current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [I] COG0020 Undecaprenyl pyrophosphate synthase, from COG1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MKSSTQAVLEHTAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQYLTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILKGIEEAEALTANNTGLTLSIAADYGGRWDILQAANKLIAEGVSEITEDTLAKYLMLGDAPEPDLFIRTGGETRISNFLLWQMAYAELYFTDILWPDFDGKALDDAVASFQKRERRFGRTSEQLPIEQQRNLast
1 -111.0001jp3_A mol:protein length:253 undecaprenyl pyrophosphate synthase  ali model follow..  48  5.ATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA.... 253
2 -109.0001f75_A mol:protein length:249 UNDECAPRENYL PYROPHOSPHATE SYNTHETASE  ali model follow..  42  7RKAIKNNNINAAQIPKHIAIIMDGNGRWAKQKKMPRIKGHYEGMQTVRKITRYASDLGVKYLTLYAFSTENWSRPKDEVNYLMKLPGDFLNTFLPELIEKNVKVETIGFIDDLPDHTKKAVLEAKEKTKHNTGLTLVFALNYGGRKEIISAVQLIAERSLDEISETHFNEYLFTANMPDPELLIRTSGEERLSNFLIWQCSYSEFVFIDEFWPDFNEESLAQCISIYQNRHRRFGGL........... 249
3 -109.0003wyi_A mol:protein length:256 Isoprenyl transferase  ali model follow..  43  12.INNYNEELDSSNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRIASDIGVKYLTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSIKNMFDENSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE........ 256
4 -108.0002d2r_A mol:protein length:245 Undecaprenyl Pyrophosphate Synthase  ali model follow..  38  2LSATQPLSEKLDSTLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRPKSEVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLLESSLLESLENEISNRLDTRNLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGELKA......... 245
5 -108.0004q9m_A mol:protein length:246 Isoprenyl transferase  ali model follow..  49  2..SMAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDNPGDITEELIGNYLFTQHLPDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRHRRFGGV........... 246
6 -107.0003ugs_B mol:protein length:225 Undecaprenyl pyrophosphate synthase  ali model follow..  34  2.........NAMNELKHLAVVMDGNRRWARAKGFLAKLGYSQGVKTMQKLMEVCMEENISNLSLFAFSTENWKRPKDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHCDALCVNLAISYGARDEIIRAAKRVIEK-KLELNEENLTQNLDLP--LDVDLMLRVGNAKRLSNFLLWQCSYAEIYFSETLFPSLTKREFKRIIKEFRNRERTFGK............ 225
7 -106.0005hc6_A mol:protein length:261 prenyltransference for protein  ali model follow..  34  3....GAETEIDEVTPNHVAIIIDGHRKWAKSRGVTVQEGHQTGVNNWKHIISRASQLGIKLLTIWALSPQNFNRSKMEVDFLMRIYEDFLRSDVKELSQQDIQFSAIGDKSRLPEYLQDAISYAEGLSQANKGMHFILAVAYGGREDIVEAARKIAAKRPDDIDEATFEQHLMTTKFPSPDLLIRAAGEQRLSNFFLWQLPFTEFYFTPKLFPDFGEADLLDALASYRCRYRGFGERKGIHEASAWSH 256
8 -105.0005kh2_A mol:protein length:272 Isoprenyl transferase  ali model follow..  49  21.KDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDNPGDITEELIGNYLFTQHLPDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAILAYNRRHRRFGGV........... 266
9 -104.0005hxn_A mol:protein length:233 (2Z,6Z)-farnesyl diphosphate synthase, chloroplastic  ali model follow..  43  1.......MLDEALMPKHIALIMDGNRRWAKDKGLDVSEGHKHLFPKLKEICDISSKLGIQVITAFAFSTENWKRAKGEVDFLMQMFEELY----DEFSRSGVRVSIIGCKTDLPMTLQKCIALTEETTKGNKGLHLVIALNYGGYYDILQATKSIVNKDVEDINKNLFDQELES-KCPNPDLLIRTGGDQRVSNFLLWQLAYTEFYFTKTLFPDFGEEDLKEAIINFQQRHRRFGGHT.......... 232
10 -102.0005xk3_A mol:protein length:232 Undecaprenyl diphosphate synthase  ali model follow..  22  1.....MAVDDDDKMMTNLMLLPDGMRRWSQKQGISLDDSYAAMTDKLVEFTGWAREEGFTTFYVTVSSVANYSRSEEQVTTAMNAFTEVVRRC-----HDTLNFNYSGTLEVVPERWLTELEALRAKSDSQSDFTLHFIMGMSLAHEVIGIFNKFNGK-IPALTEELLAANAYVP--EPVDFLIRPGGHVRMSSFYPLMSPFAEMYFCPTLLNDMTRADFDVALEDLRERDRRYGLYP.......... 225
11 -102.0005gul_A mol:protein length:238 Cyclolavandulyl diphosphate synthase  ali model follow..  25  9.........GSHGGSTTLMLLPDGMRRWSEKNGVSLDDGYAAMGDKIIEFMGWAKEEGVKTLYITASSAANHGRPEAAVNTFMEAFTEVI-----RRCHSQFKFDFSGSLDLVSEDYLTELSALRDKSDSESDFTLHYILGMSLSHEVVGIFNKLNGK-IPEMTEEILAENAYVP--TQVDYIIRTGGAIRMSSFFPLMSPYAELHFSPVLFPDTTRADFDAALKDLRARDRRFGGYPA......... 230
12 -101.0005guk_A mol:protein length:223 Cyclolavandulyl diphosphate synthase  ali model follow..  26  2...............TTLMLLPDGMRRWSEKNGVSLDDGYAAMGDKIIEFMGWAKEEGVKTLYITASSAANHGRPEAAVNTFMEAFTEVI-----RRCHSQFKFDFSGSLDLVSEDYLTELSALRDKSDSESDFTLHYILGMSLSHEVVGIFNKLNGK-IPEMTEEILAENAYVP--TQVDYIIRTGGAIRMSSFFPLMSPYAELHFSPVLFPDTTRADFDAALKDLRARDRRFGGYPA......... 217
13 -101.0002vg2_A mol:protein length:284 UNDECAPRENYL PYROPHOSPHATE SYNTHETASE  ali model follow..  39  42TSKAAAPRIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIARENPERITESTIARHLQRPDIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA........... 284
14 -100.0002vg1_A mol:protein length:228 SHORT-CHAIN Z-ISOPRENYL DIPHOSPHATE SYNTHETASE  ali model follow..  30  1...........SDLPRHIAVLCDGNRRWARSAGYDDVSGYRMGAAKIAEMLRWCHEAGIELATVYLLSTENLQRDPDELAALIEIITDVVEEICAPA--NHWSVRTVGDLGLIGEEPARRLRGAVESTPEVASFHVNVAVGYGGRREIVDAVRALLSKEVDAVTVEGISENLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAHWPAFRHVDFLRALRDYSAR.................. 228
15 -58.3003wqm_A mol:protein length:301 Diterpene synthase  ali model follow..  13  17LPLVSVAEIVRCRGPKVSVFPFDGTRRWFHLECNPQYDDYQAALRQSIRILKMLFEHGIETVISPIFSDDLLDRGDRYIVQALEGMALLANDELSFYKEHEVHVLFYGDYKKRLPSVVKSFDDLTISTSSNTEHRLCFGVFGNDAAESVAQFSIWNETHGKPPTRREIIEGYYGEYVDKADMFIGF-GRFSTFDFPLLSSGKTSLYFTVAPSYYMTETTLRRILYDHIYLRHFRPKPDYSAMSADQ.. 271

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 3 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.