current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [I] COG0020 Undecaprenyl pyrophosphate synthase, from COG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MKSSTQAVLEHTAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQYLTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILKGIEEAEALTANNTGLTLSIAADYGGRWDILQAANKLIAEGVSEITEDTLAKYLMLGDAPEPDLFIRTGGETRISNFLLWQMAYAELYFTDILWPDFDGKALDDAVASFQKRERRFGRTSEQLPIEQQRNLast
1 -121.0001jp3_A mol:protein length:253 undecaprenyl pyrophosphate synthase  ali model follow..  48  5.ATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA.... 253
2 -117.0002d2r_A mol:protein length:245 Undecaprenyl Pyrophosphate Synthase  ali model follow..  39  2LSATQPLSEKLDSTLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRPKSEVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLLESPPSESLENEISNRLDTRNLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGELKA......... 245
3 -117.0003ugs_B mol:protein length:225 Undecaprenyl pyrophosphate synthase  ali model follow..  34  2.........NAMNELKHLAVVMDGNRRWARAKGFLAKLGYSQGVKTMQKLMEVCMEENISNLSLFAFSTENWKRPKDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHCDALCVNLAISYGARDEIIRAAKRVIEKK-LELNEENLTQNLDLP--LDVDLMLRVGNAKRLSNFLLWQCSYAEIYFSETLFPSLTKREFKRIIKEFRNRERTFGK............ 225
4 -111.0005hc6_A mol:protein length:261 prenyltransference for protein  ali model follow..  34  2...AGAETEIDEVTPNHVAIIIDGHRKWAKSRGVTVQEGHQTGVNNWKHIISRASQLGIKLLTIWALSPQNFNRSKMEVDFLMRIYEDFLRSDVKELSQQDIQFSAIGDKSRLPEYLQDAISYAEGLSQANKGMHFILAVAYGGREDIVEAARKIAAKVPDDIDEATFEQHLMTTKFPSPDLLIRAAGEQRLSNFFLWQLPFTEFYFTPKLFPDFGEADLLDALASYRCRYRGFGERKGIHEASAWSH 256
5 -111.0003wyi_A mol:protein length:256 Isoprenyl transferase  ali model follow..  43  12.INNYNEELDSSNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRIASDIGVKYLTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSIKNMFDELSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE........ 256
6 -110.0001f75_A mol:protein length:249 UNDECAPRENYL PYROPHOSPHATE SYNTHETASE  ali model follow..  42  8.KAIKNNNINAAQIPKHIAIIMDGNGRWAKQKKMPRIKGHYEGMQTVRKITRYASDLGVKYLTLYAFSTENWSRPKDEVNYLMKLPGDFLNTFLPELIEKNVKVETIGFIDDLPDHTKKAVLEAKEKTKHNTGLTLVFALNYGGRKEIISAVQLIAERYLDEISETHFNEYLFTANMPDPELLIRTSGEERLSNFLIWQCSYSEFVFIDEFWPDFNEESLAQCISIYQNRHRRFGGL........... 249
7 -110.0004q9m_A mol:protein length:246 Isoprenyl transferase  ali model follow..  49  1.GSMAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDVPGDITEELIGNYLFTQHLPDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRHRRFGGV........... 246
8 -99.8002vg1_A mol:protein length:228 SHORT-CHAIN Z-ISOPRENYL DIPHOSPHATE SYNTHETAS  ali model follow..  30  1...........SDLPRHIAVLCDGNRRWARSAGYDDVYGYRMGAAKIAEMLRWCHEAGIELATVYLLSTENLQRDPDELAALIEIITDVVEEICAP--ANHWSVRTVGDLGLIGEEPARRLRGAVESTPEVASFHVNVAVGYGGRREIVDAVRALLSKEVDAVTVEGISENLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAHWPAFRHVDFLRALRDYSAR.................. 228
9 -98.6002vg2_A mol:protein length:284 UNDECAPRENYL PYROPHOSPHATE SYNTHETASE  ali model follow..  39  43.SKAAAPRIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVPERITESTIARHLQRPDIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA........... 284
10 -69.1003wqm_A mol:protein length:301 Diterpene synthase  ali model follow..  14  17LPLVSVAEIVRCRGPKVSVFPFDGTRRWFHLECNPQYDDYQAALRQSIRILKMLFEHGIETVISPIFSDDLLDRGDRYIVQALEGMALLANDELSFYKEHEVHVLFYGDYKKRGAAVVKSFDDLTISTSSNTEHRLCFGVFGNDAAESVAQFSSWNETHGKPPTRREIIEGYYGEYVDKADMFI---GFGRFSTFPLLSSGKTSLYFTVAPSYYMTETTLRRILYDHIYLRHFRPKPDYSAMSADQ.. 271

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.