-ISVGHKPYILDIGGGLHADIDEGE---LSTYMSDYINDAIKDFFPEDT---VTIVAEPGRFFAEHYSVLATQVIGKRVRDG-LYEYFFNESTYGGFSNVIFEKSVPTPQLDVPDDEEYVPSVLYGCTCDGVDVINHNVALPELHIGDWVYFPSWGAYTNVLTTSFNGFGEYDVYYI........................ 372
24 -75.9004aib_A mol:protein length:395 ORNITHINE DECARBOXYLASE  ali model follow..  17  2............KQTSLEVKEFALNLISENQPLGFWIFDTEGVEKAVERWKKNM----PTVRPCFAVKCNPEPHLVKLLGELGCGFDCASLNEIKEVLDLGFNPEDITYSQTFKPYNQLIEASHLGINHTIVDSIDEVQKIAKYAPK----MGIMIRIMENDTSAGHVF------GEKFGLHDDEVEIVLKEIKDK----GLNLDGVHFHVGSDSHNSEVFTKALTKARNTVTLA-EQFGMKPYLIDIGGGFSQVAPFEEFAATIEKTIKELEFP----------ERTRFIAEPGRYMASNAFHLVSSLHGKRVRIQNIEYTSGDGLHGSFGCCIWFEKQKSCECITQKENTKMYESIIYGPSCNGSDKVATQELPEMEPGKDWLLFPNMGAYTISMATNFNGFEERNHVIYLPLKSTKIIQI............. 394
25 -73.6003n2o_A mol:protein length:648 Biosynthetic arginine decarboxylase  ali model follow..  17  28........YGIDDQGEMYVHQIQLSKIVKQLNVPVLVRFPQILHQRVHSICDAFNQYPNKYLLVYPIKVNQQREVVDEILASQLGLEAGSKPELLAVLAMAQHASSVIVCNGYKDREYIRLALIGEKLFIVLEKMSELDLVLREAKSLGVTPRLGIRIRLASQG-AGKWQASGGEKSKFGLSASQVLNVISRLKKENQLDTLQ--LVHFHLGSQMANIRDVRNGVNESARFYCELR-TLGANITYFDVGGGLAIDYDGTRSQYGLVEYARNIVNTVGDVCKDYKQPMPVIISESGRSLTAHHAVLISNVIGTETYKP-ETVTEPEEDFQSLPDSWGIDQVFPVLPLSGLQNAADRRAVMLDITCDSDGAIDAYVDGQGIEEPYLMGFFLVGAYQEILGDMHNLFGDTHSVVVNVGDIDFINEGDTVEDMMR..... 594
26 -72.3003nzp_A mol:protein length:619 Arginine decarboxylase  ali model follow..  18  11......NENFIIKNGKVCIKKPAIIDIVKEYKGPLLLRFPHLIQKQIENIYGNFNKYKGGFNAVYPLKVNQYPGFVKNLVKLGYGLEAGSKAELLLAMAYNNEGAPITVNGFKDRELINIGFIAAEMGTLTIEGLNELEAIIDIAKERKPKPNIGLRVRLHS-AGVGIWAKSGGINSKFGLTSTELIEAVNLLKENKLLEQFT--MIHFHLGSQITEIHPLKKALNEAGNIYTELRKMGAKNLKAINLGGGLAVEYSQFKNEYTLREYANDVVFILKNIAEQKKDLEPDIFIESGRFVAANHAVLIAPVLELFSQEYQERYLVNFSLFQSMPDFWGLEQNFPIMPLDRLDEEPTRSASIWDITCDSDGEISYSKDVDVEKENYFLGFFLVGAYQEVLGMKHNLFTHPTEAIISINEVEGIIEAQSILDTLE..... 561
27 -18.5003wqc_A mol:protein length:390 D-threo-3-hydroxyaspartate dehydratase  ali model follow..  12  1...................GAMSMQDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPH--VKTSKSVPVAAAQRAAGAGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDG--------------HRSGVGADD-TPLLLAIGRTLHDGGMRLGGVLTHAGDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVT---------------------------VRAGVYVFFDLVVALSVLATVIGHQADKGWAIVDAGWMAMSRDR-YGQVCDLQGRVMPGFVLTGANQEHG-ILARADGAAEADIATRFPLGTRLRILPN--HACATGAQFPAY-----QALAADGS................... 374
28 -17.9004v15_A mol:protein length:379 D-THREONINE ALDOLASE  ali model follow..  14  21...........................LARVDTPSLVLDLPAFEANLRAMQAWADRHEVALR----AKAHKCPEIALRQLALGAGICCQKVSEALPFVAAGIRDIHISNEVVGPAKLALLGQLARAAKSVCVDNAENLAQLSAAMTRAGAEIDVLVEVDVGQG--------------RCGV--SDDATVLALAQQARALPGLNFAGLQAYHGRTREERAAVCRQAARIAASYAQLLRESGIACDTITGGGTGSVEFDAASGVYT---------------------------LQAGSYAFMDSDYVLSTVMSTPA----PGRVILDAGLKSTTAECGPPAVYGEPGLT------------YAAINDEHGVVRVEPGAQAPALGAVLRL................................................. 343
29 -17.8003llx_A mol:protein length:376 Predicted amino acid aldolase or racemase  ali model follow..  12  9...........................IAHPDTPYLLIDEAKLKSNINYLKQRVESLGSHLRPH--LKTLRTLEAAGYLLDSKSPATVSTLAEAEAYAKAGYTDLLYAVGIAPAKLKRVAALRQQGINHILLDNITQAQAVVDYAAEFGQDFSVFIEIDSDD--------------HRGGIKPSD-----SKLLTIAKTLGEHFTGLMTHAGNTEQGLKNFAKQECDAVRIARNNLETAGIHCAITSVGSTPTAHFGEDFSDIS---------------------------VRAGVYTTFDLVIAMSVVTTVIGHNKEKNWLLTDSGWMALSRDS--NRDFGYGQVCKIDGSVLDGLCVNSTSQEHGVILSDAYQLEDFPVGHQLRIMPN--HACATAAMHPVY-----HVLMSDGS................... 366
30 -17.5003anu_A mol:protein length:376 D-serine dehydratase  ali model follow..  13  7...........................LDTLPTPALTIDRTTARRNAERMRERCRALGVRLRPH--VKTHKTLEGGLLATGGTRGIAVSTLAEARFFADGGFDDILLAYPVPTARLEECAGLARRLDAHVLLDRPEALASLRQRPLGHGKRWLVWLKLDCGN--------------GRAGVRPTDAALELAQAIANDAPEEVTLVGVYAHCGSGADTIQAIARTTTNAVLSFVAALRQAGVPCPQASIGSTPSCSHPIPEMSQLTE-------------------------LHPGNYIFYDLQVAIRVLTRVIGHYAHRGQLLVDCGWAALSLHGAGAGQGPQGCAAIDGHPELRLVGLT----EHGEHAGGQMDFGRFPVGSVLALIPY--HACATAAMHPVY-----YVHEEGKV................... 366
31 -16.7003gwq_A mol:protein length:426 D-serine deaminase  ali model follow..  12  41...........................NEDVSLPAAVLYADRVEHNLKWMQAFVAEYGVKLA----GKTTMAPQLFRRQLETGAGITLATAHQVRAAYHGGVSRVLMANQLVGRRNMMMVAELLSDPEFCLVDSVEGVEQLGEFFKSVNKQLQVLLELGVPG--------------GRTGVRDAA-QRNAVLEAITRYPDTLKLAGVELYEGVEEHEVREFLQSAVAVTRELVEQERFARAPAVLSGAG-------------------SAWYDVVAEEFVKASETGKVEVVLRPGCYLTHDVGILWAYVQSIPE----PDRAIIGLGKRDSAFDAGMPEPARHYRPGNEAPRDIAASEEIFGLMDQHAYLRIPAG-ADLKVGDMIAFD---SHPCLTFDKWR------QVLVVDPAYRVTEVIETF.......... 425
32 -14.7001vfh_A mol:protein length:386 alanine racemase  ali model follow..  12  1..........................MNETPTRVYAEIDLDAVRANVRALRARAP----RSALMAVVKSNAAVPCARAAQEAGAALGTATPEEALELRAAGIQGRIMCWLWT--PGGPWREAIETDI-DVSVSGMWALDEVRAAARAAGRTARIQLKADTGL--------------GRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPAT------------TLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALVKTVPAGHHLALVPAGYADGIPRNASGRGPVLV--------AGKIRRAAGRIA---DQFVVDLGEDLAEAGDEAVILGAHTIAYEIVTRIGG--RVPRVYLGGLE.................... 380
33 -13.7004kbx_A mol:protein length:388 Uncharacterized protein YhfX  ali model follow..  13  24...........................QGKIAPDSWVIDVDQILENGKRLIETARLY--GIELYLMTKQFGNPWLAEKLLALGYGIVAVDYKEARVMRRAGLPVAHQGHLVQIPCHQVADAVEQGTD-VITVFTLDKAREVSAAAVKAGRIQSVLLKVYSDDDF---------YPGQESGFALKV---LPEIVAEIQNLPGLHLAGLTHFPCLLWDEAVGKVLPTPNLHTLARDQLAKSGIALEQLNAPSATSCTSLPLLAQYGVTH------------------------AEPGHALTGIAMLWLSEISHHFRGDS----YCYGGGYYR-------RGHAQHALVFTPENQKITETNLKTVDDSSIDYTLPLA--GEFPVSSAVVLFVTRSDVVLVSGIHRGEPEIVGRYDSLGN.................... 384
34 -13.5001xfc_A mol:protein length:384 Alanine racemase  ali model follow..  14  1.......................MTPISQTPGLLAEAVDLGAIEHNVRVLREHAG----HAQLMAVVKADGATRVAQTALGAGAALGVATVDEALALRADGITAPVLAWLHP--PGIDFGPALLADV-QVAVSSLRQLDELLHAVRRTGRTATVTVKVDTGL--------------NRNGVGPAQFPAMLTALRQAMAEDAVRLRGLMSHMVYADKPDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSATMARPDLT-----------------------------LVRPGIAVYGPAMTVKCAVALVKSIRAGENLALLPIGYADGVFRSLGGRLEVLI--------NGRRCPGVGRICMDQFMVDLGPGPLDVAEGDEAILFGPGIRGEPTAQDW................................... 355
35 -12.8005fac_A mol:protein length:410 Alanine racemase  ali model follow..  12  8............VPRGSHMSETTARRDADAVLRARAEIDLAALRANVRALRERAP----GAALMAVVKADAAIPCARAAVAAGATLGTATPQEALALRAAEPPDDVRIMCWLWTPGGPWREAVEARL-DVSVSAMWAMEEVTGAARAAGVPARVQLKADTGL--------------GRGGCPGADWERLVGAALRAEEEGLLRVTGLWSHFACADEPGHPSIAAQLTRFREMTAYAEQRGLRPEVRHIANSPAT------------TLPDAHFDLVRPGIAMYGVSPSPEIGTPADFGLRPVMTLAASLALVKQTPGETTLGLVPLGYADGIPRHASSSGPVLV--------DGKWRTVAGRIA---DQFVVDLGGDRPEPGAEAVLFGPGDRGEPTAEDW................................... 378
36 -12.2004dza_A mol:protein length:407 lysine racemase  ali model follow..  13  31......................QVAQVQPAIVNNSWIISRSALDFNVKKVQSLLG---KQSSLCAVLKGDALSLVAPIMIENNVKIGVTNNQELKEVRDLGFKGRLMRVRNA--TEQEMAQATNYNV-EELIGDLDMAKRLDAIAKQQNKVIPIHLALN------------SGGM-SRNGLEVDNKSGLEKA-KQISQLANLKVVGIMSHYPEEDANKVREDLARFKQQSQQVLEVMGLERNNVTLHMANTFAT------------TVPESWLDMVRVGGIFYGDTIASTDYKRVMTF--------SNIASINYYPKGNVLANIPVGYADGYRRVFSNAGHALI--------AGQRVPVLGKTS---NTVIVDITLNNIKPGDEVVFFGSGALFTEMSILWGAT................................ 400
37 -12.0004beu_A mol:protein length:392 ALANINE RACEMASE  ali model follow..  12  8......................ALPDAAQIQQSNSWLISLGQFQSNIEQFKSHMNA---NTKICAIMKADAIRGLMPTIIAQGIPVGVASNAEARAVRESGFKGELIRVRSA--SLSEMSSALDLNI-EELIGTHQQALDLAELAKQSGKTLKVHIALN-----------DGGM--GRNGIDMTTEAGKKEA-VSIATQPSLSVVGIMTHFPNYNADEVRAKLAQFKESSTWLMQQANLKREEITLHVANSYTA------------NVPEAQLDMVRPGGVLFGDLPTNPEYPSIVSF--------TRVSSLHHLPKDSVLANLPVGYSDGYPRKMGNKAEVLI--------NGQRAKVVGVTS---NTTVVDVTIKGVLPGQEVVLFGAELIFPELYTLWGT--SNPRFYVKSS..................... 386
38 -12.0004lus_A mol:protein length:385 Alanine racemase  ali model follow..  13  1..........................MQKITVPTWAEINLDNLRFNLNNIKNLLE---EDIKICGVIKADAAVEVAKLLEKEKVDLAVARTAEGIELRQNGITLPILNLGYT--PDEAFEDSIKNKI-TMTVYSLETAQKINEIAKSLGEKACVHVKIDSGM--------------TRIGFQPNE--ESVQEIIELNKLEYIDLEGMFTHFATADEVSKEYTYKQANNYKFMSDKLDEAGVKIAIKHVSNSAAIMDCPDLR-------MVRAGIILYGHYPSDDVFKDRLELRPAMKL--------SKIGHIKQVEPGVGIYTTTGKETIATVPIGYADGFTRIQKNPKVLIKGEVFDVVGRIC---DQIMVRIDDIDIKVGDEVILFGLGTINYEVLCMISR--RVDRVYMENNELVQINS.............. 381
39 -11.8004dyj_A mol:protein length:409 broad specificity amino acid racemase  ali model follow..  14  34.......................TNALTVQNSNAWVEVSASALQHNIRTLQAELAG---KSRLCAVLKADAIGLVMPSIIAQGVPVAVASNEEARVVRASGFTGQLVRVRLA--SLSELEDALQYDM-EELVGSAEFARQVDAIAARHGKTLRIHMALN-----------SSGM--SRNGVEMATWSGRGEALQ-ITDQKHLKLVALMTHFAVEDKDDVRKGLAAFNEQTDWLIKHAKLDRSKLTLHAANSFATLEVPEAR-----------------------------MVRTGGALFGRAMQFKSHVAAVHSYPAGNRLANITVGYSDGYRRVFTNKGHVLI--------NGHRIPVVGKVS---NTLMVDVTFPDVKGGNEVVLFGKQA............................................ 375
40 -11.7004y2w_A mol:protein length:388 Alanine racemase 1  ali model follow..  11  13.....................................VYLDAITHNFREIKKIVG---KNVKIMAVIKGDAASYVAKFLEKEGVDFGVATTEEALELREKGIKTPILIFGYT--PPTQLRQIVKHDL-TQTVYDIKYAKELEKESLKQNKRAKVHIKIDTGL--------------GRIGYIDFD--LAQKEILEMANMRGLILEGIYSHFAAASEDDRDYCKEQFDKFMNLISSLEKKRLKIPLKHIANAAAILNLNYSHRPGIILFGAYPSKRVERKVELRETLRFTTRVVHLKDVPAGFFIGYGKSFVTKR---KSVIATIPVGYADGLDRRLSNNYKLLL--------KGKYVPIVGRVC---DQCMIDVTVEGVEIGDEVVIIGIETIPQEVFSRISR--RVPRVYFYDGIKIGEVN.............. 385
41 -11.7004bf5_A mol:protein length:417 ALANINE RACEMASE  ali model follow..  15  46.....................................VDLGAFEHNIQTLKDRLGD--KGPKICAIMKADAIDLLVPSVVKAGIPIGIASNEEARVAREKGFTGRLMRVRAA--TPAEVEQALPYKM-EELIGSLVSAQGIADIAQRHHTNIPVHIALN-----------SAGM--SRNGIDLRLADSKEDALA-MLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITIHAANSFATLEVPDAY-----------------------------MVRPGGLLYGRVMAFKTQVASVNHYPAGNWLANLPLGYSDGYRRALSNKAYVLI--------QGQKVPVVGKTS---NTIMVDVTLKGVKPGDEVVLFGRQG............................................ 374
42 -11.5005irp_A mol:protein length:394 Alanine racemase 2  ali model follow..  12  1..........................MIKLCREVWIEVNLDAVKKNLRAIRRHIPH---KSKIMAVVKANGSIEVARHALEHGASLAVASVEEGIVLRKAGITAPILVLGFT--SLSCVKKSAAWNI-TLSAFQVDWMKEANEILEKEASANRLAI----------HINVDTGM--GRLGVRTKE--ELLEVVKALKASKFLRWTGIFTHFSTADEPDTTLTKLQHEKFISFLSFLKKQGIELPTVHMCNTAAA------------AFPEFSADMIRLGIGLYGLYPSAYIKQLNLVKLEPALSLKARIAYVKTMRTEEVIATLPIGYADGYSRALSNRGFVLH--------RGKRVPVAGRVT---DMIMVSLENGEGKQGDEVVIYGLNTINYEVVSTLSR--RIPRFYIRDGEIFKVST.............. 389
43 -11.0003oo2_A mol:protein length:385 Alanine racemase 1  ali model follow..  13  2........................NAMSDKYYRSAYMVDLNAVASNFKVFSTLHP----NKTVMAVVKANASVKVARHLMENGATFAVATLDEAIELRMHGITAKILVLGVL--PAKDIDKAIQHRVALTVPSKQWLKEAIKNISGEQEKKLWLHIKLDTGM--------------GRLGIKDTK--TYQEVIEIIQQYEQLVFEGVFTHFACADEPGDMTTEQYQRFKDMVNE----------------AIKPEYIHCQNSAGSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVHLKPSVQLIANVVQTKTLQAGESVYTATDPTTIALLPIGYADGYLRIMQGSFVNVNGHQCEVIGRVC---DQTIVKVP-DQVKAGDSVILIDQHTINYEVLCNLSR--RLPRIYHDGDQRFVTNE.............. 382
44 -11.0002dy3_A mol:protein length:361 Alanine racemase  ali model follow..  13  8.....................................IDLDAIAHNTRVLKQMAG----PAKLMAVVKANAVEKVAPVIAAHGADFGVATLAEAMQLRDIGISQEVLCWIWT--PEQDFRAAIDRNIDL----AVISPAHAKALIETDAEHIRVSIKIDSGL--------------HRSGVDEQE---WEGVFSALAAAPHIEVTGMFTHLACADEPENPETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLH-----------------------------MVRPGLAFYGPAMTWEAKVSVVKQIEAGQFVAVVPAGYADGMPRHAQGKFSVTI--------DGLDYPQVGRVCMDQFVISLGDNPHGVEAGAKAVIF--GENGHDATD..................................... 336
45 -10.9003kw3_A mol:protein length:376 Alanine racemase  ali model follow..  12  25.....................................IDVRAIVANYRTLAQHVA----PTECSAVVKANAAHKIAPALYQAGCRTFFVAQIEEALQLKAVLPENVMIALLNGFPHKAEEFVAQSGIIPL-LNSWSTIEDWQTLCQKKNKKFPAIIQVDTNM--------------SRLGLDKKE---LQKLIKNPTIFEKAEIKYILSHLANNNKQLAAFKRVLAQLPTCKVSFANSGGIYFDLVRPGIALYGVDPHGKHPTPLKAVVKVEAQVLQ--------------IDAGIPVGYRESFMTRR---------PSTLATISIGYADGWPRILSNKGTVYF--------NGHKLPIVGHISMDSIIVDATDLDKKPQRGDWVELIGPHQPLEKVSTDTNT---PHEILTSLGK.................... 369
46 -10.8006g56_A mol:protein length:404 Alanine racemase 1  ali model follow..  13  10............EKGAVTSLYKKAGFSDKYYRSAYMNVDLNAVASNFKVFSTLHP----NKTVMAVVKANASVKVARHLMENGATFAVATLDEAIELRMHGITAKILVLGVL--PAKDIDKAIQHRVALTVPSKQWLKEAIKNISGEQEKKLWLHIKLDTGM--------------GRLGIKDTN--TYQEVIEIIQQYEQLVFEGVFTHFACADEPGDMTTEQYQRFKDMVNE----------------AIKPEYIHCQNSAGSLLMDCQFCNAIRPGISLYGYYPSEYVQQKVKVHLKPSVQLIANVVQTKTLQAGESVYTATDPTTIALLPIGYADGYLRIMQGSFVNVNGHQCEVIGRVC---DQTIVKVP-DQVKAGDSVILIDQHTINYEVLCNLSR--RLPRIYHDGDQRFVTNE.............. 401
47 -10.4003ha1_A mol:protein length:397 Alanine racemase  ali model follow..  13  14.....................................VDLDAIYNNVTHIKEFIPS---DVEIFAVVKGNAYVPVAKIALEAGATLAVAFLDEALVLRRAGITAPILVLGPS--PPRDINVAAENDV-ALTVFQKEWVDEAIKLW-DGSSTMKYHINFDSGM--------------GRIGIRERK--ELKGFLKSLEGAPFLELEGVYTHFATADEVETSYFDKQYNTFLEQLSWLKEFGVDPKFVHTANSAAT------------RFQGITFNAVRIGIAMYGLSPSVEIRPFLPFKLEPALSLHTKVAHIKQVIKGDGIYRTKTEEWIATVAIGYADGWLRRLQGFEVLVNGKRVPIVGRVT---DQFMIHLP-CEVPLGTKVTLIGSGTINYEIITTISF--RVPRIFIRNGKVVEVIN.............. 384
48 -10.3005nlc_A mol:protein length:228 PipY  ali model follow..  16  1..........................................MAQIAERLASLRSQLPPSVQLIAVSKNHPAAAIREAYAARHFGENRVQEAIAKQAELTDLPDLTWHLLGKLQS-NKARKAVEHFDWIHSVDSWALAERLDRIAGELGRSPKLCLQVK------------LLPDPNKAGWDPAD---LRAELPQLSQLQQVQIRGL-MVIAPLGLTAAETQALFAQARTFAAELQQQAQLRLTELSMG........................................................................................................................................................................................... 193
49 -10.3003e5p_A mol:protein length:371 Alanine racemase  ali model follow..  13  13.....................................IDTQAITENVQKECQRLPE---GTALFAVVKANGAVESAKAAKKGGATFCVALLDEAIELREAGVQDPILILSVV--DLAYVPLLIQYDLSVTVATQEWLEAALQQLTPESNTPLRVHLKVDTGM--------------GRIGFLTPE--ETKQAVRFVQSHKEFLWEGIFTHFSTADEIDTSYFEKQAGRFKAVLAVLEELPRYVHVSNSATALWHPDVPGN--------MIRYGVAMYGLNPSGNKLAPSYALKPALRL--------SELIHVKRLAAGEGIYVTEAEEWIGTVPIGYADGWLRHLQGFTVLVNGKRCEIVGRVC---DQCMIRLA-EEVPVGPVVTLVGKDG............................................ 338
50 -10.3001w8g_A mol:protein length:234 HYPOTHETICAL UPF0001 PROTEIN YGGS  ali model follow..  16  9........................................AQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDQRQFGENYVQEGVDKIRHFQELGVTGLEWHFIGPQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQIN------------ISDENSKSGIQLAE---LDELAAAVAELPRLRLRGL-MAIPAPESEYVRQFEVARQMAVAFAGLKTR-YPHIDTLSLG........................................................................................................................................................................................... 203
51 -10.1003sy1_A mol:protein length:245 UPF0001 protein yggS  ali model follow..  16  10........................................AQVRDKISAAATRCGRSPEEITLVAVSKTKPASAIAEAIDARQFSEHYVQEGVDKIRHFQELGVTGLEWNFAGPQSNKSRLVAEHFDWCITIDRLRIATRLNDQRPAELPPLNVLIQIN------------ISDENSKSGIQLAE---LDELAAAVAELPRLRLRGL-SAIPAPESEYVRQFEVARQMAVAFAGLKTR-YPHIDTLALG........................................................................................................................................................................................... 204
52 -10.1003hur_A mol:protein length:395 Alanine racemase  ali model follow..  12  2.........................SLTAIHRPTWVSVDLDAAAHNLQEIREWTK----AKKVYAVLKADGAIPLAKAFQETA-ALIVSNLDEALELRQADLTLPIWVLGAW--DYSDLKLFIDHDI-VITIPSLAWLQNLPDFEGT----LKVSLAIDTGM--------------TRIGFDKAD--EISAAKKIIDKNPQLDLFSVYTHFATADEAGEKSKAYFEEQLRRWQELTINQGFDPSLFSMANSATCIWHHDDPRISFAAIRPGQLISGVNVSNGELKMPPNLHLERIFSV--------SEIADVRFVKKDQSLERMPEDGYVATLPFGYNDGWLRRMQKSSVIINGKRMPIIGRIT---DQTMVKLD-RKYPIGTRVTLIGSHTIVDEIQTTLAP--RIKRIYTGDLAEVIGAN.............. 385
53 -9.8806a2f_A mol:protein length:358 Alanine racemase, biosynthetic  ali model follow..  16  8.....................................VDLSAIRHNYALAKRCA----PQRQAFAVVKANAAREVVTALHDDADGFAVACLEEAAEVRALHASARILLLEGC--EASEYALAGQLRL-DLVIQGAEQGEAFL--AAGLDIPLNVWLKLDSGM--------------HRLGFDPAA---LRAWHARLRSHPGVRELNLISHFACADERNHPLTEQ-------LESFLGLLDLDFDQRSLANSAAVLTIPAAHMDWLRP-------MLYGSTPLADLSAAELGLKPAMSLGAQL-ISLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRTAPAGTPVLVGGRRAILAGRVS---DMLAVDLDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTARVPRRYSH.............. 358
54 -9.8401rcq_A mol:protein length:357 catabolic alanine racemase DadX  ali model follow..  14  8.....................................IDLQALRHNYRLAREA-----TGARALAVIKADAAVRCAEALAAEADGFAVACIEEGLELREAGIRQPILLLEGF--EASELELIVAHDF-WCVVHCAWQLEAIERAS--LARPLNVWLKMDSGM--------------HRVGFFPED---FRAAHERLRASGKVAKIVMMSHFSRA----ELDCPRTEEQLAAFSAASQGLEGEISLRNSPAVLGWPKVPSD--------------LLYGATPFERAHPLADRLRPVMTLESKV-ISVRDLPAGEPVGYGARYSTERRQRIGVVAMGYADGYPRHAADGTLVFIDGKPGRLVGRVS---DMLTVDLDHPQAGLGSRVELWGFGSIPYQLLCNLKRVPR.............................. 352
55 -9.8401bd0_A mol:protein length:388 ALANINE RACEMASE  ali model follow..  12  1..........................MNDFHRDTWAEVDLDAIYDNVENLRRLLPD---DTHIMAVVKANADVQVARTALEAGASLAVAFLDEALALREKGIEAPILVLGAS--RPADAALAAQQRI-ALTVFRSDWLEEASALYSG-PFPIHFHLKMDTGM--------------GRLGVKDEE--ETKRIVALIERHPHFVLEGLYTHFATADEVNTDY---FSYQYTRFLHMLEWLPSRPPLVHCANSAAS------------RFPDRTFNMVRFGIAMYGLAPSPGIKPLLPYPLKEAFSLHSRLVHVKKLQPGEKVYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVDGQKAPIVGRIC---DQCMIRLP-GPLPVGTKVTLIGLETINYEVPCTISY--RVPRIFFRHKRIMEVRN.............. 379
56 -9.8202odo_A mol:protein length:357 Alanine racemase  ali model follow..  15  8.....................................IDLQALRHNYQLAREV-----TGAKALAVIKADAAVRCAQALEAEADGFAVACIEEALELRAAGIRAPILLLEGF--EADELPLIVEHDF-WCVVHSLWQLDAIEQAR--LAKPIHVWLKLDSGM--------------HRVGLHPND---YKAAYQRLQASANVAKIVLMSHFARA----ELDCTRSVEQVAVFLGARADLTAEISLRNSPAVLGWPRVPSD--------------MLYGSSPFDEPQATASRLQPVMTLESKV-ICVRELPAGEPVGYGARFITPKPMRIGVVAMGYADGYPRQAPTGTPVFVDGVRSQLLGRVS---DMLCIDLDVPQAGLGSTVELWGADTIPYQIFCNLKRVPR.............................. 352
57 -9.7903uw6_A mol:protein length:390 Alanine racemase  ali model follow..  11  1..........................MNDFHRDTWAEVDLDAIYDNVENLRRLLPD---DTHIMASVCGNADVQVARTALEAGASLAVAFLDEALALREKGIEAPILVTGAS--RPADAALAAQQRI-ALTVFRSDWLEEASALYSG-PFPIHFHLYMDTGM--------------GSLGVKDEE--ETKRIVALIERHPHFVLEGLWTWFATADEVNTDY---FSYQYTRFLHMLEWLPSRPPLVHCANSAAS------------RFPDRTFNMVQFGIAMYGLAPSPGIKPLLPYPLKEAFSLHSRLVHVKKLQPGEKVYTAQTEEWIGTIPIGYKDGWLRRLQHFHVLVDGQKAPIVGRIL---DMCMIRLP-GPLPVGTKVTLIGLETINYEVPCTISY--RVPRIFFRHKRIMEVRN.............. 379
58 -9.6304ecl_A mol:protein length:374 Serine racemase  ali model follow..  12  11.....................................INLNNLEHNVNTLQKAMS---PKCELMAVVKAEAMYEVTTYLEQIGVSFAVATIDEGIRLRKYGISSEILILGYTSPSRAKELCKYELTQTLIDYRYSLLLN-------KQGYDIKAHIKIDTGM--------------HRLGFSTEDKDKILAAFS----LKHIKVAGIFTHLCAA--NDVAFTNKQIGSFYKVLDWLKSSGLNIPKVHIQSSYGL------------NYPELECDYIRVGVALYGVLSSTNDKTKLELDLRPVLSLKAKVVLIRKIKQGELIAILPIGYADGFPRNLSCGNSYVLIGGR-------QAPIVGKIC---DQLAVDVTIPNVKTGSIATLIGKDG............................................ 340
59 -9.5903cpg_A mol:protein length:282 Uncharacterized protein  ali model follow..  14  17..................IDDARAREITDGV---------HRVLDRIAAAEEQAGREAGSVRLLAATKTRDIGEIMAAID---AGVRMIGENRPQEVTAPDAAAEHIPFHLIGQQSNKIGKVLPVVDTIESVDSIDLAEKISRRAVARGITVGVLLEVN------------ESGEESKSGCDPAH---AIRIAQKIGTLDGIELQGL-MTIGAHVHDETVIRRGFSHLRKTRDLILASGEPGTDRCRLSMGMTGDM--------------------------------ELAIAEGSTIV-RVGTAIF................................................................................................................................. 268
60 -9.3103r79_A mol:protein length:244 uncharacterized protein  ali model follow..  15  11........................................EDVRQRIADVAEKSGRKAADVALVAVSKTFDAEAIQPVID---AGQRVFGENRVQEALKEKTSDIELHLIGPLQS-NKAADAVALFDVVESIDREKIARALSEECARQGRSLRFYVQVN------------TGLEPQKAGIDPRE---TVAFVAFCRDELKLPVEGL--------MCIPPAEENPGPHFALLAKLAGQCGLEKLSMGMSGDFETAVEFGATSVRVGS......................................................................................................................................................................... 216

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 2 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25.