current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit, from COG0516

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# E-value Template Links and tools%idFirst MREQLEALRDDAIKKIEQAQEKKVVQEIRVKYLGKKGPVTEVLRGMGKLSPEERPVIGQLANDVREAIGKAIESKMEALEQAEIHRKLQEETIDVTLPGRPVLKGGAHPLTATITEVEDLFIGLGFSVAEGPQIETDYYNFEALNLPKDHPARDMQDSFYFTDELLLRTQTSPVQARTMEKYKGKGPIKIICPGKVFRRDDDDATHSHQFMQIEGLYVDHGVRMSDLKGVLQAFAKSFFGEERSIRLRPSFFPFTEPSVEVDVSCGICHGDGCRVCKQTGWIEILGAGMVHPRVLEMSGFNPNEYSGFAFGMGVERLSMLKYGIDDIRHFYTNDRRFLAQFKRVLast
1 0.000e+00gi|654658377|ref|WP_028119299.1| phenylalanine--tRNA ligase subunit alpha [Facklamia sourekii]  clstr ali  57  6LQAEIKQLEDQALSALKAAADSKDLQDVKVQFTGKKGAMSSYTKAMKDLEPADKPKLGQAISGFNQAFNQAFESYKEALKEKELKAQLERETIDVTLPGRQQLQGSRHILTQVREEIEDLFLTMGYQVVEGPEVELDLYNFEKMNLPKNHPARDMQDTFYIDEEVLLRTHTSPVQARTMEQHDSQGALKMISPGKVFRRDSDDATHSHQFQQIEGLVVDKQITLADLKGTLLLFARAIFGQDREIRLRPSYFPFTEPSVEIDVSCFKCGGEGCSVCKQSGWIEILGGGVVHPRVLEMSGIDPEVYSGFAFGLGIERVAMLKHNVDDIRHFYQNDLRFMKQFKG. 349
2 0.000e+00 GL0083016 [Complete] locus=scaffold45079_4:1965:3008:-  ali  54  9MKEKMDAIKNAALEMIEKAQTSQDLNDVRVKYLGKSGEISLLMRDMANVPKEERPVMGKLVNELRTAVESVLNQKTQLVEEQEKLARLKAEEIDVTLPSNRENLGTLHPLTLITRELVDIFSGMGFSVVEGPEIESDLYNFQLLNVPKDHPARDMQDTFYINDNIVLRTQTSAVQARVM--QAGAPPIRIISPGKVYRSD-DDASHSPIFNQFEGLAIDKHITMGDLQGCLQTFAEKLFSKDTKVRLRPSYFPFTEPSVEVDVTCSMCHGKGCRVCKGTGWVEILGAGIVNPHVLDMCGIDSKEYSGFAFGFGIDRIAMIKYGIPNIKMLYENDVRFLKQFN.. 347
3 0.000e+00gi|498493822|ref|WP_010794560.1| phenylalanine--tRNA ligase subunit alpha [Pseudomonas sp. HPB0071]  clstr ali  51  2..ENLEALVSQALEAVQQTEDTTVLEQLRVGYLGKKGELTQVMKTLGNLPAEERPKVGALINAAKERVQDALNARKQFLEESALAEKLAAERVDVTLPGRGQKTGGLHPITRTLERIERLFTGIGYNVAEGPEIEDDYHNFEALNIPGHHPARAMHDTFYFNATRLLRTHTSPVQIRVMEQQ--QPPIRIICPGRVYRCD-SDQTHSPMFHQVEGLVIDEKVSFADLKSTIVGFLREFFEEDLEVRFRPSYFPFTEPSAEVDIRRVNKDGQLTPS-----WLEVLGCGMVHPNVLQMAGIDPEKYQGFAFGMGVERLAMLRYGVNDLRLFFDNDLRFLAQFR.. 334
4 0.000e+00gi|927546108|ref|WP_053820316.1| phenylalanine--tRNA ligase subunit alpha [Candidatus Thioglobus singularis]  clstr ali  50  2....INKIITDASKAIASAIDLKALDDSRVQYLGKKGELTDLLKGLGKLSKEERPAMGEAINEAKVKIQKLIETRKEELEEIALNQRLLDEKIDVTLPGRNSEKGSLHPITQTLNHIQDIFTKAGFEIEIGPEIEDDFHNFSALNIPEHHPARAMHDTFYFDANTVLRTHTSPVQIRTLERQ--KPPVRVIVPGKVYRCD-SDVTHTPMFHQVEGLIVDKEASFSQLKGLLIDFLRAYFEDDLKVRFRPSYFPFTEPSAEADIECVICGGEGCRVCKKSGWLEVLGCGVVHPNVLNAVNIDSEDYSGLAFGMGVERLAMLRYSVNDLRLFFENDVRFLNQF... 336
5 0.000e+00gi|503584310|ref|WP_013818386.1| phenylalanine--tRNA ligase subunit alpha [Methylomonas methanica]  clstr ali  48  1MSASIEEILTQALQALAHAKDLAELDLVRVNYLGKKGLFTQHMKQLGNLDPDQRKSVGQIINTAKNSFQDALDSRKLTLESEQLQARLASECVDVTLPGRGQAIAGLHPVTITMRRIAKIFADAGFNIAEGPEIEDDYHNFGALNIPEHHPARAMHDTFYFDAHTVLRTHTSPVQIRVMES--GQPPLRVIAPGRVYRCD-SDMTHSPMFHQVEGFLVDTDVSFGDLKGVIFEFLRAFFEKDVQVRFRPSYFPFTEPSAEFDVSCVMCDGQGCRVCKQTGWLEVGGCGMIHPEVFNSVGIDPERYSGFAFGTGVERLAMMKYGINDLRMFFENDLKFLQQFK.. 339
6 0.000e+00gi|521064701|ref|WP_020396652.1| phenylalanine--tRNA ligase subunit alpha [Thiothrix disciformis]  clstr ali  50  2..QSLLELMGEAHEHISAATTLAALDQVRVRYLGKTGLVTELLKQLGQLPAEERKTVGQEINQAKQALTAAIELRREGLQAEALNERLASQAVDVTLAGRRMDQGGLHPVTLTIQRIEEIFAQLGFAVAQGPQVEDDFHNFTALNIPEHHPARAMHDTFYLNPNLLLRTHTSSVQIRYMENH--QPPIRIIAPGRVYRCD-SDMTHSPMFHQVEGLMVDKDVTFADLKGVLATFFRAFFEMEVDMRFRASFFPFTEPSAEVDITCVQCGGSGCRTCKQTGWLEVLGCGMVHPNVLKHVGIDSEQYTGFAFGLGAERMTMLRYKINDLRVLFDNDVRFLSQFH.. 343
7 0.000e+00gi|493622468|ref|WP_006574665.1| phenylalanine--tRNA ligase subunit alpha [Pseudoflavonifractor capillosus]  clstr ali  53  1MKEKLEQIRAEALAALAGAKDAQELDGLRVKYLGKKGELTAVLKMMGSLSAEERPVMGQLANEVREALTEALSQRQKAIEEAALNQRLEAEKLDVTIPGKRPELGHKHPMSIALDELKEIFIGMGFQVAEGPEIELAEYNFTKLNTEEGHPAREWGDTFYIKEDLLLRTQTSPMQVRVMEKQ--KPPIRIIAPGRVYRKDEVDATHSPMFHQVEGLVIDKGVTMADLKGTLNAFVEALYGKGTKTRFRPHHFPFTEPSCEVDVQCHACGGKGCRVCKGEGWIELLGAGMVHPKVLEGCGIDTDVYSGFAFGIGVERMAMRRFSITDLRLIFENDMRFLSQF... 341
8 0.000e+00JGI.Meta 7045603073 SRS013476_Baylor_scaffold_8822__gene_26285 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit  ali  54  47MKEKMDAIKNAALEMIEKAQTSQDLNDVRVKYLGKSGEISLLMRDMANVPKEERPVMGKLVNELRTAVESVLNQKTQLVEEQEKLARLKAEEIDVTLPSNRENLGTLHPLTLITRELVDIFSGMGFSVVEGPEIESDLYNFQLLNVPKDHPARDMQDTFYINDNIVLRTQTSAVQARVM--QAGAPPIRIISPGKVYRSD-DDASHSPIFNQFEGLAIDKHITMGDLQGCLQTFAEKLFSKDTKVRLRPSYFPFTEPSVEVDVTCSMCHGKGCRVCKGTGWVEILGAGIVNPHVLDMCGIDSKEYSGFAFGFGIDRIAMIKYGIPNIKMLYENDVRFLKQFN.. 385
9 0.000e+00gi|494246269|ref|WP_007145587.1| phenylalanine--tRNA ligase subunit alpha [Methylophaga aminisulfidivorans]  clstr ali  48  9..QALNDIVESAKTAIAQANDNRALDNVRVEFLGKKGKITAYLKDLANVGVEERPIIGKSVNIAKQDVSALIDARNKTLSEMAMQAALAAETVDVTLPGRNSEIGGLHPVTRTLQRIERYFKNIGFDVAEGPEIEDGHHNFTALNIPEHHPARAMHDTFYFDADKLLRTHTSPVQIRVMD--EEQPPLRLIAPGRVYRCD-SDLTHTPMFHQIEGLMVDENISFTDLKGILSDFLQAFFEKPLKVRFRPSYFPFTEPSAEADIECVICGGEGCRVCSHTGWIEILGCGMVHPNVFKHVNIDSEKYLGFAFGLGVERMAMLRYGVNDLRMFFENDLRFLKQFS.. 345
10 0.000e+00gi|931387212|gb|KPJ77002.1| phenylalanyl-tRNA synthetase subunit alpha [Deltaproteobacteria bacterium SG8_13]  clstr ali  54  1MEETIDQIHAKAISELDAAADIQAVTALSVKYLGRKGEVTRFLRNISRYRPEERAAIGKRANQVKQELERSFKDVAERLEHTGAAKK---ERIDVTLPGRPAGHGTLHPITRITEEICDIFSRLGFDIAEGPEVELDYYNFEALNIPKNHPARDMQDTFYISENIVLRTHTSPVQIRTMEKQ--PPPVRVIAPGKVYRCD-SDLTHTPMFHQVEGLLVDEGISFGDLKGVLTTFVHQMFDPHTSLRFRPSFFPFTEPSAEVDILCVMCRGSGCRVCSNSGWLEILGSGMVHPALYENVGYDADKYTGFAFGMGVERIAMLKYGIDDIRKFFENDARFLRQF... 335
11 0.000e+00gi|306493314|gb|EFM65300.1| phenylalanine--tRNA ligase, alpha subunit [Peptostreptococcus stomatis DSM 17678]  clstr ali  54  19MQEKLKNLKKLAEEQIKSAGNLEEVEKLRVDLLGKKGELTKILKEMGKLSADEKPIIGKLGNEIREMITEGIAEKKESIKSAMLEKKLEMEKIDVTMPGKEFKVGKKHIISKMVDEVTEIFMGMGFSIAEGPEIETVRNNFDALNAPKDHPSRDMTDTFYITEDILLRTQTSPVQVRTMEEKNNDLPLKIIVPGRCFRSDSPDATHSPMFHQIEVLVVGKDITFTEFKGTMETFVKKLFGPETKTKFRPHNFPFTEPSAEIDVSCFKCGGAGCPVCKGEGWIEILGAGMVHPNVLRNCGIDPEVYSGFAAGMGVERLGMLKYGIDDIRLMFENDVRFLDQF... 361
12 0.000e+00gi|940339577|ref|WP_054964690.1| phenylalanine--tRNA ligase subunit alpha [Thiohalorhabdus denitrificans]  clstr ali  51  1MQEQLEAIRGRAEEEIRAAESLDELERLRVGYLGKKGELTGLLKQVGQLDPEQRKEFGQAVNAAKEAVAGLLDARRAEVARAELEHRLEAERIDVTLPGRNAEVGGLHPVTRMLERIEDLFVSMGFEVDKGPEVEDTFHNFEALNIPADHPARMMHDTFYFDGDWLLRTHTSPVQIRVMKDRE--PPLRTIAPGRVFRCD-SDVTHTPMFHQVEGLVVDEHVSFAHLKGLLQDFLQRLFEDDLPVRFRPSYFPFTEPSAEVDIGCVICEGAGCRVCKHTGWLEVLGAGLIHPNVFGHVGVDADRYSGLAFGMGVERLTMLRYGVDDLRLFFENDVRFLAQFQ.. 340
13 0.000e+00gi|949537960|ref|WP_056975192.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus floricola]  clstr ali  55  5..DHIQTLKDQGLTQIKEANDLDTLNNIRVNLTGKKGELTKVLRSMKDLSNEERPKVGQVVNEVRDLFATEIDNKKEQLQQAELEAQMQKEAIDVTLPGKESYLGSHHLINIVRQDIEEFCVSLGYQVITGPEVESDHYNFEMMNIPKNHPARDMQDTFYVDAEHLMRSQTSPVQARTLEKHDSKSPLKMISPGKVYRRDDDDATHSHQFNQLEGLVIDENITMAHLKGTLQAIAQHVFGEDREIRLRPSYFPFTEPSVEVDVTCFACGGKGCSTCKSTGWIEVLGAGMVHPNVLENAGVDSQKYGGFAFGLGLDRFAILKYGVSDIRDFYLNDVRFLEQFRQ. 348
14 0.000e+00gi|519068681|ref|WP_020224556.1| phenylalanine--tRNA ligase subunit alpha [Holdemania massiliensis]  clstr ali  58  2..EKVQQVQAQALEDIQACQDLQQLQQIRITTLGKKGPIQSLMTMMKDLSPEEKPTFGQEVNECKKAVAAAIEEKMAVLEKIAMNQKLQEEKIDITLPGVSFRTGTLHPLTLISQEIEDLFIGMGYTVAEGPEVELDFYNFERANIPADHPARDMQDTFYINPKELLRTHTTAIQMRELEKAQGQLPIKVICPGKVYRRDDDDATHSHQFMQAEGLVVDKNITLTDLKGTLQFLADRMFGKGRQIRFRPSYFQFTEPSVEVDVSCHICGGKGCPVCKGTGWIEVLGAGMVHPNVLEMAGFDSTQCSGFAFGVGIERVAMLKYGVDDIRNFYINDTRFLKMFDR. 342
15 0.000e+00JGI.Meta 7040438705 SRS015663_WUGC_scaffold_44450__gene_106013 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit  ali  56  1MKEKIENIRKEITESLETIEQLKELTNIKVTYLGKKGPINELSQSMKELSIEDKKVLGKALNDFKTEITNLINEKEEYLKQKELQEKLEKEKIDITLPATKLTVGGIHPLIRTVEEIENIFMSMGYDVVEGPEVEQDLYNFEKLNLPKGHPARDAQDTFYIDEEILLRTQTSGVQARTMDANTEKGPIRIICPGKVYRRDDDDATHSHQFMQLEALVVDKNISVANLKGTLEEVIRKLFGEDREIRLRPSFFPFTEPSFEVDVTCFKCGGKGCSICKDTGWIEVLGSGEVHPNVLRNCGYDPEVYTGFAIGIGIERIAMLKYGITDIRSFYTNDMRFLNDFNRV 348
16 0.000e+00gi|952344573|gb|KRT66747.1| Phenylalanyl-tRNA synthetase subunit alpha, phenylalanyl-tRNA synthetase alpha chain [Candidatus Rokubacteria bacterium C  clstr ali  52  8......EILKGARGEAARAKSSADLEQVRVKYLGRQGILTQFLRSLSSIPVAERPEVGREANLAKAEIETLLGERLAELKAAERRHALESQRVDLTLPGRRPSPGTLHPLTLVQDEIIEIFLGLGFAVAEGPEVESDFYNFEALNIPRDHPARDMQDTFYLSEDVLLRTHTSPMQIRIMKAM--RPPLRYIFPGRVYRRDIADASHSPVFHQVEGLAVDRNISMGDLKGTLELFAREMFGPRTTTRFRPSFFPFTEPSAEVDVRCFLCGGEGCRVCKQSGWLEILGSGMVHPQVLRNVGYDPEEVTGWAFGMGVERIAMLKYGIDDIRLFFENDLRFLTQF... 340
17 0.000e+00 GL0033459 [Complete] locus=scaffold26721_5:2581:3654:-  ali  57  9MKEQIENIKKTAIEEIAKAEDLQTLENARVKYLGKKGELTAVLRGMGGLSPEERPIIGGLVNEAKKSLEKLIXXXXXXXXXXXXNKKLEAEKIDITLPSTKMKRGSLHPVTRIIEDIEDLFVSMGYDVVTGPELENDEYCFERLNLPKGHPARDMQDSFYITDEYLLRTQTSAVQARTMMANTEKSPIRMITAGKTYRR-EDDATHSHQFNQIEGLVIDKNVSLADLKGTLEVFVRKIIGANLDLRFRPSYFPFTEPSYEVDVTCFKCGGKGCNLCKQTGWIEVLGAGIVHPNVLKMNGYDPEKFGGFAFGTGIDRLAMFRYGITDMRYLYTNDVRFLSQFDR. 353
18 0.000e+00gi|499502025|ref|WP_011188665.1| phenylalanine--tRNA ligase subunit alpha [Desulfotalea psychrophila]  clstr ali  52  1MEQELQNLENEAKASLTAICASESLEEFRIKYLGRKGLFTTVMRQLGSAPAEDRPRLGQLANTIKAQLEEQFEEKRSSLSQQTSSSDTYQSLPDLTLPGRQPAAGNLHPVTQVMQEVCAIFEAMGFSVAEGPDVEQDYYNFEALNIPAHHPARDMHDTFYVSGSTLLRTHTSPMQARVMEKQD--PPLRMIAPGKVYRCD-SDITHTPMFHQVEGLLVDKNISFADLKGVLTLFLQKIFKQDLPVRFRPSFFPFTEPSAEVDIACVMCGGKGCRVCKKTGWLEILGAGMVDPEVFKMVGYDPEVYSGFAFGLGIERIAMLKYRIDDIRLFYENDQRFLSQF... 338
19 0.000e+00 GL0082691 [Complete] locus=scaffold432_16:45037:46077:-  ali  59  2..EKLTSIKEEGLSQIEACEDLAQLQQLRVLYLGKKGPIQEVMKSMKDLPKEERPAFGQLVNEVKTLFANAIEERRAVLEVAEMEKRIAEEKIDITLSGQKPNLGNAHPLMIVQQEMEDLFIGLGYTVEEGPEVEMDLYNFERANIPKDHPARDMQDTFYINAEELLRTHTTAIQTRQLEKQEGKELIKVICPGKVYRRDDDDATHSHQFMQCEGLVVGEHITLSDLKGTLQFLAQKMFGEERVIRFRPSYFQFTEPSVEVDVSCHVCGGKGCPVCKGTGWIEILGAGMVHPNVLSMAGYDAEKLSGFAFGIGIERVAMLKYGITDIRNFYTNDIRFLKTFNR. 344
20 0.000e+00JCVI_PEP_1096687295297 /source_dna_id=JCVI_ORF_1096687295296 /offset=0 /translation_table=11 /length=366 /full_length=366  ali  50  28..QALDTLKAEATTAISSAEDASALEKLRVELLGKKGRVTDLLKSLGQLDASERPKAGAEINALKQHLNTLISERKQVLQSAALAEQLANERLDVTLPGRGEQTGSLHPITRTIERMAAFFGTLGFDVVEGPEVEDDYHNFEALNIPAHHPARAMHDTFYVDDNHVLRTHTSGVQVRTMERLA--PPIRVICPGRVYRCD-SDLTHSPMFHQVEGLLVDQNVNFGQLKGIIQQFLASFFEDDLAVRFRPSYFPFTEPSAEVDIQCVKCAGKGCRICSGTGWLEVMGCGMVHPRVLEMSGIDGEQFPGFAFGMGVERLAMLRYGIGDLRLNFENDLRFLSQFR.. 365
21 0.000e+00gi|497101701|ref|WP_009470352.1| phenylalanine--tRNA ligase subunit alpha [gamma proteobacterium HIMB55]  clstr ali  54  2..QSLEDIKXXXXXXXXXXXXXXXLEELRVSYLGKKGALTGLLKGLGQLSAEERPKAGAEINAVKQVLNEQLNARKESLQSEALSAQLAAEAIDVTLPGRRAEAGALHPITRTIQRMETFFASMGFDVVEGPEIEDDYHNFEALNIPAHHPARAMHDTFYVDDTHVLRTHTSGVQVRTMETQS--PPIRVICPGRVYRCD-SDLTHSPMFHQVEGLLIDETSNFGHLKGLLEDFLQAFFEDDLSVRLRPSYFPFTEPSAEVDIQCVKCSGEGCRVCSHTGWIEVLGCGMVNPKVLEMSGIDPDKYRGFAFGMGVERLSMLRYGIGDLRLNFDNDLRFLAQF... 338
22 0.000e+00gi|501127416|ref|WP_012176454.1| phenylalanine--tRNA ligase subunit alpha [Desulfococcus oleovorans]  clstr ali  53  1MTESLDGIKERALREIASARDTETLQSVSVKYLGRKGAVTLFLRNLSQLPAEERPRAGQAANQVKQDLQAALDRATEQIAADSA----AVDGIDVSLPGRPVSRGTLHPITRITRRICEIFGRMGFDVVEGPEIETDYYNFEALNIPKHHPARDMQDTFYISDNVVLRTHTSPTQPRVMEKTA--PPLRIIAPGKVYRCD-SDVTHTPMFHQVEGLMVDRNVSFGDLKGILTLFIHRMFDPETSLRFRPSYFPFTEPSAEVDIRCVACRGKGCRICSHTGWLEILGAGMVHPAVFEKAGYDTQAYTGFAFGMGVERIAMLKYNIDDTRKFFENDTRFLRQF... 334
23 0.000e+00gi|497921576|ref|WP_010235732.1| phenylalanine--tRNA ligase subunit alpha [Clostridium arbusti]  clstr ali  53  1MKEKLEEIKNIAIAELKESVNKEDIEKLRVKYLGKKGELTQILRGMGSLSKEERPVIGKVANEVREKIEGIISEAMESIKQKEKEEKLSSEVIDISLPGKKQVIGHRNPLDITLRKTEEIFRSMGFTVEEGPEVEYDKYNFEMLNIPKNHPARGEQDTFYINDNMVLRTQTSPVQIRTMLNQ--KPPIKMISPGKVYRSDAADATHSPIFYQVEGLVVDKGITFADMKGTLEMYIKKMFGENVKTKFRPHHFPFTEPSAELDISCFACGGEGCKVCKGEGFIEMYGCGMVHPQVLRNCGIDPEVYSGFAFGVGLDRIVMQTLGIDDIRQLYESDMRFLDQF... 339
24 0.000e+00gi|145689612|gb|ABP90118.1| Phenylalanyl-tRNA synthetase alpha subunit [Streptococcus suis 05ZYH33]  clstr ali  59  22.EQQLAELSQTTLEKLKEIQGEKELQDLRVAVLGKKGSLTDLLKGLKDLSNDMKPIVGKQVNEVRDVLTTAFEETAQKVAAAKIQQQLASETIDVTLPGRQVKVGKRHVLTQTSEEIEDIFLGMGFQIVDGFEVEKDYYNFERMNLPKDHPARDMQDTFYITEEILMRTHTSPVQARTMDQHDSKGALKMISPGRVFRRDTDDATHSHQFHQIEGLVVGENVSMGDLKGTLEMIIKKMFGEERQIRLRPSYFPFTEPSVEVDVSCFKCGGDGCNVCKKTGWIEILGAGMVHPQVLEMSGIDSTKYSGFAFGLGQERIAMLRYGINDIRGFYQGDVRFSEQF... 364
25 0.000e+00gi|505300205|ref|WP_015487307.1| phenylalanine--tRNA ligase subunit alpha [Thalassolituus oleivorans]  clstr ali  51  2..ENLEALTQQALAATESAQDVAALDQVRVQYLGKKGEITSLMKNLGNVAPEDRPKIGAVINVAKDQVQDAINARKLALETAALNAKLASETIDVTLPGRAVQEGSLHPVTRTLERIEAFFSNAGYHVAEGPEVEDDFHNFEALNIPSHHPARAMHDTFYFDATTLLRTHTSPVQVRTMESQE--PPIRIICPGRVYRCD-YDQTHSPMFHQVEGLLVDKGISFADLKGTIQQFLSVFFEKDLTIRLRPSYFPFTEPSAEIDIEWVIETPEGTK----RRWLEVGGCGMVHPEVFRHVNIDPEEYTGFAFGMGVERLAMLRYGVNDLRLFFENDLRFLQQFR.. 334
26 0.000e+00gi|503055589|ref|WP_013290565.1| phenylalanine--tRNA ligase subunit alpha [Caldicellulosiruptor obsidiansis]  clstr ali  52  1MNADIANLKNQCVEELSKIKNLQELEDFQIKYLGKKGILKSKLKELSSLEPEIRAQMGKELNSLREYIEENIANLRKRFLEEEKQRRIQSERIDVTIPGKRVEIGAIHILSQVQNEIAEIFMNMGYEIAEGPEIELDYYNFEALNIPADHPARDTQDTFYISDDVLLRTHTSPVQIRVMKSK--KPPIKIISPGRVYRSDEVDSTHSPIFHQIEGLFVDKGVTMADLKGTLEVFAKRFFGKETMVRFRPHHFPFTEPSAEVDISCIFCGGKGCRTCKGEGWIEILGAGMVHRKVLLNCGIDPDIYTGFAFGMGVERIALLRYEIEDIRLFYENDLRFLKQFR.. 340
27 0.000e+00gi|931357388|gb|KPJ49741.1| hypothetical protein AMJ40_04830 [candidate division TA06 bacterium DG_26]  clstr ali  53  1MPPSLSQLRESFLKELAVARSLHQLEEVRIQYLGRKGALTSFLKGIGELPPEERPGAGADANQLKSEIERLLEERRSHLQSRVDTERLRTERIDVTLPGRKSPLGKLHPITQVIDEIVGIFVGLGFSVELGPEIESDYYHFEALNMPPDHPARDMWSTFYVTDDLILRAQTSPVQVRVMEKR--KPPIRVISPGRCYRRDPFDPSHAPVFYQVEGLYVDEGVSFGELKGTLEVFVSRMFGEDLGVRFVPSYFPFTEPSAEVKISCVICGGKGCKVCKQSGWLEILGCGMVHPAVFRAVGYDPEKYTGYAFGMGPDRIAMLKYRIDDIRLFYENDLSFLEQF... 339
28 0.000e+00gi|519001823|ref|WP_020157698.1| phenylalanine--tRNA ligase subunit alpha [Methylobacter marinus]  clstr ali  49  1MSAILEEILAQALQQLADAKDLNQLDQVRVQYLGKKGQFTLQMKELGRLDPEQRRSAGQVINEARDQFQQQLEIRKTALEQAALEERLASERVDVTLPGRGQFVAGLHPVTTTLRRISTIFAGVGFKVVEGPEIEDDYHNFSALNIPEHHPARAMHDTFYFDAHTVLRTHTSPVQIRVMES--EQPPLKVIAPGRVYRCD-SDLTHSPMFHQVEGFLVDKDVSFGDLKGVIFEFLQAFFEKDVQARFRPSYFPFTEPSAEFDVSCVMCDGQGCRVCKNTGWLEVGGCGMIHPEVFKSVNIDHEQFSGFAFGMGVERLAMMRYGINDLRLFFENDLKFLEQFK.. 339
29 0.000e+00gi|868678033|ref|WP_048513939.1| phenylalanine--tRNA ligase subunit alpha [Megasphaera cerevisiae]  clstr ali  55  4..DKIEAIKSAVDEQIAKSEAIQDVQDIRVKYLGKKGELTSIMKELKSLSKEDRPKVGQLVNTARGIIEDHLKRKMEDLKECALENKIQSEKIDITLPGRKPVMGHEHPLHLTRRLMEQSFLNMGFSIVEGPDIESDYYNFQCLNLPEDHPARDMQDSMYVTDNILLRTHTSPLEARTLQSHKPNEPFKIIAPGKVYRCD-YDATHSPIFHQMEGMIVDKGIRFSDLKGMLEDFLQDIFGTQTKVRFRASYFPFTEPSAEVDISCVMCGGKGCRVCSHTGWLEILGCGMTNPNVLRINGYDPNEVSAFAFGMGVERIAMLKYGIDDLRLFYENDMRFLNQF... 341
30 0.000e+00gi|501769818|ref|WP_012635508.1| phenylalanine--tRNA ligase subunit alpha [Halothermothrix orenii]  clstr ali  54  3LKKQLEEIKTKAEKEFQDVKDLDHLEQLRVKYLGKKGEITSVLRQMGKIPAEERPVIGKKANILKNKLNNIIIKKKAELEELAKQRKLEKEKIDVTLPGVRPEVGHRHPLNQVIDEIKDIFIGLGFTIAEGPEVESEYNNFEALNIPAHHPARDLQDTLYLYDDLLLRTHTSPVQIRTMAKQ--NPPIRVIAPGRVYRADELDASHSPIFHQVEGLVINENISFSDLKGTIETVVHALFGKDSKIRFRPSYFPFTEPSAEVDVSCNVCHGEGCSLCSRTGWLEIMGSGMVHPNVLEMAGIDPVKYSGFAFGMGLDRIAILKYKLDDIRLLYENDRRFLHQF... 341
31 0.000e+00JGI.Meta 7042974979 C3135087__gene_232378 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit number 1 of subject 1  ali  55  1MKEKIEQIKKSSIEEIKKSETQKELAETKVKYLGKKGKLTLVLREMGKLTPEERPIMGKLVNEVRDILEEEFNKKEKELKSKELQKRLETENIDVTEPSKKTELGSIHPITQIIKEVEEIFLGMGYQIADGPEVEKTFYNFDQLNAPVDHPSRDLQDTFYITDDIILRSQTSPVQARVMESQ--KPPIKIICPGTVYRSDEVDATHSPVFHQIEGLVIDKNISMTDLKGTLEMFAKKCLGENTKIRFRPHHFPFTEPSAEADVSCFVCGGKGCKVCKGEGWIELLGCGMVHPNVLRNCGINPDEYSGFAFGFGVERIAMAKFGIDDLRLLFENDVRFLKQF... 339
32 0.000e+00JGI.Meta 7060953267 C3549545__gene_215978 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome from visit number 2 of s  ali  54  4LREQLQKIKENFIEEVKTVSDKNNLENLRLKFLGKKGELTEILKQMGKLSSEERPLIGKLANEVREEIERKIQDFSEELKKIEMEQKLKSEFIDVTMPVKPRFTGSLHPLSIVTGELEDIFTSMGFSVVEGPEVDTIENNFDLLNAPKFHPSRDVTDTFYLGEDLLLRTQTSTVQARTMKTQ--KPPIRIISPGRCFRCDTPDATHSPMFHQLEGLVVDKGITFANLKYTLEEFSKRFFGEDTKIKFRPHNFPFTEPSAEVDISCFKCKGSGCPTCKGEGWIEILGAGMVHPNVLRNCGIDPEIYSGFAFGFGIDRITMIKYEIDDIRYMYENDMRFLKQF... 342
33 0.000e+00gi|497261670|ref|WP_009575887.1| phenylalanine--tRNA ligase subunit alpha [gamma proteobacterium IMCC3088]  clstr ali  50  2..EALKQIQAEALAAIGGASELPQLEQLRVDYLGKKGALTAVLKGLSQLTPEERPAAGAKVNEVKAELQALINERKAALEAEALQAQLASESIDVTAPARGVSSGGLHPVSVTIERIEALFAAMGFEVVEGPEIEDDYHNFGALNIPDHHPARAMHDTFYVDETHVLRTHTSPVQVRVMESQE--PPLRVICPGRVYRCD-SDLTHTPMFHQVEGLLIDEQSSFADLKGLIEVFLQRFFEQDLAVRFRPSYFPFTEPSAEVDIQCVHCKGEGCRVCSQTGWLEVMGCGMVHPSVFESSNIDTKRYSGFAFGLGVERLTMLRYGVNDLRLFFDNDLRFLSQFR.. 338
34 0.000e+00gi|764403583|ref|WP_044352042.1| phenylalanine--tRNA ligase subunit alpha [Dethiosulfatarculus sandiegensis]  clstr ali  52  1MLDQLESIRDNALAAISGAQNPAELDALKTRFLGRKGELTQLLRKTGSLPADQRPLFGQTANQVKQKVQEALDQKAEELEQAQKGRAEGTE--DVTLPGIRPKRGRLHPVTQAERLILSVFTQMGFDVAESPEVELDWYCFEALNMPPDHPARDMQDTFYVAPDVVLRTHTSPVQIRTMEAH--KPPVRIVCPGKAFRRD-SDATHTPMFHQVEGLMVDKGISFADLKGVLTTFVRQIFGSDTPVRFRPSFFPFTEPSAELDIGCANCKGKGCRVCSHTGWLEILGSGMVDPNVFANVNYDPKEVSGFAFGMGIERIAMLLWGIDDLRMFYDNDLRFLRQF... 336
35 0.000e+00gi|948855460|gb|KRM72852.1| phenylalanyl-tRNA synthetase subunit alpha [Lactobacillus brantae DSM 23927]  clstr ali  57  4LKAKLEALAKQNHDRIQQIGTLAELNDVRINLLGKKGPITEVLRGMKDLDAQERPQVGAFANKIRDDLTEAIQSRKEQLEQAQIQQQLAAETIDVTLPGRPIQRGTSHVITQIMDDLEEFFMGMGYQVVSGPEVEEDHYNFEMMNIPANHPARDMQDTFYINDELLMRTHTSPVQARTLEKHDSKGPLKMISPGRVYRRDTDDATHSHQFHQLEGLVVDKHITLADLKGTLLAMVRHVFGADREIRLRPSYFPFTEPSVEVDVTCFRCGGVGCPVCKYTGWIEVLGAGMVHPNVLRAAGVDADVYGGFAFGLGPDRFAMLKYGIDDIRSFYQNDLRFLSQFQR. 347
36 0.000e+00JGI.Meta 7007079127 SRS015057_WUGC_scaffold_48231__gene_59197 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome from  ali  54  1MSQNLEGIRKAAEELLEKAGSPDALNAIRTRFLGKKGELAEAKKHLKDLAPEERPSFGQLVNQLSEQIEKEIKERREEMEKALQDKRLLSETIDVTLPGKKIRYGHPHPNTLALEEVEKIFTGMGYEVVEGPEVEYDSYNFEKLNIPKGHPARDEQDTFYINSNILLRTQTSSVQARYMETH--KPPFRMICPGRVFRSDAVDATHSPSFHQVEGLVIDKHIHFSDLKGTLDLFAKELFGKDTKTKLRPHHFPFTEPSAEVDVSCFKCKGKGCRFCKGEGWIEILGCGMVHPKVLESCGIDPKEYSGFAFGVGLERIALLKYEIDDMRLLYENDVRFLEQF... 340
37 0.000e+00gi|380878852|gb|EIC20944.1| phenylalanyl-tRNA synthetase, alpha subunit [Thiorhodovibrio sp. 970]  clstr ali  50  12..QQLADLGERLRTEATTADSLAALDEVRVRYLGKNGHLTALLKQLGRLPAESRPSAGQAINQAKSAAQQQLDQERARLETKALEARLAGERIDVTLPGRGQHPGGLHPVTRTMNRIERLFASAGFEVAEGPEVEDDYHNFEALNIPPEHPARAMHDTFYFPDGRLLRTHTSPVQIRVMES--CEPPLRIIAPGRVYRCD-SDLTHTPMFHQVEGFLVDDRATFADLKGLLYDFLRQFFEDDLSLRFRPSYFPFTEPSAEVDVQCVKCGGSGCRICKQSGWLEVLGCGMIHPEVFRHVGIDTERFQGYAFGMGVERLAMLRYGVDDLRLFFENDLRFLAQFR.. 349
38 0.000e+00JGI.Meta 7067888194 SRS064557_LANL_scaffold_30627__gene_54613 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit n  ali  57  1MKNQLESIRAAAKEALEGSHAAADIEQLRIKYLGKKGELTSILKQMGKLTPEERPVIGQLANEVRTFIEDAIESKVQELNEKKQLEQLKAEKLDVTLPGKKPVLGAKHPLTIVLDEIKEIFVGMGFDIVEGPEVETDYYNFEALNMPKNHPARDTQDTFYINDNIVLRTQTSPVQVRTMEQQ--KPPIRVISPGRVYRSDAVDATHSPLFHQIEGLVVDKGITFADLKGTLETFVKRLYGEDSVVRFRPHHFPFTEPSAEVDVQCFSCHGEGCRLCKGEGWIEILGCGMVHPKVLSNCGIDPEVYSGFALGLGLER............................ 314
39 0.000e+00gi|517548342|ref|WP_018718550.1| phenylalanine--tRNA ligase subunit alpha [Arhodomonas aquaeolei]  clstr ali  53  4..QDLDALVAAAEQAIDAAGDLAELDAVRVDYLGKKGRLTAELKQLGRLPAEERPAAGQAINAAKQRLAERLEGRREALERASLARSLEAERVDVTLPGRGTAPGGLHPITRTLERIEDLFAAVGFSIAEGPEVEDDYHNFEALNIPAHHPARAMHDTFYFDARHLLRTHTSPVQIRVMENDGA--PVRVIAPGRVYRCD-SDLTHTPMFHQVEGLLVDEGITFGDLKAVLDDFVKRFFEQDLAVRFRPSYFPFTEPSAEVDVECMFCSGDGCRVCGGSGWLEILGCGMVHPAVFEHVGVDPERYSGYAFGMGAERLAMLRYGVNDLRIFFENDLRFLRQFR.. 340
40 0.000e+00 GL0071480 [Lack 5`-end] locus=scaffold52575_2:3408:4466:-  ali  53  7MKEKLNILKKEALEEISICKDEFSINNTKSKYLGKKSEFSQIMSNMKTLSNEEKKEVGALSNEFRIELNDAINLKLKEIKEETLKKKLEKDKIDITLPSKKNKRGTIHPLTKIREEIEDLFISMGYDVVDGPEVETDKYCFEMLNVPKGHPARDAQDTFYIDDELLLRTQTSAMQVRYMLSRADKKPFKMICPGKVYRRDDDDATHSHQFMQIEGLVVGKNISLSDLKGTLELLVRKMFGKDRNIRFRASYFPFTEPSYEVDVSCFNCNNKGCNICKHTGWIEILGSGMVHPNVLRDCGFDPEVYTGFAFGLGIERVAMLKYGINNIRLFYSNDERFLNIFDR. 349
41 0.000e+00JGI.Meta 7070808445 C3948047__gene_297006 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome from visit number 3 of s  ali  55  12MDNNIEGLKQQFLEELNNVTTSRELEDLRVKYIGKKGLVTDLLKIMGSLSPDERPVYGSKVNSVKSLIEDTIRTNEDELNKKEIQEKLNAEKIDVTLPSTKIGRGSKHPLTRTIEEIEDLFVSMGYDVVSGPELENDEYCFERLNLPKGHPARDAQDSFYITAEYLLRTQTSAVQARAMMANVEKGPLRIIVPGKTFRR-EDDATHSHQFNQVEGLVIDKGISFADLKGTLEIFMKHMLGDDTKLRFRPSYFPFTEPSYEVDVSCFKCHGKGCNLCKQTGWIELLGSGIVHPNVLKMNGYDPEVYSGFAFGTGIDRLAMFKYGITDMRFLYQNDVRFLNQFDR. 353
42 0.000e+00gi|739413186|ref|WP_037273560.1| phenylalanine--tRNA ligase subunit alpha [Ruminococcaceae bacterium AE2021]  clstr ali  57  4LKESLLNTRAEFEEKIKSLTNSKEIEALRVEFFGKKGKLTGVLRGMGQLSPEERPAAGKLVNEVREKMESVFSEYQSKIVDLENSHKLKKEVIDVTLPTSYKGAGARHPLNMAINEICDIFLGLGYSIGEGPEVEYDKYNFELLRLPKGHPARDTQDTFYISDNILLRTQTSPMQIRIMENQ--KPPIKVICPGKVYRQDTLDSTHSPVFHQIEGLVVDKGITMGDLVGSLQLFAKKLFGEDTKIRLRPHHFPFTEPSVEVDLTCWSCGGKGCRVCKGEGWIEVLGAGMVHPEVLENCGIDSEEYSGFAFGIGVERTAMGRYGIDDIRLLYENDVRFLKQFK.. 343
43 0.000e+00gi|496497567|ref|WP_009206103.1| phenylalanine--tRNA ligase subunit alpha [Sulfuricella denitrificans]  clstr ali  47  3...NLDDILKEAQAAFAGIDNPAELEQAKARYLGKSGVLTEQLKQLGKMPPEERREAGARINQAKDLLEQALKDRREAIQERLLQAQLAQEALDVTLPGRGLGVGGLHPVTRTLQRIEGLFRSIGFSVAEGPEIESDFYNFTALNIPENHPARAMHDTFYVDEQHVLRTHTSPVQVHYMQNH--QPPLKIIAPGRVYRCD-SDVTHTPMFHQVEGLWVDEQVSFAELKGVLADFMQRFFEDDLKVRFRPSFFPFTEPSAEMDIGCVMCGGAGCRVCSHTGWLEVLGCGMVHPNVLGHVNVDSEKYLGFAFGLGVERLAMLRYGVNDLRLFFESDLRFLRQFN.. 339
44 0.000e+00gi|737181362|ref|WP_035167298.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus curieae]  clstr ali  55  3LREDLTNIRTENLKVIETTGDLKKLNDIRVNLLGKKGPITTALRSIKDLPVEERPEVGSYANEIRDDLTQAIANQKEKLETAEMNERLAKESIDVTLPGTELPQGQPHVIQQIIDQIVDLFLGMGYEVLTGPEVEEEKYNFEMMNLPKDHPARDMQDTFYLTSDILMRTQTSPMQARTLEKHDSQGPLKMISPGIVYRRDTDDPTHSHQFHQVEGLVIDEHITMADLKGTLITMTHEIFGDKFDIRLRPSYFPFTEPSVEVDVTCFNCMGKGCDVCKHTGWIEVLGAGMVHPNVLKMAGVDPDVYGGFAFGLGPDRFAMLQYGVTDIRDFYLNDVRFLNQFDK. 346
45 0.000e+00gi|490773652|ref|WP_004635869.1| phenylalanine--tRNA ligase subunit alpha [Dolosigranulum pigrum]  clstr ali  59  3LKEQLQAIQQKAIERLEQAKETQAVEDIRIKYLGKKGDVTQVLKGMKDLSPKERPIVGKLANDVRDTIQAKISERKAVLHQEALNKQLEEETIDVTLPGTTHSVAQTHIILQVIEEIEDLFLGMGYKIVEGNEVETEHYNFERINVPKHHPARDMQDTFYIDESYLLRTQTSGTQPRTLEQHNEEGPLKMISPGKVYRRDTDDATHSHQFHQIEGLVIDKDIAMTDLKGTLEEVAKAMFGDKHDIRLRPSYFPFTEPSVEVDVTCFKCQGEHCSVCKNTGWIEILGAGMVHPHVLEMSGVDPTVYGGFAFGLGPDRIAMLKHEIDDIRHFYTNDQRFLSQFK.. 347
46 0.000e+00gi|948629507|gb|KRK61118.1| phenylalanyl-tRNA synthetase subunit alpha [Lactobacillus farciminis KCTC 3681 = DSM 20184]  clstr ali  59  21LNDTLKNLRENGIDEAKRAQKLQELNDLRVNLLGKKGPITKALRGMKDVPAEQRPEIGTLANNVKKDIQAAIEEKMAELNQKLVAKKLEEETIDVTLPATKKVQGTKHILNQTIEDIEQFFIGLGYEVAGGYEVEEDHYNFERLNIPKDHPARDMQDTFYLSDELLMRTQTSAQEGRDMEAHDTKGPLKMISPGVVYRRDDDDATHSHQFHQIEGLVVDKNISMADLKGTLDALCRHVFGPDREIRFRPSYFPFTEPSVEVDVSCFNCGGTGCRICKYTGWIEVLGAGLTHPNVLKMSGIDPNEYSGMAFGLGPERFAMLKYGVNDIRDFYLNDVRFLEQFKGV 365
47 0.000e+00gi|949541316|ref|WP_056978396.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus senioris]  clstr ali  55  3LKDDLTKIKDQGLTSIADADDLQTLNDIRVKLLGKKGPITSALRGIRDLAVEERPVVGGYANEIRDVLTEKIEQQKQYLEDLALQAKLNSETIDVTLPGTPVRQGQPHVIQQIIDQVVDLFIGMGYQVLTGPEVEEDKYNFEMMNLPKDHPARDMQDTFYLSDDILMRTQTSPMQARTLETHDDAGPLKMISPGIVYRRDTDDPTHSHQFHQIEGLVIDKHITMADLKGTLATMIEQIFGSKFDFRLRPSYFPFTEPSVEVDVTCFNCMGKGCDICKHTGWIEVLGAGMVHPNVLRMANVDPDVYGGFAFGIGPDRFAMLKYGVDDIRDFYLDDVRFLSQFNR. 346
48 0.000e+00gi|740245761|ref|WP_038086737.1| phenylalanine--tRNA ligase subunit alpha [Acidihalobacter prosperus]  clstr ali  51  2...ELDALKREALSRVGEATDLGALDALRVEYLGKKGVLTEQLKRLGSLPAEQRPQAGQAINAIKQEVAEAIADRRAALENEALSARLEGERVDVTLPGRGQETGGLHPLTQTIERIKSLLSQAGFTTEEGPEIEDDFHNFEALNIPNNHPARAMHDTFYFPDGRLLRTQTSPVQIRVMETQE--PPLRFIAPGRVYRCD-SDLTHSPMFHQVEGLAVDEGITFADLKGVLGDFLRAFFEDDLRTRFRPSYFPFTEPSAEVDIECVHCRGEGCRVCGHTGWIEVLGCGMVHPQVFAQVGIDSERFTGYAFGMGVERLALLRYGVTDLRLFFDNDLRFLRQF... 337
49 0.000e+00JGI.Meta 7054091769 C2732704__gene_263019 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit number 1 of subject 1  ali  60  1.........................NDLRVFYLGKKGPMQAAMKSMKNMNQEERATFGQVSNKVKQEITQAIENKKVALEEAEMNAKLASENIDITLPSTALPLGSLHPLSVVKNDIEELFLGMGYQIAEGPEVESDHFNFELMNLPKGHPARDMQDTFYIDENTLMRTHTSPVQAHAMIAAEGKGPIKVICPGKTYRRDDDDATHSHQFMQCEGLVIDKNITMADLKGTLEVFAKKMFGEKRKIRLRPSYFPFTEPSVEVDISCHNCEGKGCPMCKHTGWIEILGAGMVNPRVLEMCGFDPEVYQGFAFGIGLERVAMLKYNIDNIRDFYNNDLRFLNQFGR. 318
50 0.000e+00gi|305857435|gb|ADM69223.1| phenylalanyl-tRNA synthase subunit alpha [Paenibacillus polymyxa E681]  clstr ali  65  7MKEHLLALKEEALEVLEKVATPKELADLRVKYSGKKGALTEILRGMGKLSAEERPVVGQVANEVREAIEEVVNRKQDEFTKAETNERLQAEKIDVTLPGRALPQGGLHPLNKVIEQIEDIFTGMGYRVAEGPQAETDYYNFEALNLPKNHPARDMQDSFYLTEDLLMRTHTSPVQIRAMEAMKGETPIKVICPGTVFRRDDDDATHSFQFHQIEGLVIGKDIRMSDLKGTLLQFAREMFGESTEIRLRPSFFPFTEPSAEVDVTFVKKNGE--RV-----WIEILGCGMVHPKVLEMGGFNPEVYSGFAFGMGVERIAILKYGIDDIRHFYNSDLSFLKQFAR. 342
51 0.000e+00gi|524620641|emb|CDD36960.1| phenylalanine--tRNA ligase alpha subunit [Clostridium sp. CAG:356]  clstr ali  54  1MQDKIEEIKKQAEEKIKEIKNSQELQELKVKMLGKKSELSNLLKGLGKLSPEERPKVGALVNEARKTIEEKIAIAEDAIMENMLAEKIEEETIDITLPGTKIKRGSKHPVNRVIEEIEDLFVSMGYDVVSGPELETDEFCFERLNLPKGHPARDMQDSFYITNEYLLRTQTSAVQARTMLANTEKTPIRMICAGKTYRR-EDDATHSHQFGQVEGLVIDKNVSLADLKGTLEVFVKKLIGKNSELRFRPSYFPFTEPSYEVDVTCFKCGGKGCNLCKQTGWIEVLGSGIVHPNVLKMNGYDPEKYSGFAFGTGLERLAMFKYGIPDMRYLYANDIRFLSQFDR. 345
52 0.000e+00gi|374849412|dbj|BAL52428.1| phenylalanyl-tRNA synthetase alpha chain [uncultured gamma proteobacterium]  clstr ali  51  1MSEPVADWLKQAERELAEARSLSALDQIRVRYLGKKGLFTQRLSELGRLSPEERKAAGKVLNEARQIFQRLLEARRGALARAELEARLQAEALDVTLPGRGQGVGGLHPVTLTLRRIEQLFASCGFQVAQGPEIEDDYHNFAALNIPAQHPARAMHDTFYIDQETLLRTHTSPVQIRVMEQ--GRPPFKVIAPGRVYRCD-SDLTHTPMFHQVEGFLVDRGICFADLRGVLDQFLRAFFEQDVRVRFRPSYFPFTEPSAEVDISCVLCSGAGCRVCGQSGWLEVMGCGMIHPKVFQAVGIDPERFTGFAFGLGVERLAMLRYGIDDLRLFFENDLRFLAQFH.. 339
53 0.000e+00gi|489875239|ref|WP_003778746.1| phenylalanine--tRNA ligase subunit alpha [Alloiococcus otitis]  clstr ali  59  3LQEKLQDLQQQALKEINQVDSLDQLESIRLSYLGKKGQVTQVLKGMKDLDPKDRPLVGKTANEVSDDIKDMIETSKDRLESQALDQKLAEETIDVSLPGRSSEPGQTHVILQVIEELEDLFIGMGYKIVEGYEIETDHYNFERVNVPKDHPARDMQDTFYIDDLHLLRTHTSPTQPRTLEKHDSKSPLKMISVGKVFRRDTDDATHSHQFHQIEGLVVDKSISLGDLKGTLEVMAKKIFGDSRQIRLRPSYFPFTEPSVEVDLSCFNCDGEGCSICKHTGWIEVLGAGMVHPQVLEMSGVDSSTYSGFAFGIGADRIAMLKYEVDDIRHFYLNDQRFLSQFK.. 345
54 0.000e+00gi|551218935|ref|WP_022846873.1| phenylalanine--tRNA ligase subunit alpha [Desulfurobacterium sp. TC5-1]  clstr ali  52  4..ETLEKLKSKFIEELSKIENLKSLDELRVKYIGRKGEVTSLLKRIPELPPEERKSFGKACNELKKEVETLLQNRIKELKAREKEEKLKKEFIDITLPGRRIPSGALHPITKTLSEITKIFTSMGFAIASGPEIETDFYNFEALNIPKGHPAREMQDTFYIKEEVVLRTHTSPVQIRVMES--TNPPIQIIAPGKVYRKDA-DLTHTPMFHQVEGLMVDTSVTFADLKGVLELFLREFFGSETKVRFRPSFFPFTEPSAEVDIGCVICGGKGCKVCKGTGWLEVLGCGMVDPAVFKAVNIDPEIYQGFAFGMGVERLTMLKYGIDDLRLFFENDLRFIKQFKGL 342
55 0.000e+00gi|913011120|ref|WP_050356203.1| phenylalanine--tRNA ligase subunit alpha [[Clostridium] purinilyticum]  clstr ali  52  1MKDNLINIKEKALLEIKDVNDLQALDQIRVKYLGKKGELTQVLRGMGGLSKEERPVVGQIANEVREAIEINIEASKNELKNKEKKARLELEKIDITMPGKDIKVGHRHPLITVMEELENAFMSMGFDIVQGPEVETVYNNFDALNSPENHPSRDESDTFYITDDILLRTQTSPVQIRTMKQ--SKPPIRIVSAGRTFRFDDVDDTHSPMFHQLEGLVVDKNVTFANLKDTIDMFIKKIFGSEMKTRIRPHYFPFTEPSAEVDVTCFKCMGKGCDSCSGTGWMELLGCGMVHPNVLRNCGIDPNEYSGFAFGIGIDRIAMVKYGINNIRLLFENDMRFLNQF... 340
56 0.000e+00gi|554673585|ref|WP_023174989.1| phenylalanine--tRNA ligase subunit alpha [Gloeobacter kilaueensis]  clstr ali  56  1MKDQLDALQLEALGAIHSAADLNVLERIRVDFLGKKGRLSAILGGMGRLSTEERPLVGALANKVKARIEEALEAQRLDLEEQQIARRLEAEHIDVTMPGRFVPPGRLHPLTSTTDRIVDVFVGLGFTVATGPQIETDYYNFEALNTPADHPARDMQDTFYLSDGLVLRTQTSSVQIRYMEENE--PPIRICAPGRVYRRDQVTNRHSPVFHQVEILAVDEEITFGDLKGTLTFFTQELFG-DRPVRFRPSYFPFTEPSAEVDVQCRFCGGRGCRVCSHTGWLEIAGCGMVDPNVFQAVGYDPEKVQGFAAGMGIERIAMLLYDISDIRLFYTNDWRFLRQF... 338
57 0.000e+00gi|491512015|ref|WP_005369649.1| MULTISPECIES: phenylalanine--tRNA ligase subunit alpha [Methylomicrobium]  clstr ali  48  6.....EEILAQASTALADAQDLTQLDQVRVHYLGKKGLLTQLMKELGALDPDQRREAGQKINQAKDRFQEQLDGRKQVLEAKELATRLASERIDVTLPGRGQAVAGLHPVTTTLRRIAKIFTSAGFRAVEGPEIEDDYHNFEALNIPAHHPARAMHDTFYFDAHTVLRTHTSPVQIRVMES--EEPPLKVIAPGRVYRCD-SDLTHSPMFHQVEGFLVDRDVSFADLKGVIYDFLQAFFEKDSRVRFRPSYFPFTEPSAEVDIECVICNGSGCRVCGQSGWLEVMGCGMIHPEVFKAVDIDSEKYTGFAFGMGVERLAMLRYGINDLRLFFENDLKFLQQFK.. 339
58 0.000e+00gi|503472577|ref|WP_013707238.1| phenylalanine--tRNA ligase subunit alpha [Desulfobacca acetoxidans]  clstr ali  53  4..EELQRLEPEALAEINAAGSAPALDQIRVKYLGRKGIITQALRSLGGLPVEVRPQFGQEANRLKKLLEQQLASAHDCLKKAALEAETAA-GLDLTLPGRQLDRGRLHPITQITREICDIFTRMGFQVVEGPEVETDYYNFEALNIPRDHPARDMQDTFYISDSIVLRTHTSPMQVRVMEQQ--QPPVRIVAPGKTFRRD-SDLTHTPMFHQVEGLLVDTDVSFADLKGVLTTFVHEMFGPEVGLRFRPSFFPFTEPSAEVDIRCVICQGAGCRVCKQTGWLEILGAGMVDPEVFRFVNYDPEVYVGFAFGMGIERIAMLKFGIDDLRLFFDNDLRFLKQF... 338
59 0.000e+00JCVI_PEP_1096687141865 /source_dna_id=JCVI_ORF_1096687141864 /offset=0 /translation_table=11 /length=360 /full_length=360  ali  52  22..DELKTLQDDALKKVQDARALSELEQVRVHFLGKKGLISQQMKALGQLAPEDRPAAGAQINVVRDAVAEAIDAQKAALERAEESKTLAREAIDVSLPGRPLEPGGLHPVTRTLDRLNALFASLGYAVATGPEIEDDWHNFEALNIPSHHPARAMHDTFYFDDGRVLRTHTSPVQIRTM--MTEEPPIRIVAPGRVYRCDH-DLTHTPMFHQIEGLVVDRDISFSDLKGTIVTFLNRFFEADLDVRFRPSYFPFTEPSAEVDVQCVMCAGDGCRVCKQTGWLEVMGCGMVHPKVFEETGVDTSVYTGFAFGMGIERLAMLRYGIGDLRLFFENDLQFLNQFRG. 359
60 0.000e+00JGI.Meta 7051520390 C3169363__gene_267665 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit number 1 of subject 1  ali  55  1MREQLQKIKLTAQQELSECSDLKELEQLRIKFLGKKGELTSVLRTMGSLSADERPQIGALANEVRKFIETTIEQKKDMLNKSALLARLKDERIDVTMPGRKTKIGKEHPLTIVLNEIKEIFLGMGFSIASGPEVEYDHYNFEMLNMPKDHPARDTQDTFYITENILLRTQTSPVQIRVMEN--EKPPIKVIAPGRVYRSDEVDATHSPLFHQIEGLVVDKGIRMSDLKGTLELFAKRIYGDDVKVRFRPHHFSFTEPSAEMDICCFGCGGKGCRLCKGEGWIEILGAGMVHPKVLRNCNIDPEVYSGFAFGIGLERIVMRRFDIDDMRLFFENDQRFLNQF... 339
61 0.000e+00gi|499566740|ref|WP_011247523.1| phenylalanine--tRNA ligase subunit alpha [Bacillus clausii]  clstr ali  75  1MREQLTALKHEALDKAEVAKSEQDIQAIRVAYLGKKGPITEVLRGMGKLSAEERPIIGALANEVRDEIKNKLDEKSKKLQEAAIKQQLEQESIDVTLPGRPALQGAIHPLTAVVTEIEEIFLGLGFSIGEGPEIETDYYNFEAMNLPKDHPARDMQDSFYVTEDLLLRTQTSPVQARTMEKFAGKGPVKVVVPGKVFRRDDDDATHSHQFMQVEGLYVDKKVRMSDLKGVLETFAKQFFGQDRSIRLRPSFFPFTEPSVEVDVSCGICSGKGCRVCKQSGWIEVLGAGMVHPRVLEMSGFDANEYSGFAFGMGVERLAMLKYDIDDIRQFYANDLRFLMQFKDV 344
62 0.000e+00gi|1012046139|gb|KYO65226.1| Phenylalanine--tRNA ligase alpha subunit [Thermovenabulum gondwanense]  clstr ali  58  1MKEELIALKSELDELLGSIDDLTEINSLRVKFLGKKGKLTALMKKMGELPPVERPVIGQLVNRIKEEMEFAIEEKIKTXXXXXXXXXXXXXXXDVTVP-TKVILGHRHPLTIVLNEVINFFYGLGYEVVEGPEVEWDYYNFEALNIPKDHPARDLQDTFYITEDILLRTHTSPVQIRTMEK--SKPPIKVIVPGRVYRSDAVDATHSPVFHQVEGLVVGESVTMADLKGTLTAFAKAIFGEERKTRFRPSFFPFTEPSAEMDISCISCNGIGCRLCSYTGWIEILGCGMVHPNVIKNGGYDPEKVSGFAFGMGLERIALLKYNIDDMRLLFENDLRFLSQF... 338
63 0.000e+00gi|653062277|ref|WP_027313596.1| phenylalanine--tRNA ligase subunit alpha [Balneatrix alpica]  clstr ali  52  2..EHLDTLLAQGREAVAQAADLQALDAIRVQYLGKSGELTQLLKGLGKLSAEERPQAGAAINAAKEALQEALNGRRDQLQQAELAAQLASERIDVTLPGRGQQLGGLHPVTKTIERIQDFFGSIGYSVAEGPEVEDDYHNFEALNIPSHHPARAMHDTFYFDVGTLLRTHTSPVQIRTMEAQ--QPPIRIICPGRVYRCD-SDQTHSPMFHQVEGLLVDKGISFADLKGTVERFLRVFFEQDLSVRFRPSYFPFTEPSLEVDI--------GYSVNGEQRWLEVMGCGMVHPKVFEYVGIDSEVYTGFAFGMGVERLAMLRYGVKDLRLFFDNDLRFLQQFR.. 330
64 0.000e+00gi|938893050|ref|WP_054677570.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus sharpeae]  clstr ali  58  3LQDRLLALKQENQQRIEDAKELGDLDKIRVNLLGKKGPITEVLRGMRDLEASERPKVGAFANAIRDELKTAIDVQRKALEQEAIANKLAKETIDVTLPGAPVRQGTPHILQQTIDDLEDFFMGMGYQVVDGYEVEEDHYNFEMLNIPADHPARDMQDTFYIDQELLLRTQTSASQARTLERHDSKGPLKMVSPGRVYRRDNDDATHSHQFHQMEGLVIDKHITMGDLKGTLLAMAQHVLGADRKIRLRPSYFPFTEPSVEVDISCFKCGGTGCAVCKQSGWIEVLGAGMVHPNVLIAAGVDPEVYGGFAFGVGPDRLAMLKYGVDDIRSFYTDDVRFLEQFQ.. 345
65 0.000e+00gi|332314497|gb|EGJ27482.1| phenylalanine--tRNA ligase, alpha subunit [Streptococcus porcinus str. Jelinkova 176]  clstr ali  59  28LQEQLEALRNQTLNQLKELTGSKELQDLKVAVLGKKGSLTELLKGLKDLSVDMRPLVGKQVNELRDVLINAFEQQGKVVEAAKIQDQLDAESIDVTLPGRQMAIGNRHILTQTSEEIEDIFLGMGFQIVDGFEVEKDYYNFERMNLPKDHPARDMQDTFYITDEILLRTHTSPVQARTLDQHDSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMGDLKGTLEMIIKKMFGEERKIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVCKGTGWIEILGAGMVHPSVLEMSGVNAEEYSGFAFGLGQERIAMLRYGINDIRGFYQGDMRFSEQFN.. 372
66 0.000e+00gi|410504468|gb|EKP93978.1| phenylalanyl-tRNA synthetase, alpha subunit [Thermaerobacter subterraneus DSM 13965]  clstr ali  55  36..EGIAQLQHQXXXXXXXXXSLADLERLRVEWLGKKGRISQLLRQMGSLPPDRRPAFGQRANAARQAVEEALSRRRRELEAQEERRRLAAERIDVTLPGRPVLRGRRHPLRRVELEIIAIFRGLGFTVAEGPEVERDYYNFEALNIPADHPARDMHDTFYLTDDILLRTHTSPVQVRYMQARTPQLPVRIIAPGRVYRRD-DDATHSPMFHQVEGLLVDRGVSFAHLKGTLAEFARRMFGPQTRYRFRPSYFPFTEPSAEMDVSCPLCGGSGCRTCGGSGWIEILGSGLVHPAVLRAGGYDPEQVSGFAFGMGIERIAMIKYDIDDLRLFFQNDLRFLGQFR.. 374
67 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  55  1MKEQIAKMKEIALEEINKAQDITGLNNARVKYLGKKGELTAILRGMKDLSAEERPVIGSLVNVVKAELENLIEVREEEFKKAEINKKLEQEKIDITLPATKVKRGSKHPVNRIIEEIEDLFVSMGYDVCSGPELETDEYCFERLNLPKGHPARDMQDSFYITDEYLLRTQTSAVQARTMMANTEKTPIRELTAGKTYRR-EDDATHSHQFGQVEGLVIDNNVSLADLKGTLEVFVRKVIGKNSELRFRPSYFPFTEPSYEVDVSCFKCGGKGCNLCKQTGWIEVLGCGMVHPNVLKINGYDPEKFGGFAFGTGIDRLAMFKYGIPDMRYLYANDVRFLSQFDR. 345
68 0.000e+00gi|499735835|ref|WP_011416569.1| phenylalanine--tRNA ligase subunit alpha [Syntrophus aciditrophicus]  clstr ali  54  1MIEDLKELQNKAEAEIKAAKTETDLAAVRVRYLGRKGLLTQFLRNLGQLSIEEKQIFGKRANEIKTILSSRFDEAQTVIAALKKESVLRAEALDVTLPGRSSGYGRAHPVTQVLEEICAIFSEIGFSIAEGPEIESDYYNFEALNIPKDHPARDMQDTFYVEEAIVLRTHTSPVQIRTMEKQS--PPVKIISPGRVYRPD-SDVSHTPMFHQVEGLLVDRGITFGDLKGLLNAFLKQIFGEETVLRFRPSYFPFTEPSAEVDIRCVICRGKGCRVCGQSGWLEILGSGMVDPAVFENVGYDPEEYSGFAFGLGVERIAMLKYGITDIRLFFENERRFLQQF... 338
69 0.000e+00gi|494192882|ref|WP_007121735.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus gastricus]  clstr ali  58  3LKDQLTELRAQALEAIQNSTDDQAINEARVKFLGKKGPITAVLRGMKDLSKEERPKVGQFANEIRDQIQVALDEKRSAIEAARLNQQLASETLDVTLPGRPVIQGQPHVIQQIIDQIIDLFVGMGYEVATGHEVEEEVYNFEKLNLPKDHPARDMQDTFYITPSILMRTQTSPMQARMMEKHDSRGPLKMISPGKVYRRDTDDATHSHQFHQVEGIVIGEHITMADLKGTLEAVAQNLFGDELSVRLRPSYFPFTEPSVEADITCFNCHGQGCSICKQTGWIEALGAGMVHPNVLKMSGVDPEVYGGFAFGLGPDRFAMLKYGVEDIRNFYLNDMRFLTQFDQ. 346
70 0.000e+00gi|740685962|ref|WP_038471251.1| phenylalanine--tRNA ligase subunit alpha [Mollicutes bacterium HR1]  clstr ali  57  5..DKLKAIQESALEDIKVIKSMHELNDVKAKYLGKKGVFSDVMKLMKDLPNEERPSFGKMTNETKQVILKYIEEQRTLIERVKVEEQLSKETIDVTLPGKRMSSGNRHLLTQVVEELEDLFIGMGYEIMEGPEVETDEYNFEKLNLPKDHPARDMQDTFYITEDTLLRTHTSPVQIRTMLEVGGTEPIKILCPGKVYRRDDDDATHSHQFMQIEGLVVDETTSMADLKGTLLEVANKMFGEGRDIRLRPSYFPFTEPSVEVDISCHNCNGKGCNICKGTGWIEVLGAGIVNNNVLEASGYDSTKYRGFAFGIGVERMAMLKYGINDIRQFYTNDLRFNKQFKK. 345
71 0.000e+00gi|496217091|ref|WP_008931333.1| phenylalanine--tRNA ligase subunit alpha [Ectothiorhodospira sp. PHS-1]  clstr ali  53  2..ESLSNLTDAALTAIRASADLRHLDDLRVHYLGKKGVITEQLKSLGALPPEQRREAGQAINQAKQVVAEALEARREALEMAAREARLAAETLDVTLPGRRQEPGGLHPVTLTIERIQALLEQLGFAVAEGPEVEDDYHNFEALNIPSHHPARAMHDTFYFDATTLLRTHTSPVQVRVMENQA--PPLRIIAPGRVYRCD-SDLTHSPMFHQVEGLVVDEQVTFAHLRGVLDAFLRAFFEQDLKTRFRPSYFPFTEPSAEVDIQCVQCGGHGCRVCKQTGWLEVMGCGMVHPNVLRHVGIDSERYSGFAFGLGVERMAMLRYGVNDLRLFFDNDIRFLRQF... 338
72 0.000e+00gi|671602908|ref|WP_031576119.1| phenylalanine--tRNA ligase subunit alpha [Proteiniclasticum ruminis]  clstr ali  53  1MREQIDAIKQKFNEKLAALSTSEELEKLRVEVLGKKGEFTQILRSMGSLSAEERPLIGKLVNEAKEELEDKIRSVKESLKERATDAKLKNEVIDITLPGVKSPMGGKHPLMMTMEKIENIFLEMGFTIEEGPEVELDYYNFEALNIPKDHPARGEQDTFYIDDQVVLRTQTSPVQIRTIENQ--KPPIKMISPGKVYRSDDVDATHSPIFYQIEGLVIDKGITFADLKGTLDLFVKKMFGDDIITKFRPHHFPFTEPSAEMDGTCFVCHGEGCKVCKGEGFMELLGCGMVHPEVLKKGGIDPEVYSGFAFGFGLDRMTMQKFGIDDIRLLYESDMRFLKQFK.. 340
73 0.000e+00gi|938534476|ref|WP_054646238.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus lindneri]  clstr ali  53  3LKEDLETIKQTGLQEVTAASDSKALNEIKVKLLGKKGPITKALRGISQLSVAERPIVGSFANKVRDELTDAINEKQTQLEREILNKQLASETIDVTLPGNNIPMGHPHVIQQVIDEIEDIFIGMGYQVLNGPEVEEEHYNFEMMNLPKNHPARDMQDTFYITKEILMRTHTSPMQARALQQHDNKGPLKMISPGVVFRRDTDDPTHSHQFHQVEGIVIDKHITMADLKGTLEVMSHKLFGDKFKVRVRPSYFPFTEPSVEADVTCMNCEGKGCEVCKGSGWIEVLGAGMVHPNVLKMAGVDSQEYGGFAFGVGPDRFAMLKYGVNDIRDFYLNDLRFLTQFD.. 345
74 0.000e+00gi|524722654|emb|CDE25253.1| phenylalanine--tRNA ligase alpha subunit [Clostridium sp. CAG:440]  clstr ali  56  1MKEQIEQIKENSINEIENAKDLKQLQDLKVKYLGKKGELTQVLRTMGTLAEEERPVIGSLVNEVRGKIENLISRKEEEFKKIELNKKIENERIDITLPSKKMVRGSKHPMNLVIEEVEDLFVSMGYDVVSGPELETDEYCFKKLNLPEGHPARDMQDSFYITNEYLLRTQTSSAQARVMEQKGGKEPIRIICPGKTYRR-EDDATHSPQFAQVEGLVIDKNVSLADLKGTLEIFAKKMLGENSKLRFRPSYFPFTEPSYEVDVTCFKCGGKGCSLCKKTGWIEVFAAGMVHPNVLKMGGYDPEEWGGFAFGPGLDRITMFKYAIPDVRYLYTNDVRFLKQFDR. 345
75 0.000e+00JGI.Meta 7013496136 SRS050244_LANL_scaffold_102858__gene_141318 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome fr  ali  57  6LLDQLETLRGEVKEHLEKTYSEKELNEFKINFMGKKGKLAHIMKEMGKLSKEERPVFGENANKVREYIIASIDEKMKLYKAEALREKLEKETIDVTLPGRTRKKGGVHPLTLVVDEAVSIFTSLGFEVAEGPEIESDYYNFQALNLAKDHPARDMQDTFYIDENIVLRSQTSPVQIRTMEKKGGEVPVKIICPGRVYRKD-DDATHSPMFHQIEGLLIGEAITMADLKGTLLYFVREIFEKDVDLRLRPSYFPFTEPSVEVDISCVSCGGQGCRVCSHTGWLEILGAGMVHPNVLRAGGYDPNKVQGFAFGMGVERIAMLKYGISDLRLLFANDIRTLEQF... 345
76 0.000e+00gi|651614611|ref|WP_026608735.1| phenylalanine--tRNA ligase subunit alpha [Methylocaldum szegediense]  clstr ali  51  1MSTPLEELLVQARKEVAEADTLGKLDQVRVHFLGKKGVFTERMKSLGTLPAEQRREIGAWINRAKDQLLADLEARKSALEAIELEERLQRETIDVTLPGRGQRTGGLHPVTLTLRRISQLFKNVGFDIVEGPEVEDDYHNFEALNIPAHHPARAMHDTFYFDEHTLLRTHTSPVQVRIMETQ--NPPLRVIAPGRVYRCD-SDLTHTPMFHQVEGFVVDRDVSFADLKGILYEFLTLFFEKDIQVRFRPSYFPFTEPSAEVDIECVICGGEGCRVCKQSGWLEVMGCGMIHPRVFEFVKIDPERYTGFAFGLGVERLAMLRYGINDLRLFFENDLRFLAQF... 338
77 0.000e+00gi|799759269|emb|CEV54037.1| phenylalanyl-tRNA synthetase%2C alpha chain [Streptococcus pneumoniae]  clstr ali  60  5.EEQLKALREETLTSLKQAGNEKEMQDLRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDVLTAAFEETAKLLEEKKVAAQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTEPSVEVDVSCFKCGGEGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQERVAMLRYGINDIRGFYQGDVRF....... 343
78 0.000e+00gi|496679878|ref|WP_009322076.1| phenylalanine--tRNA ligase subunit alpha [Subdoligranulum sp. 4_3_54A2FAA]  clstr ali  57  1MKEALQNIRQSXXXXXXXXXXXXXVDELRVRFLGKKGELTAILKQMGRLSAEERPVVGALANEVREAITADIARRTKELESAALAARLAAEEIDVTLPGKAPAQGKRHPFEQVLGELKEIFLGMGFDIVSGPEVELDHYNFEMLNMPKSHPARDTQDTFYFTENVLLRTQTSPMQIRTMEKQ--KPPIRIICPGRVYRSDAVDATHSPIFHQCEGLVVDKGVTFSDLKGTLELFIKKLYGEETRVRFRPHHFPYTEPSAEMDMSCFKCGGKGCSMCKGEGWIEILGCGMVHPQVLENCGIDPEVYSGFAFGVGLERIAMMRYGIDDMRLLYENDLRFLKQF... 339
79 0.000e+00gi|498307875|ref|WP_010622031.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus suebicus]  clstr ali  57  3LREKLDELRQQGLKDVDNSEDLDRINDIRVRLLGKKGPIKEALRGMRELSADERPKIGQFANEIRDDLTKAIDKRREELEFAKINAQLEQETIDVTLPGSEVAQGQPHVIQQIIDELVDLFVGMGYEVAVGDEVEEDHYNFEMLNLPKDHPARDMQDTFYVTPEVLMRTQTSPMQARMLEKHDSKGPLKMISPGKVYRRDTDDATHSHQFHQVEGMVIGKHITMADLKGTLEVVAQELFGDELQVRLRPSYFPFTEPSVEADITCFNCLGKGCAICKHTGWIEVLGAGMTHPNVLKMAGIDPEVYGGFAFGLGPDRFAMLKYGVEDIRDFYQNDVRFLTQFDQ. 346
80 0.000e+00gi|737543070|ref|WP_035516327.1| phenylalanine--tRNA ligase subunit alpha [Pseudohaliea rubra]  clstr ali  53  2..DNLEELAGEARAAIEAAGDGAALEQLRVDYLGKKGRVTALLKGLGKLSAEERPAAGARINEVKESLQGLIAGRKAALDTAAVAERLAGEAIDVTLPGRGEGTGSLHPVTRTIERMEDFFSAVGFEIAEGPEIEDDYHNFEALNFPPNHPARAEHDTFFVDEGTVLRTHTSPVQVRVMESRE--PPFRIICPGRVYRCD-SDLTHTPMFHQVEGLLVDEHSTLADLKGLIEDFLQSFFEQSLAVRFRPSYFPFVEPGAEVDMQCVHCGGEGCRVCSHTGWLEIMGCGMVHPRVFELSGIDPDRYAGFAFGMGVERLAMLRYGVGDLRLFFDNDQRFLAQF... 337
81 0.000e+00gi|493573026|ref|WP_006526234.1| phenylalanine--tRNA ligase subunit alpha [Solobacterium moorei]  clstr ali  56  1MSDKVMQVQEEALAAIEQATTLEQLQQVKIQYLGKKGSIQALMSEMKALPQEKKPAFGQKVNVCKDTVAKVLESKEEVLKIAALAGKLEAEKIDITLAGDTHKLGTTHPLVMIQQEIEDLFLSMGYKVAEGPEVEQDYYNFELANTPKDHPARDMQDTFYIDPNTLLRTHTTAMQMRELEKAKGQVPIKLICPGKVYRRDDDDATHSHQFMQCEGLVVGENITLADLKGTLEYMASTMFGQGRTVRFRPSYFPFTEPSVEVDVSCPFCNGKGCNVCKGSGWIEILGAGMVHPNVLRMNGFDPEKYSGFAFGVGLERVAMLKYGIDDIRNFYTNDVRFLKIFDR. 343
82 0.000e+00gi|654497012|ref|WP_027966794.1| phenylalanine--tRNA ligase subunit alpha [Halomonas halocynthiae]  clstr ali  52  2..EHLPTLVSKARQAIDAAEDIAALDHVRVHYLGKKGEITALLKGLGRLSAEERPAAGEQINQAKQQLFQLIEARKTSLETAALAQRLAAERIDVTLPGRHQLDGGLHPVMRTLERIEALFTRIGFDVATGPEIEDDYHNFEALNIPAHHPARGMADTFYFDASRLLRTHTSPVQVRTMETQS--PPIRIVCPGRVYRSD-SDLTHTPMFHQVEGLLVDENVSFADLKGTVEDFLQAFFEDDLSVRFRPSYFPFTEPSAEVDIQCVMCAGEGCRVCSHTGWIEVLGCGMVHPAVFNHVGIDTERYTGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLRQF... 338
83 0.000e+00JGI.Meta 7020011059 SRS048870_WUGC_scaffold_48439__gene_96093 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit n  ali  56  3MKERLEEISKMTKEKVEQITTSQELKELKAKVLGKKSELTEILRGMGQIAAEQRPVVGELVNKVRTEIEEVIDSKEKEFEEAELKRKVEAEKIDITLPATRIKRGSIHPLNRIIEDVEDLFVSMGYDVVTGPELETDEYCFERLNLPKDHPARDMQDSFYITTEYLLRTQTSSVQARTMMANTEKTPIRMICPGKTYRK-EDDATHSHQFNQVEGLVVDKDISFANLKGTLEVFVKRLLGEKTQLRFRPSYFPFTEPSYEVDATCFKCGGKGCNLCKQTGWIELLGSGMVHPNVLKMNGYDPDVYSGFAFGTGLDRLAMFKYGITDMRLLYTNDVRFLSQFDR. 344
84 0.000e+00gi|973093019|gb|KUK52668.1| Phenylalanine--tRNA ligase alpha subunit [Desulfotomaculum sp. 46_296]  clstr ali  57  1MEEKLQKIAAEAVKLLSLSQDLEEIEKIRVRFLGRKGELTQVLRGMGALDEKDRPRIGQLANEIRGRIEDELANRTALVKEKTIRSRLLKEALDISLPGTTPARGRIHPITRVRRQMEDIFLGLGFEIAEGPEIELDYYNFEALNFPKDHPARDMQDTFFIGEESLLRTHTSPVQVRTMERTAPAIPVKIISPGKVYRRD-DDATHSPMFQQVEGLLIDTRITFGDLKGILELFAKEMFGPSTLTRFRASFFPFTEPSAEVDISCVMCGGHGCRVCSQTGWLEILGCGSVHPRVLEMSGYNPEEVTGFAFGVGVERVAMLKYGIDDIRLFYDNDLRFLNQF... 340
85 0.000e+00 GL0084734 [Complete] locus=scaffold97369_2:1131:2168:+  ali  57  2.ENELLKIKDEALEKIEACTSLKELNDIRVLYLGKKGPIQEAMKSMKNMDPDQRKTFGQTSNKVKQELSKAVEDKKEVLEHQAIIDKINSETIDLSLPSYKLDQGTMHPLSIIVSQLEELFLGMGYQIAEGPEVESDYFNFELMNLPKGHPARDMQDTFYIDENTLMRTHTSPVQAHTLLAAKGKGPIKVICPGKTYRRDDDDATHSHQFMQCEGLVVDKNITLADLKGTLEVFARKFFGEKREIRLRPSYFPFTEPSVEVDISCHHCGGKGCAMCKGTGWIEILGAGMVNPKVLDMCGFDSKVYQGFAFGIGIERVAMLKYGIDNIRDFYNDDLRFLNQFQR. 343
86 0.000e+00gi|494633256|ref|WP_007391200.1| MULTISPECIES: phenylalanine--tRNA ligase subunit alpha [Megasphaera]  clstr ali  53  3.QETIGAMQQAVQERLLHCRTAQDVQAVRVQYLGKKGELTALLKGMKNVPPAERPAFGQLVNAARSALEAKLQERQAEVEEQEMATRLQSETLDITLPSRQPVRGHMHPLHLTRRHMEEAFLRMGFSLVEGPEIETDYFNFQCLNFPPDHPARDMQDSMYLTDSLLLRTHTSPMQARVLQSHKPNEPVKVIVPGKVYRWD-YDATHSPVFHQMEGLIVDRHIRFSDLKGMLEDFLREIFGASTKVRFRASYFPFTEPSAEVDISCVMCGGEGCRVCSHTGWLEILGCGMVHPNVLRLNGYDPEQVTGFAFGMGVERIAMLKYGIDDLRLFYENDMRFLTQF... 341
87 0.000e+00gi|504365903|ref|WP_014553005.1| phenylalanine--tRNA ligase subunit alpha [Halanaerobium praevalens]  clstr ali  51  3LLNDLKTIEKNAEKELAKVEDLDQLEDLRIKYLGKKGAIQSVFSKMGKIEAEQRPIVGKNANILKNKIQNWINEHQQKLAAEAAEKRLKKEKIDVSLPGSNLKIGKSHPLSLVTKEIEDIFIGLGFNIAEGPEVESEYYNFEALNIPAHHPARDLQDTLYIDDHYLLRTHTSPVQVRTMEA--EEPPVRIIAPGRVYRSDELDASHSPIFHQTEGLVIDKNISFSDLKGTIELIVEALFGQDRKIRFRPSYFPFTEPSAEVDVSCIVCGGDGCSLCSQTGWLEIMGAGMVHPNVLEKSGYDSEIYSGFAFGVGLDRLALLKYGIDDIRVLYENDKRFLEQF... 341
88 0.000e+00gi|504027771|ref|WP_014261765.1| phenylalanine--tRNA ligase subunit alpha [Filifactor alocis]  clstr ali  54  1MKERLEAIRKNAQLAIEQAKDVNLLEQVRVQFLGKKQELASLLKEMGKLSPEERPTMGKIVNEVRDEIETAIREKKEHLENIALEQKLNREMIDVTIPVKTNFVGKPHPITKVINEIETIFMNMGFSIKEGPEVETVENNFDKLNAPKNHPSRDISDTFYISDTLLLRTQTSPVQIRTML--EEGLPIRMISPGRCFRSDTPDATHSPMFHQVEGLVIGKNITFANLKHTLEEFAIKFFGEDTKTKFRPHNFPFTEPSAEVDVSCFKCHGEGCSICKGEGFIEILGAGMVHPNVLENCGIDSDVYSGFAFGLGVERVAMLKYEIDDIRLMYENDMRFLEQF... 339
89 0.000e+00gi|498232999|ref|WP_010547155.1| phenylalanine--tRNA ligase subunit alpha [gamma proteobacterium HIMB30]  clstr ali  50  2..DNLQSIQDEALALIESADSLAHLDDVRVKFLGKKGLISAQMKTLGQLSAEERPQAGAKINTVRDRVTKVLEARKTTLEIEAETQSLMRDAVDVTMPGRPQEIGGLHPVTRTLDRLNRLFASLGYTVATGPEIEDDWHNFEALNIPSHHPARAMHDTFYFDDGRVLRTHTSPVQIRTM--VSEEPPIRIVAPGRVYRCD-SDLTHTPMFHQIEGLVVDRDISFADLKGTIITFLNRFFEADLDVRFRPSYFPFTEPSAEVDVQCVMCEGSGCRVCSHTGWLEVMGCGMVHPTVFEQTGVDTSVYTGFAFGMGIERLAMLRYGIGDLRLFYENDLQFLNQFHG. 339
90 0.000e+00JGI.Meta 7060387448 C3691594__gene_221377 hypothetical protein [Human Tongue dorsum microbiome from visit number 3 of subject 158883629]  ali  52  1MQEKLNAILNEVKEQISEEKNVAKLVDIKVKALGKKSQLMELLKSTGKLPQEERKSFGAAVNAAKEEIERLIEEKRVALKKEEMRLRLAAEKIDVTEPAKKFEIGGKHPISITIDEISSVFMSMGFSIEEGPEVETVYYNFDALNAEPNHPARDMTDTFYITPKTLLRTQTSPVQARVI--AREKPPIKIISPGRCFRCDTPDATHSPMFHQVEGLLIDEGITMADLKGTLDSFAHKMFGSSVRTKFRPHHFPFTEPSAEMDVSCFKCGGSGCNVCKGSGWIEILGCGMVHPNVLAAGGIDTEKYTGFAFGMGVERIAMLKYGVDDIRNFYENDMRFINQFK.. 341
91 0.000e+00gi|524534986|emb|CDC70288.1| phenylalanine--tRNA ligase alpha subunit [Oscillibacter sp. CAG:155]  clstr ali  53  1MKEQLEAIRKSALDAGVETRTAVDLEAVRVRYLGKKGELTAVLKQMGKLSPEERPVMGQLANDVRAALEAAIESRSDALAQEAMAARLKAETVDVTIPGKKVEIGHKHPMYTVLDEIKEIFINMGFEVMDGPEIEQAEYNFTKLNAPENHPSRDWTDTFYLTEDILLRSQTSPMQIRAMETYGV--PIRMISPGRVYRKDEVDATHSPMFHQIEGLVVDKGITMADLKGTLNAVIREIYGPNTKTRFRPHHFPFTEPSCEVDIQCHKCGGVGCPTCKGEGWIEVLGAGMVHPKVLRGCGIDPEVYSGFAFGMGLERLAMGQFKISDLRLIFENDMRFLSQF... 341
92 0.000e+00gi|763159318|ref|WP_044038976.1| phenylalanine--tRNA ligase subunit alpha [Clostridium bornimense]  clstr ali  55  1MQEKLKLIETTAIDELNKAVTKEDIEAVRVKYLGKKGEVTLILRGMGGLSPEERPIVGKLVNDVRGNLEGRIENALTDIKKKEKEERLKNEVIDISMPGDKSPLGGKNPLTITMEEIQDIFLSMGFSIEEGPEVELDYYNFEALNIPKNHPARGEQDTFYINDNVVLRTQTSPVQIRVMENQ--KPPIKMISPGKVYRSDAVDATHSPIFYQVEGLVIDKGITFADLKGMLETFVKKMFGDKMVTKFRPHHFPFTEPSAEMDATCFVCGGEGCKVCKGEGFIEILGCGMVHPKVLENCGIDPNEYSGFAFGFGLDRMVMQKFGIDDIRLLYEADMRFLKQFK.. 340
93 0.000e+00gi|657723278|ref|WP_029519858.1| phenylalanine--tRNA ligase subunit alpha [Persephonella sp. IF05-L8]  clstr ali  52  3LKEDIKSLGEEAKALIQKATDLKQLNDIRVEFLGKKGKLKNILKTLGKLSPEERKEIGQLANKIKEELEQLLKSQEKALKQKALEEELRKEKIDITLPVSWIDIGSSHPVISTLIEISEIFISMGFSVAEGPEVEKEEYNFDMLNIPKDHPARDMQDTFFLNNGDILRTHTSPVQVRTMLTR--KPPIAIIAPGRVYRKDA-DPTHSPMFHQIEGLLVDENVTFRDLKGILKIFLEFVFGKDVGIRFRPSYFPFTEPSAEVDISCTVCGGKGCRVCKGTGWLEILGCGMVDPNVFKAVGIDPDKYSGFAFGLGIERIAMLKYRITDIRLLFENNMRFNHQFKGI 343
94 0.000e+00gi|938773621|ref|WP_054657174.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus ozensis]  clstr ali  54  3LQDELQSVLKEGLEKINHSTDLKEINDIKVNLLGKKGEITKVLRGIKDLPNEEKPLVGQYANKVRDEIQTALANKQEILENEALNAKLSAEKIDVTLPGSTTRVGHPHVIQSIIDQICDMFMGMGYEVLSGPEVEEDKYNFEMMNLPKDHPARDMQDTFYITKEILMRTQTSPMQARTLEKHDSKGPLKMISPGVVYRRDTDDPTHSHQFHQVEGIVIDENITMGDLKGTLEFLTHQLFGDKFDVRLRPSYFPFTEPSVEADITCFKCNGKGCDVCKNTGWIEVLGAGMVHPNVLEMAGVDSQKYGGFAFGLGPDRFAMLKYGVDDIRDFYLNDVRFLSQFN.. 346
95 0.000e+00gi|938932438|ref|WP_054713806.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus manihotivorans]  clstr ali  56  3LKSKLEELFEQNQAKIKSLHDLDELNQTRINLLGKKGPITEVLRGMKDLDATERPKVGAYANKIKDNLQDVIAERKAVLEQAVIDQKLKQETIDVTLPGDVVKAGTPHILTQIMDDIEEFFIGQGYQVIDGPEVEEDHYNFEMLNIPKNHPARDMQDTFYMGNDLLMRSQTSPVQARTLEVHDSKGPLKMISPGRVYRRDTDDATHSHQFHQVEGLVIDKHITMADLKGTLLAVAQHVFGKDRTIRLRPSYFPFTEPSVEVDVSCFRCGGRGCAICKYSGWIEVLGAGMVHPNVLTNAGVDPKVYGGFAFGLGPDRFAMLKYGIDDIRSFYQGDQRFLSQFQQ. 346
96 0.000e+00gi|653213982|ref|WP_027426667.1| phenylalanine--tRNA ligase subunit alpha [Lachnospiraceae bacterium NC2004]  clstr ali  52  1MKERMEAIKKAAFERIENAKSLDDLNEIKTSILGKKGELTSVLKGMKDVAPEDRPKVGQMVNDARAAIEEYLAKESKMLQSKIREEKMKKEVIDVTLPAKKLKAGHRHPNQIALDDLERVFVGMGYEVVEGPEVEYDKYNFELLNIPADHPAKDEQDTFYITKDILLRTQTSPVQARVMET--GRMPIRIISPGRVFRSDEVDATHSPSFHQVEGLVIDKGITMADLKGTIDQWAKEFFGPDTKTKFRPHHFPFTEPSAEADVTCFKCGGKGCRMCKGSGWIEILGCGMVHPKVLKDCGIDPDVYSGFAFGIGLERVTLLKYEIDDMRLLYENDERFLEQF... 339
97 0.000e+00gi|524335212|emb|CDA91344.1| phenylalanine--tRNA ligase alpha subunit [Firmicutes bacterium CAG:238]  clstr ali  53  9MEERLEKILENSRERLKAIDTIQDAEDVRIKVLGKKGELTEMLKSMGKMDPEERKEFGMAANQVRSEIEKMLDASFEQLKNKAKEAKFKMEKIDVTEPGKLQHLGTKHPITITIEEISKVFKSMGFSLAEGPEVETVFNNFDALNAGPNHPARDWTDTFYINDEVLLRTQTSPVQVRTLLNQ--KPPIRVFAPGRCFRCDTPDATHSPMFHQVEGLVVDEGITMADLKGVLDSFAKQMFGSEVRTKFRPHHFPFTEPSAEMDVSCFKCGGKGCRVCKGSGWIEILGCGMVHPNVLKVGGVDTEKYTGFAFGMGVERIAMLKYGIDDIRLLYENDMRFIEQFK.. 351
98 0.000e+00gi|524304585|emb|CDA64370.1| phenylalanine--tRNA ligase alpha subunit [Firmicutes bacterium CAG:56]  clstr ali  54  1MKDKLQAIREEALKQIRESNRLDKLNEVRVSFLGKKGELTAVLKGMKNVDPKERPFVGQMVNETREAIEEFLEETKKKLEEKAREEKMKQEVIDVTLPAKKINVGHRHPNTIALEEVERIFVGMGYEVVEGPEIEYDLYNFEKLNIPANHPAKDEQDTFYINKDIVLRTQTSPVQARIMEQ--GKLPIRMIAPGRVFRSDEVDATHSPSFHQIEGLVVDKNITFADLKGTLEEFAKQLFGPETKTKFRPHHFPFTEPSAEVDVSCFKCGGSGCRFCKGSGWIEILGCGMVHPHVFEMCGIDPEEYTGFAFGVGLERIALLKYEIDDMRELYKNDIRFLKQF... 345
99 0.000e+00gi|493840566|ref|WP_006787709.1| phenylalanine--tRNA ligase subunit alpha [Thiorhodospira sibirica]  clstr ali  51  1MQD-LNDVIATALDEIKACQSLKALDSLRVQYLGKKGIITEQLKSLGQLPPEQRRSDGQRINQAKQTLTEALEQRHQRLAEQAHQQTLAADTLDVTLPGRGQESGGLHPLTLTIERIEHLLAQAGFSVVEGPEVEDDYHNFEALNIPAHHPARAMHDTFYFDASTLLRTHTSPVQVRVMES--GQLPIRVIAPGRVYRCD-SDMTHSPMFHQVEGLLVDEGITFAHLRGVLDQFLQAFFEQDLQTRFRPSYFPFTEPSAEVDIQCVQCFGQGCRVCKHTGWLEVMGCGMVHPNVFAHVGIDAQRYSGFAFGLGVERMAMLRYGVNDLRLFFDNDIRFLRQF... 338
100 0.000e+00gi|291418185|gb|EFE91904.1| phenylalanine--tRNA ligase, alpha subunit [Oribacterium sp. oral taxon 078 str. F0262]  clstr ali  55  20...QLEELRKLAEDAIRRAADIDALNQVRVSFLGKKGEITNLMKALRELPPDQKKIFGQKINEVRALIESELQTQLPILHRRMREARIQSETLDVTLPAKKRRFGHMHPNTRALEEVERIFIGMGYEVVEGPEIEYDLYNFEKLNIPKGHPARDEQDTFYINESILLRTQTSSVQARVMEK--GKLPIRMICPGRVFRSDEVDATHSPSFHQIEGLVIDRHVSFSDLKGTLDTFAKELFGPETRTKLRPHHFPFTEPSAEVDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPHVLEMCGIDPEKYSGFAFGVGLERIALLKYEIDDMRLLYENDSRFLEQF... 355
101 0.000e+00gi|931488571|gb|KPK68933.1| phenylalanyl-tRNA synthetase subunit alpha [Acidithiobacillales bacterium SM23_46]  clstr ali  53  1MEQDLARLVDEARVAIAGVAEVAAVEELRVHYLGKKGVLSEQLKRLGTLPQEERPLVGKWVNDAKAAVQQALVVRRGALEIAARDAQLVAEVVDVTLPGRGLRQGGLHPVTRTLERLETLFVRMGFTIADGPEIEDDYHNFEALNIPPNHPSRAMHDTFYFDAHRLLRTHTSPVQIRHMEAH--RPPLRVIAAGRVFRCD-SDVTHTPMFHQIEGLLVDEAVSFADLKGVLAEFLEQFFETSLKLRLRPSYFPFTEPSAEVDISCVMCGAKGCRVCKQTGWLEVLGCGMVHPEVFRHVGIDSERWSGFAFGLGVERLAMLRYGVNDLRLFYENDLRFLQQFR.. 339
102 0.000e+00gi|557869975|gb|ESS72973.1| phenylalanine--tRNA ligase alpha subunit [Methyloglobulus morosus KoM1]  clstr ali  48  26..DNLDEILAQATSSISDAQDLNQLDQVRVHYLGKKGIFTLQMKELGSLDPERRRAVGQVINQAKDRFQEQLQARKDALDNIELEHRLASERIDVTLPGRGQSEGGLHPVTTTLRRIAKIFASVGFSVVEGPEIEDDYHNFGALNIPEHHPARAMHDTFYFDAHTVLRTHTSPVQIRVMES--EKPPLKVIAPGRVYRCD-SDITHTPMFHQVEGFLVDTDVSFADLKGVVYQFLRAFFEKDIQVRFRPSYFPFTEPSAEVDIECVMCNGEGCRVCSQTGWLEVMGCGMIHPEVFKAVNIDSESHSGFAFGMGVERLAMLRYGINDLRLFFENDLKFLRQFH.. 362
103 0.000e+00gi|91208197|sp|Q3JBZ8.1|SYFA_NITOC RecName: Full=Phenylalanine--tRNA ligase alpha subunit; AltName: Full=Phenylalanyl-tRNA synthetase alpha subunit;  clstr ali  49  15..QALAEIVAKARQAVSAAPDLPTLDELRVRYLGKKGELTGHFKALDQVSAEERPIFGKAVNEAKQALQSEIEARRKDLEQAALEARLASEAIDVTLPGRGLDVGGLHPVTRTLARIEAFFRYAGFEIHEGPEVEDDYHNFEALNIPPSHPARAMHDTFYFDAHTLLRTHTSPVQIRVMEHQG--PPLRIIAPGRVYRCD-SDLTHTPMFHQVEGLLVDEQVSFTDLKGILSDFLRAYFEEDLEVRFRPSYFPFTEPSAETDIQCVNCSGEGCRVCGHTGWLEVLGCGMVHPKVFEHVGIDSERYLGFAFGLGVERLAMLRYGVNDLRLFFENDLRFLRQFN.. 352
104 0.000e+00gi|639441505|ref|WP_024620802.1| phenylalanine--tRNA ligase subunit alpha [[Clostridium] mangenotii]  clstr ali  55  1MQQKLLDLQDAALKEIREVCSMDEVENLIVKYLGKKGELKSILKEMGKLSEEERPVIGKVGNEVRDVIEDSLATKKDELKEIVKKEKLSKEVIDVTLPGKKHAIGKRHPITQIIDEVSEIFIGMGFSIAEGPEMDTIGNNFDALNAPKDHPSRDMTDTFYISDDLLLRTQTSPVQVRTM--RSSELPIKIISPGRCFRRDTPDATHSPMFHQIEGMVVGKDVTMAQLKWTLDAFVKKLFGEDTKTKFRPHNFPFTEPSAEVDITCFKCGGKGCPTCKQEGWIEILGCGMVHPNVLKNCGIDPEVYSGFAFGVGVERLAMFKYEIDDIRLLFENNKRFLNQF... 339
105 0.000e+00gi|949552482|ref|WP_056987641.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus paracollinoides]  clstr ali  57  3LRDQLEKIRDERKQSILDVDDLKKLDELRVQLLGKKGPVTQALRSMKDLPADERPSFGQFANKVRDDLKNAIDDRNSELQQAALNFKLQHEKIDVTLPGAAVTQGQPHVIQQIVDQLEDLFMGMGYQVLSGPEVEEDKYNFEMMNLPKDHPARDMQDTFYITKEILMRTQTSPMQARTLETHDSKGPLKMISPGVVYRRDTDDPTHSHQFHQVEGLVIDKHVTMADLKGTLEPVAHTLFGDRFDVRLRPSYFPFTEPSVEADITCFNCGGKGCNVCKYTGWIEVLGAGMVHPNVLKMAGVDPTVYGGFAFGLGPDRFAMLKYGVDDIRNFYLNDVRFLTQFAK. 346
106 0.000e+00gi|489129387|ref|WP_003039175.1| phenylalanine--tRNA ligase subunit alpha [Francisella tularensis]  clstr ali  52  5.....EQMKDKALAELNLVKDKKTLDDIRVKYLGKKGELTEMMKLIATLPNDEKPKLGQAVNIAKQALQEAINLKLANFEEQELNEKLAQEKIDITLSGVGQNQGSLHPVTKTLNRIEAFFKQNGFAIEFGPEIESDYYNFETLNIPSHHPARAMHDTFYIDETHVLRTHTSGVQIRTMEKQ--QPPIRIIAPGRVYRCD-SDITHTPMFHQVEGLLVDKDVSFADLKGLLHAFLNSFFEKDLKVRFRPSYFPFTEPSAEADIECVMCDGKGCRVCKHTGWLEVLGCGMVHPKVLKAGNVDPEKYQGFAFGMGVERLSMLRYGIDDLRMFFENDLRFLKQF... 337
107 0.000e+00gi|914626105|ref|WP_050617841.1| phenylalanine--tRNA ligase subunit alpha [Intestinimonas sp. GD2]  clstr ali  51  1MKETLEQIRREALAALSETKTAADLEALRVRYLGKKGELTALLKQMGRLSAEERPVMGQLANEVREALTEALARQQKVLEAAALHARLEAETLDVTIPGKPVEVGHKHPMYTVLDEIKDIFIGMGFDILDGPEIEQAEYNFTKLNAPEDHPSRDWTDTFYLTEDVLLRSQTSPMQIRAMETRE--LPIRIISPGRVYRKDEVDATHSPMFHQIEGLVVDKGITMADLKGTLNTVIRQIYGPDTQTRFRPHHFPFTEPSCEVDIQCHKCGGKGCPTCKGEGWIEVLGAGMVHPKVLRNCNVDPDVYSGFAFGFGLERLALGQFKISDMRLIFENDVRFLSQF... 341
108 0.000e+00JGI.Meta 7027800587 C1583042__gene_143187 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit number 2 of subject 7  ali  57  20MKDQIEQIKQTAIEEIKKSSDLKTLGETKVKFLGKKGELTSVLRGMGALSPEERPVIGSLVNEVRDELEKLISEKESEFKQIELNKKLSAETIDITLPGKKVKKGSKNPMNIVIEEIEDLFVSMGYDVISGPELETDEFCFARLNLPEGHPARDMQDSFYITDNYLLRTQTSAVQARTMLEYGGNKPIRMICTGKTYRR-EDDATHSHQFNQVEGLVIDKNVSLANLKGTLEVFMKKMLGEKTELRFRPSYFPFTEPSYEVDVTCFKCGGKGCPLCKKTGWIEVLGAGMVHPNVLKMNGYDPDQYSGFAFGTGIDRLAMFKFGIPDMRLLYSNDIKFLNQFAR. 364
109 0.000e+00gi|492421966|ref|WP_005838704.1| phenylalanine--tRNA ligase subunit alpha [Eubacterium saphenum]  clstr ali  57  1MKEELNKMLQQAMEEIEKAGDLEVIETLRVKYLGKKSKMSEILRGMGKLSHEDRRLMGEAANSVRDNIASVISSKKKLLKEAERKIKMQREKIDVTQPGKAMHLGTKHPITITIEEITDVFKSMGFSICEGPEIETVYNNFDALNADKHHPARAMTDTFYLTEEYLLRTQTSPVQIRTIKKQ--KPPIKIISPGRCFRCDTADATHSPMFHQVEGLVIDEGITMADLKGTLNRFAKLMFGEFAKTKLRPHHFPFTEPSAEVDLSCFKCGGEGCSVCKGSGWIEILGCGMVHPNVLKEGNIDPEKYTGFAFGMGVERIAMLKYEIDDIRLFYENDMRFIEEFK.. 340
110 0.000e+00gi|523979221|emb|CCX64162.1| phenylalanine--tRNA ligase alpha subunit [Firmicutes bacterium CAG:791]  clstr ali  52  3.QEDLERIRQEAYERLEKAFSPEEINQIKVDFLGKKGQLTGILKGMKDVAAQDRPKVGQMVNETRVRIEEAISQHQKEIEEKLLAERLKAEKIDVTLPAKKETRGHLHPNTVALREIEEVFIGMGYEVVDGPEIEKDYYNFEALNIPADHPAKDEQDTFYIGGEMLLRTQTSGTQIHEMEK--GHIPVRMIAPGRVYRADEVDATHSPVFHQVEGLVLDKGITFADLKGTLAEFAKAIFGEDTKVRFRPHHFPFTEPSAEMDVSCFKCGGKGCSFCKNEGWIEILGCGMVHPHVLEMSGIDPEVYSGFAFGVGLERIALLKYEIDDMRLLYENDKRFIDQF... 340
111 0.000e+00gi|946816116|gb|KRG22733.1| Phenylalanine--tRNA ligase alpha subunit [Coxiellaceae bacterium HT99]  clstr ali  52  2..EELATLVATAKDAIENAPDIAALEKIRVDYLGKKGEITQQLKSLKDIPEEQRREFGKRVNDAKDAIQEAITTRRITLEDKAIHEQLAKERVDVTLSARGIEVGGLHPITIVMERITNLFSQLGFSVHEGPEVETEYYNFEALNIPSHHPARAMHDTFYFANKTLLRTHTSPVQIRVMENQ--KPPLKIIAPGRVYRCD-SDVTHTPMFHQIEGLMVDENISFADLKGILSDFLSAFFETKVKTRFRASYFPFTEPSAEVDMACVKCQGQGCRICKQTGWLEILGCGMVHPRVLEYGGIDPEKYSGFAFGMGVERVAMLRYNVDDLRLFFENDIKVLKQFNGV 340
112 0.000e+00gi|651638936|ref|WP_026624816.1| phenylalanine--tRNA ligase subunit alpha [Eggerthia catenaformis]  clstr ali  55  1MMDELIKIREEALKKLSEVQNLKELNDLRVLYLGKKGPMQQAMKQMKTMAQQQRAEFGKVSNQVKKDINDYIENTKLRLEELAVKAKLAGEDIDISLPGYKLPQGSLHPLTIVKEDLEELFLGMGYEVAEGPEVESDHFNFELMNLPKGHPARDMQDTFYINETTLMRTHTSPVQAHVMLAKGGNQPIKVICPGKTYRRDDDDATHSHQFMQCEGLVVDKNISMADLKGTLEVFVKKMFGEKREIRLRPSYFPFTEPSVEVDISCGHCGGKGCSMCKKTGWIEILGAGMVNPHVLEMCGYDSKIYQGFAFGIGLERVAMLKYGIENIRDFYNNDLRFLNQFAG. 343
113 0.000e+00gi|652486367|ref|WP_026880935.1| phenylalanine--tRNA ligase subunit alpha [Dielma fastidiosa]  clstr ali  59  1MK-NLEQLKEEGLNAIRESQTLAALQQHRVLYLGKKGPIQEVMKSMKDLSAEERPKFGAAVNEIKSQIAAAIESKWAELEAKEMEDRLEREKIDITLEGYHPTVGNLHPLTLVQQELEDLFIGLGYTIGEGPEIEFDLYNFERANIPKGHPARDMQDTFYINAEELLRTHTTAIQTRQLEAYAPKLPIKVVCPGKVYRRDDDDATHSHQFTQMEGLVVAENITLSDLKGTLEFMAKKMFGEKRVIRFRPSYFQFTEPSVEVDVSCHICNGKGCPVCKGTGWIEILGAGMVHPNVLEMAGYDSKKCSGFAFGVGIERVAMLKYGIDDIRHFYTNDLRFLKTFTR. 342
114 0.000e+00JGI.Meta 7070145370 SRS047634_LANL_scaffold_136473__gene_186694 phenylalanine--tRNA ligase, alpha subunit [Human Supragingival plaque microb  ali  52  1MKDKLEQLKKEALQKIENVEGLEFLNDLRVAYLGKKGELTALLKGLKEVSEEERPKMGQYVNDTRAEIEKRLNEMRDKLTRRIRQEQMALEAIDVTLPARAPEIGHKHPNSIAYEEVEKIFVGMGYEVIEGPEIEYDEYNFGKLNIPANHPAKDEQDTFYINKEIVLRTQTSPVQARVMEK--GKFPIRMISPGRVFRSDAVDATHSPCFHQIEGLVIDKNVTLADLKGTLEKFATGLFGEGTKVKFRPHHFPFTEPSAEMDVSCFKCMGKGCRFCKGSGWIEILGCGMVHPNVLDKCGVDKSVYQGFAFGMGLERIALLKYEIDDMRLLYENDIRFLEQFN.. 340
115 0.000e+00gi|491494579|ref|WP_005352301.1| phenylalanine--tRNA ligase subunit alpha [[Eubacterium] siraeum]  clstr ali  52  1MKEQLQNIKEQALKTIGDCVDVKQLDELRVKYLGKKGELTAILKSMGKLSAEERPVMGQLANDVRQSLEGFIAQKQAQLKSALMEQKLKKETLDVTMPGKQQAMGVRHPLNIVLDELKEIFRGMGYTVVDGPEVEETKYVFDMLLTEDGHPARDEQDTFYITDEILLRTQTSSVQIRTMLKN--KPPIAIISPGRVYRPDAVDGTHSPIFHQCEGLVIDKNITFGDLKGTLETFAKRLYGDEVKLRFRPHHFPYTEPSAEVDLQCFKCGGKGCPLCKGEGWIEMLGSGIVHPQVLINCGIDPEEYSGFAFGIGLERIAMMRYNIDDMRLLYENDQRFLAQFR.. 340
116 0.000e+00gi|954627972|gb|ALP53056.1| phenylalanine--tRNA ligase subunit alpha [Candidatus Tenderia electrophaga]  clstr ali  50  1MQE-LADLVSQAEAAVTQASDLNALDQVRVEYLGKKGVLTQYLKQLGNLPAEERPKVGQAVNQAKQALQVSINARRRELEAAALNAKLAAETLDVTLPGRGQDVGGIHPVTRTLQRIEEYFNRLGFDIATGPEIESDYHNFTALNIPENHPARAMHDTFYVDERTLLRTHTSPVQVRVMENK--QPPLRVIAPGRVYRCD-SDVTHTPMFHQVEGFMVDTDVTFAHLKGMLTDFLRNFFEQDLGTRFRPSYFPFTEPSAEVDMECVMCQGKGCRVCSHTGWLEVLGCGMIHPNVLANVGIDNEKYTGFAFGMGVERLTMLRYGVNDLRLFFENDLRFLRQFN.. 338
117 0.000e+00gi|749066387|ref|WP_040095357.1| phenylalanine--tRNA ligase subunit alpha [Geoalkalibacter ferrihydriticus]  clstr ali  51  1MKEKLEAIAADGRQALQSAATENDLQQARVRYLGKKGELTTLMKGLGSVSAEERPGLGALLNQLKDQLEEIFQARLAIVRDEEIRLRLERERVDVTLPGRVRFTGSKHPITLVMEEICSIFTALGFGIAEGPEVEKDFYNFEALNFPKDHPARDMQDTFFVSEDVLLRTHTSPVQVRTMLQHA--PPVRVIAPGTVYRRD-SDITHSPMFHQVEGFLVDRHVTFGDLKGILTAFISQYFGKSIGVRFRPSFFPFTEPSAEVDIQCVICKGSGCRVCKGSGWLEILGSGMIDPEVFKSVNYDPDIYSGFAFGMGIERIAMLKYGVNDLRLFFENDVRFLRQF... 338
118 0.000e+00JGI.Meta 7046800575 C1974616__gene_149210 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit number 1 of subject 7  ali  59  1............................RVRFLGKKGELTAVLKQMGKLTAEERPVIGQLANEVRAYIEQIVETREKELKAEETARQLENERIDVTMPGKCRPLGHKHPLSIVLDEVKEIFLGMGFEVATGPEVEWDYYNFEALNIPPDHPARDTQDTFYITEKMLLRTQTSPVQIRVMEQQ--KPPIRIIAPGRVYRSDAVDATHSPLFHQIEGLVVDEDITMGDLKGTLEAFAKRLYGDDTRIRLRPHHFPFTEPSCEIDVSCFRCGGKGCPMCKGEGWIEILGGGMVHPKVLQNGGIDPEKYSGFAFGVGLERLVMFRFNIDDMRLLYENDMRFLSQF... 311
119 0.000e+00 GL0068594 unmapped_[Complete]_[mRNA]_locus=scaffold92084_1:5071:6105:+  ali  53  5MRTELQRILAEAREQLANADTVEACEEIRIRLLGKKGALTEILRGMGKLSPEEKKTMGQAANSVKAEIEALLEEKLSAAKAAMQSAKLKAEKIDVTEPGKKFELGAKHPITLTIQEITNVFKAMGYSIVEGPEVETVWFNFDALNSPKNHPSRDMTDTFYFSQDKLLRTHTSPVEVRTMLAQD--LPIKVVVPGRCFRSDTPDATHSPMFHQVEGLVVDEGITMADLKGTLDTFAKLMFGSDVKTKLRPSHFPFTEPSAELDVSCFKCGGKGCNVCKGSGWIEILGCGLTHPHVLQAGGIDSEKYSGFAFGMGVERVAMLKYGVEDIRLFYENDMRFIEEFK.. 344
120 0.000e+00gi|657609858|ref|WP_029420998.1| phenylalanine--tRNA ligase subunit alpha [Alicyclobacillus macrosporangiidus]  clstr ali  58  1MEAAVLQVQREAEDALRQVEDTRALDEWRVRYLGKKSALSQVMRQMGTLPAEDRPRAGEVVNRCRERLQAAWEAARTALAERQLAERLASERIDVTLPGRRQERGALHPLVRVIQEVEDIFLGMGFSIAEGPEVETDEYNFEKLNLPKDHPARDMQDTFYLTDTLLLRTHTSPMQVRTMERMRPMAPVKVIVPGRVYRRDEDDATHSHAFNQIEGLVVDEGIRMSDLKGVLEQFARAMFGPEQAVRLRPSFFPFTEPSAEVDVRCINCGGAGCRVCKDTGWIEILGAGMVHPHVLDGAGYDSRRFNGFAFGMGVERIAMLKYGIEDIRQLYQNDLRLLRQFTR. 343
121 0.000e+00JGI.Meta 7057404208 SRS019126_WUGC_scaffold_1303__gene_1477 phenylalanine--tRNA ligase, alpha subunit [Human Palatine Tonsils microbiome fro  ali  58  12LQTQLQELKTSTQAKLAEMEHSKELQELRVAVLGKKGSLTDLLKGLKDLPNEERPKVGKMVNEVRDVLTEAFDEAAKIVDAAKIQAQLDSESLDVTLPGRQVKLGNRHILSQTAEEIEDIFLGMGFQIVDGFEVETDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTLDKHDSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMGDLKGTLEMIIQKMFGAERQIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVCKKTGWIEILGAGMVHPQVLEMSGVDSEEYSGFAFGLGQERIAMLRYGINDIRGFYQGDVRFSEQFK.. 356
122 0.000e+00gi|653140038|ref|WP_027389339.1| phenylalanine--tRNA ligase subunit alpha [Chrysiogenes arsenatis]  clstr ali  54  1MHERLGQIRDEALHAVAVVADTRELGELKVRYLGKKSPITEVLGGMKDVPPAERPRIGEVANQVRDALALAIEQRGEALKQAELLTRLEGERLDVTLPGRRPQTGSIHPLSRVMQEIVDVFGSLGFTVAEGPEIEKDFYNFEALNIPRNHPSRDMQDTFYISEDILLRTHTSPVQVRTMLQQ--RPPVRIIAPGKVYRCD-SDITHTPMFHQVEGLLIDKKTTFAELKGVLEYFCQAMFGAKTAVRFRPSFFPFTEPSAEVDIECVMCRGKGCRVCKMTGWLEILGCGMVDPNVFGSVEYDPEVYQGFAFGMGVERITMLKYGINDLRLFFENDLSFLAQYR.. 340
123 0.000e+00JGI.Meta 7070158492 SRS047634_LANL_scaffold_140698__gene_199816 phenylalanine--tRNA ligase, alpha subunit [Human Supragingival plaque microb  ali  52  3.KENLEKIRENALKRIAQTRDLDALNDLRVEYLGKKGELTSVLKMMKEVSAEEKPKIGQLVNDAREIIENQLLSAKKELTKALREERMKHETIDVTLPAKKREFGHNHPNTVALMEIQKIFVSMGYEVVEGPEIEYDEYNFTKLNIPANHPAKDEQDTFYINKDIVLRTQTSPVQARIMEK--GKLPIRMISPGRVFRADEVDATHSPSFHQVEGLVIDKNITFSDLKGTLAEFAKKLFGDNVKVKFRPHHFPFTEPSAEMDVTCFKCLGKGCRFCKGSGWIEILGCGMVHPHVFDMCGVDKEKYQGFAFGLGLERVALLKYEIDDMRLLYENDIRFINQF... 340
124 0.000e+00 GL0420625 unmapped_[Complete]_[mRNA]_locus=scaffold159761_1:648:1670:-  ali  52  1MQKQLMTILEEAKKQLSEAASPEMAEEIRVKVLGKKGKLTEILRSMGSLGAEERKEVGKRANEVRGEIENLLDEKMTELKEKKKQARLAAEVIDVTEPGRIKELGVKHPITQTIDEMSKIFMNMGFEIVEGPEVETVFMNFDALNAGPNHPSRDLTDTFYITDNTILRTQTSPVQARTLLTKE--PPMKVISPGRVYRCDTPDATHSPVFHQVEGLVVGEGITMADLKGTLGEFARQMFGPDTLTKFRPHHFPFTEPSAEVDVSCFKCGGEGCSVCKGSGWIEILGCGMVHPNVLKVGGIDTERYTGFAFGIGVERIAMLKYAVDDIRLFYENDERFLKQFK.. 340
125 0.000e+00JGI.Meta 7070676526 SRS063932_LANL_scaffold_105876__gene_165087 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome fr  ali  50  3.KDELLKIKEEALKAISDIDNMENLNNLRVNYLGKKGVLTNILKSLKDIPNEEKPKFGQLVNETRELLETRLNEAKNEVLRKIRQEKIKAEKIDVTLPAKRLNLGHKHPNRIALEEVEKIFIGMGYRVVEGPEIEYDEYNFAKLNIPANHPAKDEQDTFYINKDIVLRTQTSPVQARIMEK--GELPIRMISPGRVFRSDEVDATHSPSFHQVEGMVIDKNITFADLKGTLAEFAKKLFGEETKVKFRPHHFPFTEPSAEVDVSCFKCKGKGCRLCKGSGWIEILGCGMIHPRVLDMCGIDKNEYQGFAFGLGLERIALLKYEIDDMRLLYENDIRFLKQF... 340
126 0.000e+00gi|496512645|ref|WP_009220928.1| phenylalanine--tRNA ligase subunit alpha [Lachnospiraceae bacterium oral taxon 500]  clstr ali  53  1MLDIIEKLQKEALEKIKSAETKEILNELRVAYLGKKGELTALLKNMKNVAPEDRAEFGKVVNEAREAIENTLNTVGNELAKLALEARLKSETIDVTLPANRREFGHSHPNIIALHEVEKIFTNMGYEVVEGPEIEFDEYNFTKLNIPEDHPAKDEQDTFYITKDIVLRTQTSPVQARTMET--GKIPIKMISPGRVYRSDEVDATHSPTFNQIEGLIVDKGITFADLKGTLEVFAKKLFGEDTKVKFRPHHFPFTEPSAEMDVTCFKCHGSGCRFCKGSGWIEILGCGMVHPHVFDMCGVDKNEYNGFAFGIGLERIALLKYEIDDMRLLYENDIRFLKQFK.. 340
127 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  54  1MKEKLEAIKAEALAKIDSAKDLDSLNDIKVAVLGKKGELTAVLKSMKDVPAEERPMVGQMVNEARTAIEEKLEEEKTKIARMLRTEKMKRETIDVTLPGKKNMRGHRHPNQIALEDLERVFIGMGYEVVEGPEVEYDKYNFELLNIPANHPAKDEQDTFYITKDILLRTQTSPVQARIMEK--GKLPIRILSAGRVFRADEVDATHSPSFHQVEGLVVDKNITMADLKGTLAQFAKEFFGEKTQVKFRPHHFPFTEPSAEVDITCFKCGGKGCRMCKGSGWIEILGCGMVHPHVLEMCGIDPKEYQGFAFGIGLERVTLLKYEIDDMRLLYENDTRFLGQF... 339
128 0.000e+00gi|682699845|gb|KFZ26183.1| Phenylalanine--tRNA ligase alpha subunit [Mollicutes bacterium HR2]  clstr ali  60  1MEEKLDQIKLEAEGHIRVVKTLHALNEVKSKYLGKKGSFSEVMKLMKDLPKEDKPHFGQVTNEAKQVILKYIDDQKILIEEAIVNEQLASETIDVTMPGKKFETGNVHLLTKVREEIEDLFIGMGYEVMEGPEIEIDEYNFEKLNLPKDHPARDMQDTFYITDETLLRTHTSPVQVRTMLDNDEKGPIKIICPGKVYRRDDDDATHSHQFMQIEVLVVDTNTSMADLKGTLLETAKKLFGEKREIRLRPSYFPFTEPSVEVDVSCHNCNGKGCNICKGTGWIEILGAGMVNDNVLEASGYDSKKYQGFALGMGVERIAMLKYGINDIRLFYTNDIRFNKQFK.. 344
129 0.000e+00gi|938943675|ref|WP_054723391.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus nasuensis]  clstr ali  58  3LKSRLEALRDENQQKIHHISDLDELNQVRVSLLGKKGPITEVLRGMRDLAPEERPKVGEFANQIKAELQANLQERRAALEAAMIQKRLEQETIDVTLPGDEVVAGTPHILQQIMDDVEEFFIGQGYQVIDGPEVEEDHYNFEMLNIPKDHPARDMQDTFYIDSQLLMRSQTSPVQARTLEKHDSKGPLKMISPGRVYRRDTDDATHSHQFHQIEGLVIDRHITMADLKGTLLALAQHVFGAERKIRLRPSFFPFTEPSVEVDVSCFRCGGVGCAICKYSGWIEVLGAGMVHPNVLTAAGVDADVYGGFAFGLGPDRFAMLKYGIDDIRSFYQGDVRFLRQFQQ. 346
130 0.000e+00gi|515407858|ref|WP_016896913.1| MULTISPECIES: phenylalanine--tRNA ligase subunit alpha [Lactobacillales]  clstr ali  60  1MQDDLKAIENQIMDEIDAAQSLADIKAVRVKYLGKKGPITEALRGMRDLSAEERPQVGAYANELKAKADGKLSEKETLLSXXXXXXXXXXXXIDVTLPGEKPVTGTKHVLTQVMEEIEDLFVSMGYEVVEGPEIESDFYNFERMNLPKDHPARDMQDTFYINDEVLLRTHTSPVQARAMDAHDFEGPLKMISPGKVYRRDDDDATHSHQFHQIEGLVVDRNVSLADLKGTLELFARHMFGEETEVRLRPSYFPFTEPSVEIDVTCFKCGGAGCNICKQSGWIEILGGGMVHPSVLEMAGISSTEYTGFAFGLGPDRVAMLKYGIDDIRHFYQNDLRFLKQF... 344
131 0.000e+00gi|260208559|emb|CBA61232.1| phenylalanyl-tRNA synthetase alpha chain [Peptoclostridium difficile CD196]  clstr ali  58  19...............IKEAQSIESVESLRVKYLGKKGEITAILKEMGKLSAEERPVVGKVANEVRENIELSINSKKEEINAIEKERKLKEEVIDVTQPGKVLKVGKKHPITQIIDEVTDIFIGMGFSIAEGPEVETVENNFDALNAPKDHPSRDMSDTFYINDGVLLRTQTSPVQVRTMRSQE--LPIKVIAPGRCFRSDSPDATHSPMFHQIEGLVVGKDVTMAEFKGTMDIFVEKLFGSDIKTKFRPHNFPFTEPSAEVDVTCFKCGGKGCPMCKYEGWIEILGSGMVHPNVLRNCGIDPEVYSGFAFGVGVERLAMLKYEIDDIRLLFENDMRFLNQF... 342
132 0.000e+00gi|951557541|ref|WP_057889507.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus oligofermentans]  clstr ali  56  3LQDKLNDLLQQGLKQVEESVNLDSINDVRVKMLGKKGPITEVLRGMRDLSSEERPKVGQFANEVRDQLTAAIDEQRLKIESAKLNEQLKKEAIDVTLPGNSVAQGQPHVIQQIIDQLVDLFVGMGYVVAEGGEVEEDRYNFEMLNLPKDHPARDMQDTFYVTPEILMRTQTSPMQARTLETHDSKGPLKMVSPGKVYRRDTDDTTHSHQFHQVEGLVIGKHITMADLKGTLEIVAQELFGDELEVRLRPSYFPFTEPSVEADITCFNCHGKGCSICKSTGWIEVLGAGMTHPNVLKMAGVDPEEYGGFAFGLGPDRFAMLKYGVTDIRDFYQNDVRFLTQFDQ. 346
133 0.000e+00 GL0376410 unmapped_[Complete]_[mRNA]_locus=scaffold371549_1:88:1110:-  ali  54  1MREKIQNILDEMKAALENAKSSETMQEIRVKYLGKKGEITSMMKQMGSIAPEERPSFGQLVNAARKEAEAALEAKQKIIAEKIKNERLERERIDVTLPGKTRFVASEHPLTKVCNEIKAIFTKMGYTVMEGPEIELDKYNFELLNIPKDHPARDMQDTFYVSDEIVLRTQTSPVQVRAMLSQ--KPPIRMICPGRVYRTDDVDATHSPVFNQIEGLYIDKGVTFADLKGTINEFLNQLYGEDTVTKFRPSFFPFTEPSAEVDATCSICKGKGCPACKGQGVIEVLGCGMVNPKVLENCGIDPEVYSGFAFGMGLDRMTNIKYGITDIRHLYENDIRFLDQFK.. 340
134 0.000e+00gi|499959774|ref|WP_011640508.1| phenylalanine--tRNA ligase subunit alpha [Syntrophomonas wolfei]  clstr ali  56  1MLRKIEEIKNECQARLSQVSSMEELNEFRIKTLGRKGEVTLLLRGLKDLSGEEKARAGRVANELKQNLEQMLREKIDAFKLDELEQKLLQEKIDVTLPGLPRQRGRQHPLTQITREIQDIFIGMGFTVAEGPEIELDYYNFEALNVPRDHPARDMQDSFYISEELLLRTHTSPVQVRTMEKMAPQIPIKIIVPGKVYRKD-DDATHSPMFHQVEGLVIGQRITFAHLKGTLVRFAHQVFGEDVTVRYRPSFFPFTEPSAEMDISCVMCQGEGCRVCSHTGWLEILGAGMVNPRVLQYGGYDPEEVTGFAFGMGIERIAMLKYGINDLRLFFENDKRFLAQF... 340
135 0.000e+00 GL0504963 unmapped_[Complete]_[mRNA]_locus=scaffold60362_1:1548:2570:-  ali  57  1MQAQLNKILEEAKEQLQQAASVSDVDEIRVKLLGKKGKLTEILRGMGKLSPEERKTTGQMANSVRSEIEGLLERRFADMKAAAKEAKFKLEKIDVTEPGKEVTLGVKHPLTITIEEISKVFMSMGFSIAEGPEVETVFNNFDALNAGPDHPSRDMSDTFYITEDILLRTQTSPVQVRTLMK--TKPPIKVISPGRCFRCDTPDATHSPMFHQIEGLVVDEGITMADLKGTLDSFAKQLFGTETRTKFRPHHFPFTEPSAEMDVSCFKCGGKGCRVCKGSGWIEVLGCGMVHPHVLKVGGLDTEKYTGFAFGMGVERAAMLKYGVDDIRLFYENDMRFINQFK.. 340
136 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  51  1MKEQLQNIKEQALKTIGDCVDVKQLDDLRVKYLGKKGELTAILKSMGKLSAEERPVMGQLANDVRQSLESFIAQKQSQLKSALMEQRLKKETLDVTMPGKQQAMGVRHPLNIVLDELKEIFRGMGYTVVDGPEVEETKYVFDMLLTEDGHPARDEQDTFYITDDILLRTQTSSVQIRTMLKN--KPPIAIISPGRVYRPDAVDGTHSPIFHQCEGLVIDKNITFGDLKGTLETFAKRLYGDDVKLRFRPHHFPYTEPSAEVDLQCFKCGGKGCPLCKGEGWIEMLGSGIVHPQVLINCGIDPEEYSGFAFGIGLERIAMMRYNIDDMRLLYENDQRFLAQFR.. 340
137 0.000e+00 GL0033377 [Complete] locus=scaffold32_1:2817:3836:+  ali  56  1MKEALQNIRQSADTLIAQAADAAAVDELRVRFLGKKGELTAILKQMGRLSAEERPVVGALANEVREAITADIARRTKELESAALAARLAAEEIDVTLPGKAPAQGKRHPFEQVLGELKEIFLGMGFDIVSGPEVELDHYNFEMLNMPKSHPARDTQDTFYFTENVLLRTQTSPMQIRTMEKQ--KPPIRIICPGRVYRSDAVDATHSPIFHQCEGLVVDKGVTFSDLKGTLELFIKKLYGEETRVRFRPHHFPYTEPSAEMDMSCFKCGGKGCSMCKGEGWIEILGCGMVHPQVLENCGIDPEVYSGFAFGVGLERIAMMRYGIDDMRLLYENDLRFLKQF... 339
138 0.000e+00gi|496310284|ref|WP_009019462.1| phenylalanine--tRNA ligase subunit alpha [Luminiphilus syltensis]  clstr ali  51  2..ESLETLNRAAVAAINEAENVATLEQLRVEYLGKKGALTALLKGLGKLSAEERPKAGAEINTVKQQLQSQIEERKQALAAGALKARLDAERIDVTLPGRRSETGGLHPISRTIERMEGFFGGIGFDVVEGPEIEDDYHNFEALNIPAHHPARAMHDTFYVDDTHVLRTHTSPVQVRVMEQRE--PPLRIICPGRVYRCD-SDLTHSPMFHQVEGLLIDEESSFGDLKGLIEDFLHVFFEDDLEVRFRPSYFPFTEPSAEVDIQCVKCSGQGCRICSGTGWLEVMGCGMVNPKVFQFSGIDTERFTGFAFGMGVERLAMLRYGIGDLRLNFENDLRFLRQF... 338
139 0.000e+00gi|503145857|ref|WP_013380518.1| phenylalanine--tRNA ligase subunit alpha [Eubacterium limosum]  clstr ali  53  1MQEELNRIRENCLEDLKTVSDMKSLDDIRVKYLGKKGVLTAALKEMGKLSKDERPVIGKLANEVREEIETGLAGKKEALETAEMMAAIEKEKLDVSLPGKKPSEGNLHPLNIIINDLEEIFLGMGFSIAEGPEIEWSKYNFDYLNMPQEHSARDLQETFYYNDEVVLRTQTSPVQVRVM--MDEKPPLRVISPGRVYRADEIDATHSPVFHQMEGLVIDKGITMADLKGTLDMFAKKLFGETVQTKFRPHQFYFTEPSAEMDVTCFKCGGTGCKVCGNSGWIELLGCGMVHPNVLRHCGIDPEVYSGFAFGMGLERVAMTKYGINDLRLLFENDMRFLTQFK.. 340
140 0.000e+00gi|952342600|gb|KRT64933.1| phenylalanyl-tRNA synthetase, alpha subunit, phenylalanyl-tRNA synthetase alpha chain [Candidatus Dadabacteria bacterium  clstr ali  53  1MEGKLEEIRLDAEKEIKSVSDEVALQNVKAKFLGRKGVITEFLKRMPDVPESERPEMGRLINEVKNFIENLFEKRLEEIKEEKKTSVLLKERVDVTLPGRGIRIGGKHPVTQVMEEIISIFERMGFEVVEGPEVELDYYNFEALNIPKDHPARDMQDTFYISDEIVLRTHTSPVQIRVMEKQM--PPVKIIAPGKVYRCD-SDISHTPMFHQVEGLLVDEHVTFADLKGVLTEFARLMFGANIGVRFRPSFFPFTEPSAEVDIECVICGGRGCRVCKNSGWLEILGCGMVDPEVFKSVNYDQERYTGFAFGMGVERIAMLKFGINDIRLFFENDIRFLRQFS.. 339
141 0.000e+00gi|529040955|gb|EPZ42117.1| hypothetical protein N007_16200 [Alicyclobacillus acidoterrestris ATCC 49025]  clstr ali  59  6LKQELATLHAKALQELDDVQDTKRLGEWRVAYLGKKSELTTLSKQMGQLDAQTRPLFGQLLNERRQALEGAFTSKRESIEAAEQNARLAAETIDITLPGRHRDVGAVHPISRVIRDIEDIFLGMGFMIADGPEVETDRYNFEMLNLPKDHPARDMQDTFYITEELLMRTHTSPMQVRTMEQMHPHAPIKVIVPGRVYRRDEDDATHSHAFTQIEGLVVDKGIRMSDLKGVLEAFAKALFGEHQRVRLRPSYFPFTEPSAEVDLVCVHCQGHGCRVCKDTGWIEILGAGMVHPRVLDMAGYDSSIYSGFAFGMGPERIAMLKYGITDIRQLYQNDLRLLRQFAKV 349
142 0.000e+00gi|740253311|ref|WP_038094135.1| phenylalanine--tRNA ligase subunit alpha [Tumebacillus flagellatus]  clstr ali  61  1MREQLQGLKEQALTDLQGQESLQALGDWKVKYLGKKGELTAILRGMGSLSAEERPVIGQLVNEVRDELEAAHDEKEAAFKRAERNKRLAEEAVDVTLPGRAVPVGSEHPLNQLIRDVEDIFIGLGFSVAEGPEVEFDYFNFEAMNVPKNHPARDMQDTFYVTEEILMRTQTSPMQARVMGEKAAEAPIRIISPGRVYRRDDDDATHSHAFMQIEGLVVDRNIRMSDLKGTLLTFAREIFGDGVQVRLRPSYFPFTEPSTEVDATCHNCGGSGCRTCKGTGWIEILGAGMVHPSVLEMAGYDPTVFSGFAFGMGVERTAMRRYAIEDIRGFYQNDVRLMQNFK.. 351
143 0.000e+00gi|670484050|ref|WP_031432302.1| phenylalanine--tRNA ligase subunit alpha [Methylomarinum vadi]  clstr ali  48  1MSANIDDILKQALAELAQAQDLNQLDQVRVNYLGKKGAFTLQMKELGKLDPDQRRQVGQVINQAKSEFQQALEHSKQVMQGAALEARLASEAIDVTLPGRGQNSCGLHPVTITLRRIAEIFSSVGFKVEEGPEIEDDYHNFEALNIPAHHPARAMHDTFYFDAHTLLRTHTSPVQIRAMEAN--KPPLKVIAPGRVYRCD-SDLTHTPMFHQVEGFLVDSEVSFADLKGTVYEFLRAFFEKDIQVRFRPSYFPFTEPSAEVDIECVMCGGEGCRVCGHTGWLEVMGCGMIHPEVFKAVNIDSEQNSGFAFGMGVERLAMLRYGINDLRLFFENDLKFLEQFN.. 339
144 0.000e+00gi|654478914|ref|WP_027949005.1| phenylalanine--tRNA ligase subunit alpha [Haliea salexigens]  clstr ali  54  2..DNLTPLAEEAKSAIAGAGDSAALEQLRVDFLGKKGRVTELLKGLGQLSAEERPAAGARINVVKQELQALINERKXXXXXXXXXXXXXRETLDVTLPGRGQSTGGIHPVTRTIERMEDFFAAVGFEVVEGPEIEDDYHNFEALNIPAHHPARAMHDTFYVDPTTVLRTHTSPVQVRVMEN--SQPPLRVICPGRVYRCD-SDLTHTPMFHQVEGLLVDERSSFADLKGLIEDFLRVFFEKDLSVRFRPSYFPFTEPSAEVDIQCVNCAGAGCRVCSQTGWLEVMGCGMVHPRVLEGSGIDPERYTGFAFGMGVERLAMLRYGVNDLRLFFENDLRFLEQF... 337
145 0.000e+00gi|524347138|emb|CDB03586.1| phenylalanine--tRNA ligase alpha subunit [Firmicutes bacterium CAG:145]  clstr ali  52  1MQQKLKTILEESKRELEKATSLQEAEETRIKVLGKKGALTEILRSMGGLAPEERKELGQAANKVRAEVEKLLAETVNSLKEKAKEAGFKAETIDVTEPGKRYELGTKHPITITMEEISKIFKSMGFSLTEGPEVETVFNNFDALNAGPYHPSRDWTDTFYINDDVLLRTQTSPVQVRTLMKQ--KPPIRVFAPGRCFRCDTPDATHSPMFHQVEGLVVDEGITMADLKGVLDSFAKQMFGSETITKFRPHHFPFTEPSAEMDVSCFKCGGKGCRVCKGSGWIEILGCGMVHPNVLKVGGVDTEKYTGFAFGMGVERIAMLKYGIDDIRLLYENDMRFIEQFK.. 340
146 0.000e+00gi|501259454|ref|WP_012302472.1| phenylalanine--tRNA ligase subunit alpha [Candidatus Desulforudis audaxviator]  clstr ali  58  1MREKLAQVVEEAEKALAGASTAEVVEEVRIRYLGKKGVLTQVLRSMGSLPAAERPVVGKLANEMKVRLEQALASRSALLKQEEKAARLAAERIDVTLPGVLPHLGSMHPLTMVRTEIENIFLGLGFQIVEGPEVELEYYNFEALNFPKDHPARDMQDTFFINDEVLLRTHTSPVQVRTFEKTAPRVPVRIIAPGKVYRED-DDATHSPMFNQVEGFAVDTRITLGDLKGTLVYFVREMFGE-RRMRFRPSFFPFTEPSAEVDISCVICGGGGCRVCSHTGWLEILGAGMIHPRVLEVSGYDAEKVSGFAFGMGIERVAMLKYGIDNIRLFFDNDLRFLNQF... 339
147 0.000e+00gi|320138820|gb|EFW30710.1| phenylalanine--tRNA ligase, alpha subunit [Selenomonas artemidis F0399]  clstr ali  56  15MDEKIKELRERARTAIEKATSLGELGDIRVKFLGKKGELTSLLRSMSALVAEERPRIGKIVNEAREELEELLAAKSEELSYRELEERMARERIDVTLPGRTGEVGHLHPLTITLNRIKKIFLNMGFTIEEGPEIETDYFNFEALNLPKDHPARDMQDSFYITEDILLRSQTSPVQARTMQKSEPNAPIRMIAPGRVYRRDSYDATHSPMFTQVEGLVIDKGISFADLKGMLELCLHQLFDKDVKVRFRPSFFPFTEPSTEVDISCSSCRGAGCRVCKGTGWLEILGAGMVHPNVLSMSGYDPAVVSGFAFGMGIERIAMLAYGVDDLRLFYDNDVRFLHQF... 356
148 0.000e+00gi|737177312|ref|WP_035163457.1| phenylalanine--tRNA ligase subunit alpha [Caloranaerobacter azorensis]  clstr ali  50  1MKERLNAIKESALNEIKKVTDLERLEELRVKFLGKKGEITQVLRGMKDLSKEERPIIGKIANEVREVIEDEIEKLKLDLKEKMQKERLIAERIDISMPGKEKIIGHRHPLISVMEELENVFMNMGFSVVQGPEIETVYNNFDALNSPENHPSRDLSDTFYITDDILLRTHTSPVQIRVMKQ--VKPPLRIVSAGRTFRFDDVDDTHSPMFHQFEGLVIDKNITMANLKDTIYKFVREIFGEDMKVRFRPHYFPFTEPSAEVDVSCFKCKGKGCPACNGTGWMEILGCGMVHPKVLKNCGIDPEVYSGFAFGLGVDRIAMVKYGINNIRLLFENDMRFLEQF... 340
149 0.000e+00gi|225039040|gb|EEG49286.1| phenylalanine--tRNA ligase, alpha subunit [Blautia hydrogenotrophica DSM 10507]  clstr ali  53  3MKQKLQEIHEEAIQKIQQIDALDKLQEIRVSYLGKKGQLTSLLKGMKDVAKEERPVVGQMVHETQSQIEELLDRTKKRLEEVALNAKLEAEEIDVTLPAKKSKIGHRHPNMIALEEVENIFIGMGYEVVSGPEIEYDEYNFRKLNIPDGHPAKDEQDTFWITDEIVLRTQTSPCQARTMER--GPLPIRMIAPGRVYRSDEVDATHSPCFNQVEGMVIDKNITMADLKGTLDEFAKQLFGPETKTKFRPHHFPFTEPSAEMDVSCFKCGGKGCRFCQGTGWIEILGCGMVHPDVLEMCGIDSKEYTGFALGMGLERIALLKYEIDDLRRLYENDVRFLKQF... 341
150 0.000e+00 GL0040634 [Complete] locus=scaffold64339_1:168:1199:+  ali  55  5MKEKIAEIEKKSIQEIENCTTQKELNELKVKYLGKKGELTTVLRGMGALSPEERPVIGSLVNQVRDKLNELFTEKEETFKKKELEKRLLTEKIDITEPSKKIELGSLHPITQIIKEVEEIFLGMGYKIADGPEVEKAIYNFDKLNTPPDHPARDIQDTFYITDDVVLRSQTSPVQARVMENQ--KPPIKIICPGAVYRSDSVDATHSPVFHQIEGLVVDKNISMTDLKGTLEMFAKKCLGENTKIRFRPHHFPFTEPSAEADVSCFVCGGKGCRVCKGEGWIELLGCGMVHPNVFKNCGIDPDEYTGFAFGFGVERIAMAKFGIEDMRLLFENDVRFLKQF... 343
151 0.000e+00JGI.Meta 7074952185 SRS053854_LANL_scaffold_29229__gene_39228 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome from  ali  57  12MSDKVMQVQEEALAAIEQASNLEQLQQVKIQYLGKKGSIQALMSEMKALPPEEKPAFGQKVNVCKDTVAKVLESKEEVLKIAALAGKLEAEKIDVTLAGDIHKLGTTHPLVMIQQEIEDLFLSMGYKVAEGPEVEQDYYNFELANTPKDHPARDMQDTFYIDPNTLLRTHTTAMQMRELEKAKGQVPIKLICPGKVYRRDDDDATHSHQFMQCEGLVVGENITLADLKGTLEYMASTMFGQGRTVRFRPSYFPFTEPSVEVDVSCPFCNGKGCNVCKGSGWIEILGAGMVHPNVLRMNGFDPEKYSGFAFGVGLERVAMLKYGIDDIRNFYTNDVRFLKTFDR. 354
152 0.000e+00gi|821686816|gb|KLA45598.1| phenylalanyl-tRNA synthetase alpha chain [Lactobacillus ruminis]  clstr ali  62  56...............IKNADDSKKINEIRVNLLGKKGPITEVLRGMRDLSAEERPKVGSFANAIKEELATAIAEKCEEIEIERTAKQLEKEKIDVTMPGFPVEEGQPHVLMQVIDEIEKLFIGMGFQIVDGPEVEEDHYNFEMLNLPPDHPARDMQDTFYINDRLLMRTQTSPVQARTMEVHDSKGPLKMISPGKVYRRDTDDATHSHQFHQVEGLVIDKNITMGDLKGTLELVAKTIFGENREIRLRPSYFPFTEPSVEVDVSCFKCGGKGCSVCKQSGWIEVLGAGMVHPNVLKMAGVDSEVYGGFAFGLGPDRFAMLKYGVDDIREFYLNDVRFLSQFSQ. 384
153 0.000e+00 GL0111445 [Complete] locus=scaffold2364_1:2396:3421:+  ali  54  4..DKIEAIKAAVNEQLAKSEHLQDVQDIRVKFLGKKGELTAIMKEMKNFSKEERPKVGQLVNTARNAIEEQLKAKMEEVKAKELAAKIESEKIDITLPGRKPVMGHEHPLHQTLRLMEDSFLRMGFSIVEGTDIESDYYNFQCLNLPEDHPARDMQDSMYITDNILLRTHTSGMQARTLQAHKPNEPFKIIAPGKVYRCD-YDATHSPVFHQMEGMIIDKDIRFSDLKGMLEDFLRDIFGPQTKVRFRASYFPFTEPSAEVDISCVMCGGKGCRVCSHTGWLEILGCGMVNPSVLRLNGYDPDVVTGFAFGMGVERIAMLKYGIDDLRLFYENDMRFLNQF... 341
154 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  53  2MKEKIDAIKAAVSEQLDKSEALQDIQDIRVKYLGKKGELTALMKELGKLSKEERPQVGQMVNTARSLIEDALQQRMAELKQQALQKKIESEKIDITLPGRKPLMGHEHILHQTAREMEEAFMRMGFSIVEGPDIESDYYNFQCLNFPDDHPARDMQDSMYITDKILLRTHTSPLESRTLQAHKPNEPFKIIAPGKVYRWD-YDATHSPVFHQMEGMIVDKDIRFSDLKGMLEDFLREIFGPKTKVRFRASFFPFTEPSAEVDISCVMCGGKGCRVCSHTGWLEILGCGMTHPNVLRQNGYDPEKVTAFAFGMGIERIAMLKYGVDDLRLFYEDDMRFLKQF... 341
155 0.000e+00gi|737663599|ref|WP_035633238.1| phenylalanine--tRNA ligase subunit alpha [Lachnospiraceae bacterium ND2006]  clstr ali  52  1MKEKLEQIRQQALSAIGGSDTLDKLNDVRVSILGKKGELTAVLKGMKDVAPEDRPKVGAIVNETRAEIEKALEDAKKKLDRAVREAQMKAETIDVTLPAKKPVLGHRHPNQIALEEMERIFTGLGYEVIESPEVEYDYYNFEALNIPADHPAKDEQDTFYVNKEILLRTQTSGAQVHEMEK--GRLPIRMICPGRVYRSDEVDATHSPVFHQVEGMVVDETTTFADLKGTLTEFAKELFGEDTKVKFRPHHFPFTEPSAEMDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPHVLEMSKIDPLKYRGFAFGVGLERIALLKYEIDDMRLMYENDARFLEQF... 339
156 0.000e+00gi|504818484|ref|WP_015005586.1| MULTISPECIES: phenylalanine--tRNA ligase subunit alpha [Cycloclasticus]  clstr ali  50  1MENSLENIVKQAQKELADASSLSVVEEIRVTYLGKKGVFTRQMKTLGKLSAEERPKVGAVINQAKQEFQAHLEQRKVQLENELLAKRLIEETIDVTLPGRGQSVGGVHPVTRTMRRIEQIFNRVGFDVATGPEVEDDFHNFEALNIPSHHPARAMHDTFYFDEHTLLRTHTSPVQIRVMENQ--QPPLKVIAPGRVYRCD-SDITHTPMFHQVEGFVVDKDINFADLKGVISAFLKAFFEKDVKVRFRPSYFPFTEPSAEVDIECVMCEGEGCRVCGHTGWLEVLGCGMIHPEVFRHINIDADQFTGFAFGMGVERLTMLRYKINDLRLFFENDLKFLKQFN.. 339
157 0.000e+00gi|654585568|ref|WP_028052648.1| phenylalanine--tRNA ligase subunit alpha [Carboxydothermus ferrireducens]  clstr ali  57  6.....EELWQKYLGEVSRVSDLNELQTVKVKFLGKKGEVTLALKNLKNLPPELRPEAGHKINTVKKLIEEDLEKREQELLQKALEEKLSKEAIDVTLPGYSLKLGKLHPLTQVQHRIVEIFTSMGFSVATGPEIEKDYYNFEALNLPKDHPARDMQDSFYITEEVLLRTHTSPVQVRVMEKYAPNLPIRIISPGKVYRRD-DDATHSPMFAQCEGLAVDKNIRFSDLKGVLLTFIKELFGPKTKMRLRPSYFPFTEPSAEVDISCVICGGIGCKVCKGSGWLEILGSGMVHPRVLEMAGYDSSVVTGFAFGMGLERIAMLLYGIDDLRLFYDNDIRFLQMF... 340
158 0.000e+00JGI.Meta 7066254066 SRS056519_LANL_scaffold_36358__gene_79660 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit n  ali  53  54MKEQLEHIAQSAMEALQKVQNSAELEQLKVKVLGRKGELTQQMRLLGKMSPEERPAFGQMVNAVREKLTAAMEKMEADLKEKENAIRFAKEAVDVTAPGTQLPRGSYHPLSLVLQDIRDTFLEMGFSISEGPEIELDHYNFELLNIPKDHPARDEQDTFYIDDNIVLRTHTSPVQARTMLSQ--KPPIKMICPGRVFRSDDVDATHSPVFHQVEGLVVDKGIHFGHLKWLLDDFAKRFFGPDTQTRFRPGYFPFTEPSAEVDATCSACHGKGCRVCKGTGWIEILGCGMVHPNVLRGCGIDPEEYTGFAFGMGIDRLANIKYNITDIRLLFEGDVRFLSQF... 392
159 0.000e+00gi|948901930|gb|KRN16846.1| phenylalanyl-tRNA synthase subunit alpha [Lactobacillus fermentum]  clstr ali  57  35LKERLEELRQQGLEEIKQSDDLDRVNDVRVKLLGKKGPLTSVLRGMKDLSADERPKVGKFANEIRDELKAALEEKRAQLEKAVLDAKLAAEAIDVTLPGTPVAQGQPHVLQQIIDQLEDLFIGMGYEVAVGDEVEQEVYNFEKLNLPKDHPARDMQDTFYVTPSVLMRTQTSPMQARMLEQHDSKGPLKMISPGKVYRRDTDDATHSHQFHQVEGIVVGEHVTMADLKGTLEAVAQNLFGDQLKVRLRPSYFPFTEPSVEADITCFNCLGAGCSICKGIGWIEVLGAGMVHPNVLKMSGVDPEVYGGFAFGLGPDRFAMLKYGVEDIRDFYQNDVRFLTQFDQ. 378
160 0.000e+00gi|494075157|ref|WP_007017212.1| phenylalanine--tRNA ligase subunit alpha [Bermanella marisrubri]  clstr ali  52  2..ENLENLVSEALQKVEQAEDVKALDQVRVDYLGKKGALTAQLKNLGQLSAEERPAAGAKINEAKQQVEAVLREKKENLENAALEAKLAAESIDVTLPGRGQQRGGLHPVTRTLQRMQSFFKNAGYNVEFGPEVEDDFHNFEALNIPSHHPARAMHDTFYFDASTLLRTHTSPVQIRTMETQE--PPIRVICPGRVYRCD-SDVTHTPMFHQVEGLVVDENVSFADLKGTVEQFLRVFFEKELKVRFRPSYFPFTEPSAEVDMECVMCGGDGCRVCSHTGWLEVMGCGMVHPKVFQASGVDSEKYSGFAFGMGVERLAMLRYSVNDLRLFFENDLKFLEQFN.. 338
161 0.000e+00gi|503913400|ref|WP_014147394.1| phenylalanine--tRNA ligase subunit alpha [Methylomicrobium alcaliphilum]  clstr ali  49  1MSATLEDLLAQALQELANSQDLNQLDQVRVHYLGKKGLFTLQMKELGRLDPQQRREAGQVINQAKNQFQEALEAKKQALEAAALQQRLASESIDVTLPGRGQQVAGLHPVSRTLRRIAKIFAGVGFDVVEGPEIEDDYHNFGALNIPDHHPARAMHDTFYFDAHTVLRTHTSPVQIRVMES--EQPPLKVIAPGRVYRCD-SDLTHTPMFHQVEGFLVDSGVSFADLKGVVYEFLRAFFEKDIQVRFRPSYFPFTEPSAEVDIECVMCGGKGCRVCGHTGWLEVMGCGMIHPEVFKSVGIDGELYSGFAFGMGVERLAMLRYGINDLRLFFENDLKFLQQFR.. 339
162 0.000e+00gi|949078468|gb|KRO71719.1| phenylalanine--tRNA ligase subunit alpha [OM182 bacterium BACL3 MAG-120507-bin80]  clstr ali  50  5.....DSLLTEALDAIQDSSDEKSLESLRVHYIGKKGEVTAQLKALGQLPADERPAAGERINVVKRAIDAALAARKTAIVEQSLNAQLAAETIDVTLPGRRQNQGSLHPITQTIERISAIFAGSGYEVAEGPEIEDDYHNFEALNIPAHHPARAMHDTFYIDPATVLRTHTSPVQVRVME--GGSPPFKMICPGRVYRCD-SDLTHTPMFHQVEGLLIDRDVSFADLKGTVIEFLQAYFEADLPVRFRPSYFPFTEPSAEVDMGCVSCGGKGCRICGHTGWLEVMGCGMVHPSVLEMSNIDPETHNGFAFGMGVERLAMLRYGVGDLRTYFENDLRFLQQFN.. 338
163 0.000e+00gi|320126114|gb|ADW13674.1| phenylalanyl-tRNA synthetase, alpha subunit [Geobacter sp. M18]  clstr ali  57  15MKDKXXXXXXXXXXXXXQASTEEGLQELRVKYLGKKGALTGVMKGLGALSPEERPLVGQVVNTVKAKLEESLDSRGAEIREAVKAQRLAAERIDVTLPGRKRSMGSKHPITLVTEEICSIFGALGFAVAEGPEVELDFYNFEALNLPKDHPARDMQDTFYFGESVLLRTHTSPVQIRTMLKQ--PPPVRIIAPGTVYRCD-SDATHSPMFHQIEGLMVDKGITFGDLKGILTLFIGQLFGSDIGVRLRPSFFPFTEPSAEVDIACVICRGKGCRVCKETGWLEILGAGMVDPEVYRHVGYDSELYTGFAFGMGIERIAMLKYGIADMRLLFENDLRFLKQF... 352
164 0.000e+00gi|119458960|gb|EAW40060.1| phenylalanyl-tRNA synthetase alpha subunit [marine gamma proteobacterium HTCC2080]  clstr ali  54  19MEESLEAIKSAAIAAVAQASTPQELEQLRVEYLGKKGALTGLLKTLGGLSAEERPKAGALINAVKQELSGVLNERRTELEQAALQQKIEAEKIDVTLPGRGVDVGGLHPITRTIQRVEDFFTGMGFSVAEGPEIEDDYHNFEALNIPAHHPARAMHDTFYIDETHVLRTHTSGVQIRTMESRE--PPLRIICPGRVYRCD-SDLTHSPMFHQIEGLLVDERSSFADLKGLLEAFMQAFFEDDLAVRFRPSYFPFTEPSAEVDIQCVKCGGEGCRVCSHTGWLEVLGCGMVNPRVFEMSGIDTERFTGFAFGLGVERLAMLRYGIGDLRLNFDNDLRFLSQFQ.. 360
165 0.000e+00gi|503042414|ref|WP_013277390.1| phenylalanine--tRNA ligase subunit alpha [Acetohalobium arabaticum]  clstr ali  57  1MEEKLQSIEETATNEVKEAADLEELEELRIKYLGKNGEVTEILQNIGDLPPEQRPVVGKLGNKLKSKLENVIAERKEELKQAAKKERLKKERIDVTLTGRKDNLGSKHPLTQVIDEISEIFLGLGFGIVEGPEVEKDYYNFEALNIPKTHPARDMQDSFYISEDILLRTHTSPVQVRTME--ETEVPIRIIAPGRVYRVDEVDANHSPVFHQVEGLMIDQNISFSDLKGILIKVVKELFGEDRKVRFRPSYFPFTEPSAEVDVSCALCGGEGCSTCSDTGWLEILGSGMVHPRVLEMSGLDPNEVSGFAFGMGVERIAILKYGITDIRRFYENDIRFLKQF... 339
166 0.000e+00gi|653188626|ref|WP_027424538.1| phenylalanine--tRNA ligase subunit alpha [Lachnospiraceae bacterium AC3007]  clstr ali  54  6..EELSEIRERALEAIKDAKALDALNEVRVAFTGKKGELTEVLKGMKDVAAEDRPKVGALVNETRDIIEDAINKAKENLEAKALEIRLEKEKIDVTLPAKKHLLGHLHPNAIALDELERIFTGMGYEVVEGPEIEKDYYNFEALNIPADHPAKDEQDTFYINGDMLLRTQTSGTQIHEMEK--GRLPIKMISPGRVFRSDEVDATHSPSFHQIEGLLVDTDVTFSDLKGTLETFAKKLFGEDTKVKFRPHHFPFTEPSAEMDVSCFKCHGKGCRFCKGEGWIEILGCGMVHPHVLEMCNIDHIKYKGFAFGIGLERIALLKYEIDDMRLLYENDIRFLQQF... 342
167 0.000e+00gi|169292650|gb|EDS74783.1| phenylalanine--tRNA ligase, alpha subunit [ [[Clostridium] spiroforme DSM 1552]  clstr ali  58  29MENELLRIKEEALNKLDECSSLKELNDIRVLYLGKKGPIQESMKLMKNMDPEARKTFGQISNLVKQELSKAVEEKKELLENQTILDKINREKIDITLPSYKLDQGSLHPLSIIVTELEDLFLGMGYQIAEGPEVESDYFNFELMNLPKGHPARDMQDTFYIDENTLMRTHTSPVQAHTLLAAKGKGPIKVICPGKTYRRDDDDATHSHQFMQCEGLVVDKNITMADLKGTLEVFARKFFGEKREIRLRPSYFPFTEPSVEVDISCHNCGGKGCSMCKHTGWIEILGAGMVNPKVLEMCGFDSEIYQGFAFGIGIERVAMLKYGIDNIRNFYNDDIRFLNQFTR. 371
168 0.000e+00JGI.Meta 7014044976 C184149__gene_3144 phenylalanine--tRNA ligase, alpha subunit [Human Buccal mucosa microbiome from visit number 1 of subj  ali  60  32.EEQLKALREETLASLKQAENEKEMQDLRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDVLTAAFEEIAKLLEEKKVAAQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTEPSVEVDVSCFKCGGEGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQERVAMLRYGINDIRGFYQGDVRFSEQFK.. 375
169 0.000e+00gi|494634234|ref|WP_007392178.1| phenylalanine--tRNA ligase subunit alpha [Megasphaera sp. UPII 135-E]  clstr ali  55  1MQTNMENLKAEVKKQLAACKKIQDVQDIRVKYLGKKGEITGLMKNMKNLSPEERPAFGQLVNATRTEVEQWIEARREEVKAQELAKRLQAETIDITLPGRISAIGHEHPLHITRKKMEQAFLRMGFSLVEGPEIETDYYNFQCLNFPDDHPARDMQDSMYITDSILLRTHTSPMQARVLQQHAANEAVKVIVPGKVYRWD-YDATHSPVFQQMEGLIVDKHIRFSDLKGMLEDFLREIFGASTKVRFRASYFPFTEPSAEVDISCVMCGGSGCRVCSHTGWLEILGCGMVHPNVLRLNGYDPTVVNGFAFGMGVERIAMLTYGIDDLRLFYENDMRFLAQF... 340
170 0.000e+00gi|749570560|ref|WP_040200087.1| phenylalanine--tRNA ligase subunit alpha [Geoalkalibacter subterraneus]  clstr ali  51  1MKDKLRQIAEQGREALAAAGSEAELQQAKARFLGKKGELTSLMKGIGSVPPEERPAIGTLLNTYKDELEELFQQRLNQVRDADIKARLEREKVDVTLPGRQRFTGSKHPITLVTEEICSIFASLGFGVAEGPEVEMDFYNFEALNFPKDHPARDMQDTFFVSDDVLLRTHTSPVQVRTMLRHS--PPVRIIAPGTVYRRD-SDITHSPMFHQVEGFLVDHHVTFGDLKGILTAFINQFFGDDIGVRFRPSFFPFTEPSAEVDIQCVICKGQGCRVCKGSGWLEILGSGMIDPEVFKSVNYDPEVYSGFAFGMGVERIAMLKYGVNDLRLFFENDVRFLKQF... 338
171 0.000e+00gi|504122378|ref|WP_014356364.1| phenylalanine--tRNA ligase subunit alpha [Acetobacterium woodii]  clstr ali  55  1MELELKQLRDRCLADLNAIEELKSLDNVRIKYLGKKGELTIVLKGMGKLSNEERPIIGKLANEIREEIENNISNQKLALEKKEIEVQIETEGIDVSLPGKKHLAGNLHPLTTTINQLKEVFLGMGFSVAEGPEIEWSKYNFDYLNVPQEHSARDLQDTFYYQEDIVLRTQTSPVQIRVMQEQ--KPPLRIISPGRVYRFDEIDATHSPVFHQMEGLVIDKGITMSDLKGTLDLFAKKLFGEQTKTKFRPHQFYFTEPSAEMDVTCFKCGGVGCKVCSNTGWIEVLGCGMVHPNVLRFCGIDPDEYSGFAFGMGLDRITMIKYGINDLRLLFENDLRFLSQFK.. 340
172 0.000e+00gi|931409142|gb|KPJ96829.1| phenylalanyl-tRNA synthetase subunit alpha [Gammaproteobacteria bacterium SG8_15]  clstr ali  50  6.EKSLSQVLEEACSAVEAAKDEVAVEQLRVLYLGKKGVLTEQLKRLGTLPADQRPLFGKQVNEAKQKLQQLLTERKSGLQSGARARQLASEKIDVTLPGRGYGTGGLHPVTRTLERLERLFVGMGFEVADGPEIEDDFHNFEALNIPEDHPARAMHDTFYFEDGHVLRTHTSPVQIRFMENN--KPPFRVIAPGRVYRCD-SDVTHTPMFHQLEGLWVDETVSFADLKGLLSEFLSRFFEKDLDVRFRPSFFPFTEPSAEVDIGCVICGGEGCRVCSHTGWLEVLGCGMVHPEVFRHVGVDSEKYTGFAFGLGVERLAMLRYGVNDLRLFFENDLRFLRQF... 342
173 0.000e+00gi|657213622|ref|WP_029327552.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus malefermentans]  clstr ali  56  3LKDRLSELLNQGLEDLKSTSEQDELNELRVHLLGKKGPITKVLRGMKDLSPEERPVVGSFANEVRDRLQEAIDARKEEIDQKLLTVKLEKEKIDVTLPGKPAARGNAHVIQQIIDQIEDLFLGMGYQVLSGPEVEEDRYNFEMMNLPKDHPARDMQDTFYITKDILMRTQTSPMQARTMEKHDSKGPLKMISPGVVYRRDTDDPTHSHQFHQVEGLVIDKHVTMADLKGTLELVAHELFGDRFDVRLRPSYFPFTEPSVEADITCFNCGGKGCAVCKHTGWIEVLGAGMVHPNVLKMAGVDSDIYGGFAFGLGPDRFAMLKYGVDDIRNFYLDDERFLNQFS.. 345
174 0.000e+00gi|171281746|gb|EDT47180.1| phenylalanine--tRNA ligase, alpha subunit [Streptococcus infantarius subsp. infantarius ATCC BAA-102]  clstr ali  60  33LQAQLEELKSSTQAKLAEMNNAKELQELRVQVLGKKGSLTELLKGLKDLSKEMRPVVGKQVNEVRDVLTKAFEEQAKIVEAAKIKAQLESESLDVTLPGRQVNLGNRHVLTQTSEEIEDIFLGMGFQVVDGYEVESDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTLDKHDSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGENISMGELKGTLEMIIKKMFGEDRKIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVCKKTGWIEILGAGMVHPRVLEMSGVDSEKYSGFAFGLGQERIAMLRYGINDIRGFYQGDVRFSDQFK.. 377
175 0.000e+00gi|516566946|ref|WP_017942012.1| MULTISPECIES: phenylalanine--tRNA ligase subunit alpha [Thioalkalivibrio]  clstr ali  50  2..EQLQQLVAEARERVEGATDLKALDEVRVHYLGKKGALTAQLKELGKLPAEDRPAAGQKVNEAKSEVADLIEARKAALAESALADQLANERVDVTLPGRRPADGALHPITQTLERIETFFAGLGFRVAEGPEVEDDFHNFEALNIPEHHPARAMHDTFYFDAHRVLRTHTSPVQIRTMEQQ--QPPLRVIAPGRVYRCD-SDLTHSPMFHQVEGLCMDTDITFADLRGVLSAFLQAFFDDDLATRFRPSYFPFTEPSAEVDIQCVHCGGDGCRVCSHTGWLEVMGCGMVHPNVLGHVGIDAEQFTGFAFGLGVERMAMLRHGVNDLRLFFDNDIRFIGQFGQ. 340
176 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  54  4..DKIEAIKAAVNEQLAKSEHLQDVQDIRVKFLGKKGELTAIMKEMKNFSKEERPKIGQLVNTARNAIEEQLKAKMEEVKAQELAAKIESEKIDITLPGRKPVMGHEHPLHQTLRLMEDSFLRMGFSIVEGNDIESDYYNFQCLNLPEDHPARDMQDSMYITDNILLRTHTSGMQARTLQAHKPNEPFKIIAPGKVYRCD-YDATHSPVFHQMEGMIIDKDIRFSDLKGMLEDFLRDIFGAQTKVRFRASYFPFTEPSAEVDISCVMCGGKGCRVCSHTGWLEILGCGMVNPSVLRMNGYDPDVVTGFAFGMGVERIAMLKYGIDDLRLFYENDMRFLNQF... 341
177 0.000e+00gi|506260954|ref|WP_015780729.1| phenylalanine--tRNA ligase subunit alpha [Kangiella koreensis]  clstr ali  50  14....LQEIISQAEQEISAVQSLPDLEQVKARFVGKKGLITAQMQQMAKLPPEEKPKFGARVNEAKKEVFAIIEAKQKAIKDAEIAKKLAGETIDVTLPGRNNQDGGVHPVNRTLHRIESYFAQMGFSVEEGPEVEDNFHNFTALNIPEHHPARAMHDTFYIDAERLLRTHTSPVQIRVMEEQ--KPPFRIIAPGRVYRCD-SDLTHTPMFHQVEGLLIDESTTFVDLKGILDEFLKHFFEKDLAVRFRPSYFPFTEPSAEVDIQCVMCNGDGCRVCSHTGWLEILGCGMVHPKVLEAVGIDSEKYTGFAFGMGVERLTMLRYGVNDLRLFFENDLNFLKQFN.. 348
178 0.000e+00gi|524251774|emb|CDA16988.1| phenylalanine--tRNA ligase alpha subunit [Clostridium sp. CAG:571]  clstr ali  58  1MKEQIEKIKSNAIEEIAKITDLKSLNELKVKFLGKKGELTSVLRGMGALEPEERPVIGSLVNEVRDELESLISEKEENFKQEEMNRKLEKETIDITLPSKKAIRGSKHPINRTIEEIEDLFISMGYEVVDGPELETDEFCFERLNLPKGHPARDMQDSFYITDNYLLRTQTSAVQAHTMLKYAGKKPIRMICIGKTYRR-EDDATHSHQFNQVEGLVIDKHVSLADLKGTLEVFMKKMLGENTKLRFRPSYFPFTEPSYEVDCTCFKCGGKGCNLCKDTGWIEVLGSGIVHPNVLKMNGYDPDEWGGFAFGTGIDRLAMFKYGIPDMRYLYANDVRFLKQFDR. 345
179 0.000e+00gi|518509039|ref|WP_019679246.1| phenylalanine--tRNA ligase subunit alpha [Ruminococcus flavefaciens]  clstr ali  56  1MKEQLEKIEALAKQELESCTEIKALDDLRIKFLGKKGELTAILKQMGKLSAEERPVIGQLANKVRADIEEALGSKLASLKANAQAAKLAEEKIDITLPGKRAPFGKLHPLTKVENEIREIFIGMGFNIADGPEIDDDYHVFEALNLPPDHPARDTQDTFYINETVLLRTQTSSVQVHVMENQ--KPPIRIISPGRVFRSDAVDATHSPLFHQIEGLVVDKGITMSDLKGTLEMLMKKLYGNDCKLRFRPHHFPFTEPSCEVDISCFNCGGKGCSMCKDEGYIELLGAGMVHPKVLENCGIDSNEYSGFAFGLGLERMVMGRYDINDLRLLYENDVRFLEQF... 342
180 0.000e+00gi|924872095|ref|WP_053550801.1| phenylalanine--tRNA ligase subunit alpha [Desulfuromonas sp. WTL]  clstr ali  55  1MKARLEEMLVAARSALSAAGVESELQEGRVRFLGKKGELTAIMKGMGGLSAEERPVVGALANTVKEEIEALFESRLLELREVEIARRLASERIDVSLPGRRLYAGSKHPITLVTEEIVEIFSSLGFGVEEGPEIEKDFYNFEALNMPKDHPARDMQDTFYISDDVVLRTHTSPVQIRTMLKQA--PPVRVIAPGTVYRRD-SDITHSPMFHQVEGFLVDRNVSFGDLKGILTTFLAQFFGKGIDVRFRPSFFPFTEPSAEVDIQCVICGGKGCRVCKNSGWLEILGSGMIDPEVFKSVDYDAKAYSGFAFGMGLERLAMLKYGVNDLRLFFENDLRFLKQF... 338
181 0.000e+00gi|493352692|ref|WP_006309351.1| phenylalanine--tRNA ligase subunit alpha [Facklamia languida]  clstr ali  60  8LQEQVEALISQALQAIQRSQSTQDLQAIRVQYTGKKGALTQVSKQMKDLDPADKPQLGQLISQFHQAFNGAMESKQAELSQKELQDRLISEQVDVTLPGHQFPIGSRHIITQTREELEDLFLGMGYQIIEGPEVEVDLYNFEKMNLPKNHPARDMQDTFYISEEVLLRTHTSPVQARTMEQHDQQGPLKMVSPGKVFRRDDDDATHSHQFHQMEGLVVAEGITLADLKGTLSQFAKAFFGEEREIRLRPSFFPFTEPSVEVDVSCFKCGGKGCSVCKQTGWIEVLGAGVVHPNVLEMSGIDSSKYSGFAFGVGIDRVAMLKYNIDDIRHFYQNDLRFLKQFQG. 352
182 0.000e+00gi|503434695|ref|WP_013669356.1| phenylalanine--tRNA ligase subunit alpha [Aerococcus urinae]  clstr ali  57  6...NLQAIEGQIAEEIQSISSLDDVQAIRVKYLGKKGPITEALRHMKDIDPSERPKVGAYANELKNKVAKELDQKQAVLEEKALNQKLMAETIDVTLPGKEQKLGSQHVISQVMEEIEDLFLDLGYIIVEGPEIESDYYNFKRMNLPEDHPARDMQDTFYIEENVLLRTHTSPVQAHAMDQHDSKGPLQMISPGKVYRRDSDDATHSHQFHQIEGLVVDKNIGLSDLKGTLELFARHLFGADRQVRLRPSYFPFTEPSVEIDISCFKCGGQGCNICKKTGWIEILGGGMVHPNVLEMSGIDSEEYSGFAFGLGPDRVAMLKYGIEDIRHFYQNDLRFIHQFQ.. 346
183 0.000e+00gi|938914232|ref|WP_054697080.1| phenylalanine--tRNA ligase subunit alpha [Syntrophomonas palmitatica]  clstr ali  56  1MFDKLREIEKNVSETLSKARSLDELNEIRVRFLGRKGEITTLLRGLKDLKPDERAEFGRTANEVKDHLEMAISKKINDLKRLEMETRLQNEKVDVTLPGLPFQRGGKHPLSLVTEEIREIFTGMGFSVAEGPEIESDYYNFEALNIPKDHPARDMQDSFYISEEILLRTHTSPVQVRTMEKMAPHLPVKIIVPGRVYRRD-DDATHSPMFHQVEGLLVDTRITFGDLKGILMTFARKIFSEDLEVRYRPSFFPFTEPSAEMDISCVICKGSGCRVCSNTGWLEILGAGMVNPRVLQYGGYDPEYVTGFAFGMGVERIAMLKYGVNDLRLFFDNDVRFLKQF... 340
184 0.000e+00gi|524155796|emb|CCZ28647.1| phenylalanine--tRNA ligase alpha subunit [Firmicutes bacterium CAG:194]  clstr ali  54  1MKEKLAQIKAEAIKQIENSRTLEQLNEVRVSQLGKKGALTEILKGMKDVAPEDRPKVGQLVNETRAEIEKVLEDSRKKMEELVREAKMQKETIDVTLPAKKAKVGHVHPNFNVLDEVERIFIGMGYEVVEGPEVERDYYNFEALNIPADHPAKDEQDTFYINGDLLLRTQTSSTQVHEMET--GKMPIRMIAPGRVFRADEVDATHSPSFHQVEGLVIDKHITFADLKGTLAEFAKELFGEDTKVKFRPHHFPFTEPSAEMDVTCFKCGGSGCRFCKGEGWIEILGCGMVHPHVLEMSHIDPEEYTGFAFGVGLERITLLKYEIDDMRLLYENDIRFLKQF... 339
185 0.000e+00gi|339290045|gb|AEJ44155.1| phenylalanyl-tRNA synthetase, alpha subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1]  clstr ali  58  38...QLGAIREQAMASLALASDSKALSDWRVEVLGKKSALGQMSKAMGSLAPEERRALGEALNRVRQELEQAWRARQAEVEAKEKALRLERERIDVTLPGRVVPLGAMHPISRVIEEIEDIFTSLGFSVVEGPEVETDHYNFELLNIPKDHPARDMQDTFYLTEEWLLRTHTSPMQVRTMERMRGRTPIRVIVPGRVYRRDEDDATHSHQFTQIEGLVVDEGIRMSDLKGTLEAFAKALFGPSQRVRLRPSYFPFTEPSCEVDLVCISCGGEGCRMCKGTGWIEILGAGMVHPRVLDMSGYDSARYTGFAFGLGAERIAMLRYGISDIRMLYQNDLRFLRQFRHA 378
186 0.000e+00gi|496010587|ref|WP_008735166.1| phenylalanine--tRNA ligase subunit alpha [Alcanivorax pacificus]  clstr ali  56  2..ENLETLTRXXXXXXXXXXXXRALDEVRVNYLGKKGEISQLLKGLGKLSAEERPQAGALINEARDAVQQALENRREAMEQAALNAQLAGERVDVTLPGRGELPGNLHPVTRTRRRIEDFFAGLGYDVAEGPEVEDDFHNFEALNIPGHHPARAMHDTFYFGDGRLLRTHTSPVQIRVMEN--GKPPFRIIAPGRVYRCD-SDLTHTPMFHQVEGLLVDQNITFADLRGTVAAFLRAFFEDDLAVRFRPSYFPFTEPSAEVDIGCTHCGGNGCRVCKQTGWLEVMGCGMVHPTVLRHGGVDPEQYSGFAFGMGIERLAMLRYGVNDLRMFFENDVRFLSQF... 338
187 0.000e+00gi|493964408|ref|WP_006907842.1| phenylalanine--tRNA ligase subunit alpha [Facklamia hominis]  clstr ali  58  8LQDQITKLLESALNQIQAAESTQILQQIRVDYTGKKGQLTQVSKAMKNLSNEEKPQLGQMINYFHREFNQVMASKEEALKAKELQAQLASERIDITLPGRRNFQGSRHIITQTREELENLFLGMGYQIVEGPEVELDSYNFEKMNLPKNHPARDMQDTFYISSEVLMRTHTSPVQARTMEKHDFEGPLKMVSPGKVFRRDNDDATHSHQFHQMEGLVVAEKITLADLKGTLTQFAKAFFGQEREIRLRPSFFSFTEPSVEVDVSCFKCGGKGCNICKDTGWIEVLGAGMVHPNVLAMSGIDPEKYSGFAFGVGIDRVAMLKYSIDDIRHFYQNDLRFLSQFKG. 352
188 0.000e+00JGI.Meta 7041550682 SRS019327_WUGC_scaffold_59804__gene_93177 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome from  ali  54  13....LQEIVKRAEEQIAGSKDLTALNDIRVQFLGKKGELTEAKKLLKDLSPEERPKFGQLVNEMFQKVEQSIKSHGEDLERSLREAKMREETIDITLPAKKIRYGHPHPNTLALEEVEKIFIGMGYEVVEGPEVEYDSYNFEKLNIPEGHPARDEQDTFYINSNILLRTQTSSVQARYMETH--KPPIRMICPGRVFRSDAVDATHSPSFHQIEGLVIDKNIHFSDLKGTLDLFAKELFGQDTKTKLRPHHFPFTEPSAEVDVSCFKCKGKGCRFCKGEGWIEILGCGMVHPKVLESCGIDSKEYSGFAFGVGLERIALLKYEIDDMRLLYENDLRFLEQF... 347
189 0.000e+00gi|524381116|emb|CDB31744.1| phenylalanine--tRNA ligase alpha subunit [Clostridium sp. CAG:575]  clstr ali  56  1MKEQIEQIKQTSIKQIEEAKDLKELNDLRVKYLGKKGELTAVLRGLGSLSPEERPIIGGLVNEAKAVLENLIEEKETKFEQEELNKKLEAEKIDITLPSTKMKRGSIHPVNRIIEDIEDLFVSMGYDVVTGPELENDEYCFERLNLPKGHPARDMQDSFYITDEYLLRTQTSAVQARTMMANTEKTPIRMITAGKTYRR-EDDATHSHQFNQIEGLVIDKNVSLADLKGTLEVFVRKIIGANLDLRFRPSYFPFTEPSYEVDVTCFKCGGKGCNLCKQTGWIEVLGAGIVHPNVLKMNGYDPEQYGGFAFGTGIDRLAMFRYGITDMRYLYTNDVRFLGQFDR. 345
190 0.000e+00gi|940345724|ref|WP_054970721.1| phenylalanine--tRNA ligase subunit alpha [Alicyclobacillus ferrooxydans]  clstr ali  59  1MEQELAHLRAGAVEALAATSDVKALEEWRIEFLGKKSRLTQVSRQMGGLSAEERPIVGSLLNQLRGQLQEAFDARLSELEKAALAARFAAEQIDVTLPGRKTKRGAMHPITRVIEEIEDVFLGMGFEIAEGPEIETDEYNFERLNLPKDHPARDMQDTFYLTENLLLRTHTSPMQVRTMERMCPSAPVKVIVPGRVYRRDEDDATHSHAFNQIEGLVVDKGIRMSDLKGVLEQFAKAVFGPNQAVRLRPSFFPFTEPSAEVDVLCVNCGGKGCRVCKDTGWIEILGAGMVHPNVLDWAGYDSKIYSGFAFGMGAERIAMLKYGIEDIRQLYQNDLRLLSQFAR. 343
191 0.000e+00gi|835373065|gb|KLU61820.1| phenylalanine--tRNA ligase alpha subunit [Peptococcaceae bacterium CEB3]  clstr ali  57  4LQEEVRRLEAETLALLAKTDTLDGIRDLKVKVLGKKGTLTALLRQMGSLPPQERPLMGQIVNEARNKLEQAWNERERLLEERILQERLEGERVDVTLPGFRFPEGHLHPLSQIIEEIEDIFLGMGFEIAEGPEIETDYYNFEALNLPKEHPARDMQDSFYISEEILLRSQTSPVQIRTMERQHPRLPVKIIAPGKVYRKD-DDATHSPMFHQVEGLFVDRGIRMSDLKGVLLNFSRQMFGADREIRLRPSFFPFTEPSAEVDVSCMLCGGAGCRVCKGTGWLEILGSGMVHPKVLAMGGYDPREVTGFAFGMGAERVAMLKYGIEDMRLMFDNDLRFLRQF... 343
192 0.000e+00JGI.Meta 7056035483 SRS047824_WUGC_scaffold_55971__gene_90063 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome from  ali  53  3.KEKLEQINKQVLEQLEASKDLNDLNRIRVEVLGKKGQLTGLLKSMRDVAPQDRPKVGQIVNEARASLEAAMEARKRGMEEALLDVKLKSEVIDVTLPAKKSRLGHRHPNTIALKEAERIFVGMGYQVVEGPEVERDYYNFEALNIPADHPAKDEQDTFYISGDFLLRTQTSSVQVREMEK--GHLPIKMISPGRVFRADEVDATHSPSFHQIEGLVIDQDITMSDLKGTLAEFAREIFGEDTKVKFRPHHFPFTEPSAEMDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPHVLEMSGIDPEKYTGFAFGVGLERIALLKYEIDDMRLLYENDIRFLNQF... 340
193 0.000e+00gi|948769401|gb|KRL92403.1| phenylalanine--tRNA ligase [Lactobacillus ingluviei DSM 15946]  clstr ali  57  9LREKLEELRKQGIQEIKASADLDHLNDIRVKMLGKKGPLTTVLRGMKDLSKEERPKVGKFANEIRDELAQALEAKKAELATARLNAKLAAETLDVTLPGTPTVQGQPHVIQQIIDQLVDLFVGMGYQVAVGDEVEQDEYNFERLNLPKDHPARDMQDTFYVTPSVLMRTQTSPMQARMMEKHDANGPLKMISPGKVYRRDTDDATHSHQFHQVEGLVVGEHVTMADLKGTLEVVAKTLFGDELAVRLRPSYFPFTEPSVEADITCFNCLGQGCAICKHTGWLEVLGAGMVHPNVLKMSGVDPEVYGGFAFGLGPDRFAMIKYVVEDIRDFYQNDVRFLNQFNQ. 352
194 0.000e+00gi|817124569|ref|WP_046497211.1| phenylalanine--tRNA ligase subunit alpha [Syntrophomonas zehnderi]  clstr ali  55  1MIERLLKLKQMTEETIQGINDMQTLNEVKVKTLGRKGEITMLLRGLKDLGGDEKIEAGRTANEVKNSLEKLIEEKTEQIKKKELEQRLKSEKIDVTLPGLPLESGGLHPITQVTREIKEIFMGMGFTVAEGPQVETDYYNFEALNVPKDHPARDMQDTFYIDEEILLRTHTSPVQVRTMEKMAPQIPVKIIVPGKVYRKD-DDATHSPMFHQIEGLVIDERITFGDLKGTLMQFAQKIFHADVRVRYRPSFFPFTEPSAEMDISCVNCQGEGCRVCSHTGWLEILGAGMVNPRVLQYGGYDPEKVTGFAFGMGIERIAMLKYGINDLRLFFDNDKRFLTQF... 340
195 0.000e+00gi|259168415|gb|EEW52910.1| phenylalanine--tRNA ligase, alpha subunit [Lactobacillus antri DSM 16041]  clstr ali  59  21LKDRLTELRDEGLAEIKNSQDLKKINEIRVKMLGKKGPITSVLRGMRDLSAEERPVVGQFANKVRDELTTAIENRRAELEQAALDAKLAAETVDVTLPGTPVAQGQPHVIQQIIDQVVDLFVSMGYEVAVGDEVEQEVYNFEKLNLPKDHPARDMQDTFYVTPTVLMRTQTSPMQARMLEKHDSQGPLKMISPGKVYRRDTDDATHSHQFNQIEGMVVGKHITMADLKGTLEVVAQSLFGDKLKVRLRPSYFPFTEPSVEADITCFNCLGKGCAICKHTGWIEVLGAGMVHPNVLKMSGVDPEVYGGFAFGLGPDRFAMLKYGVDDIRNFYQNDVRFLNQFD.. 363
196 0.000e+00JGI.Meta 7004771802 SRS013705_Baylor_scaffold_103384__gene_140062 phenylalanine--tRNA ligase, alpha subunit [Human Tongue dorsum microbiome  ali  51  3.KEQLDKIKEEALQKIAKVNNLDMLNDLKVAYLGKKGELTAVLKGMKDVLPEDKPKVGQMVNEVRQMLEEKLAQTKDELVKIAREEQMKMETIDVTLPAKKNVLGHSHPNTVALNEVERIFTSMGYEVVEGPEIEYDEYNFAKLNIPANHPAKDEQDTFYINKEIVLRTQTSPVQARMMEK--GKLPIRMISPGRVFRSDEVDATHSPSFHQVEGLVIDKNITFADLKGTLAEFAKMLFGPETKVKFRPHHFPFTEPSAEMDVTCFKCGGKGCRFCKGSGWIEILGCGMVHPNVLDMCGVDKNEYTGFAFGVGLERIALLKYEIDDMRLLYENDIRFLQQF... 340
197 0.000e+00 GL0084912 [Complete] locus=scaffold16202_1:3177:4262:+  ali  55  17MKEKLEAISKMSKEKIAEIKDSQALNDFKVKVLGKKGELTEILRGMKDIAAEERPVVGNLVNKIRDEIEQMIDEKESEFKNKDLQERLEKEKIDVTLPATKVKRGSEHPLNRVIEEVEDLFVSMGYDVVSGPELETDEYCFERLNLPKGHPARDMQDSFYITSEYLLRTQTSAVQARTMMSNTEKTPIRVICPGKTYRK-EDDATHSHQFNQVEGLVIDKNISFADLKGTLEIFMRKMLGENTQLRFRPSYFPFTEPSYEVDVSCFKCGGKGCNLCKQTGWIELLGSGIVHPNVLKMNGYDPEVYSGFAFGTGLDRLAMFKYGITDMRLLYTNDVKFLSQFDRM 359
198 0.000e+00gi|852214691|ref|WP_048306611.1| phenylalanine--tRNA ligase subunit alpha [Halomonas sp. PR-M31]  clstr ali  51  2..DHLPALVTKARAAIADANDVSALDTVRVEYLGKKGEITTLLKGLGKLAPEQRPQAGERINQAKQQLSGEIETRKRELEQRALDARLKSERLDVTLPGRGQSTGGLHPVTRTLERIEGLFTRIGFDVAVGPEIEDDYHNFEALNIPAHHPARGMADTFYFDANRLLRTHTSPVQVRTMESQE--PPIRIVCPGRVYRSD-SDLTHTPMFHQVEGLLIDEDVSFADLKGTIEDFLHAFFEEDLSVRFRPSYFPFTEPSAEVDIQCVMCSGDGCRVCSHSGWLEVMGCGMVHPEVFRHSNIDTERYTGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLRQF... 338
199 0.000e+00gi|406358534|emb|CCK22804.1| Phenylalanine--tRNA ligase alpha subunit [Lactobacillus casei W56]  clstr ali  57  49LQTKLEQLFQQNNDTIKKVKSLDELNQIRVQLLGKKGPITGVLRGMKDLSAEERPKVGAFANKIRDDLSAVIEARKAQLEQAVINAKLASETVDVTLPGDPVEAGTPHIITQIMDDLEGFFMGMGYQVLTGPEVEEDHYNFEMMNIPKDHPARDMQETFYITNELLMRSQTSPMQARTMEKHDTKGPLKMISPGVVYRRDDDDATHSHQFHQMEGLVIDKHITMADLKGTLLAMCQHVFGKDRTIRLRPSYFPFTEPSVEVDVSCFRCGGKGCPVCKYTGWIEVLGAGMVHPNVLQAANIDADVYGGFAFGLGPDRFAMLKYGIDDIRSFYTDDLRFLTQFSQ. 392
200 0.000e+00gi|515830979|ref|WP_017261732.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus rossiae]  clstr ali  56  3LRERLQELHDRGLADIKKGDSLDRINEIRVQLLGKKGPITQALRGLRDVSAEERPKIGSFANQIRDELTAAIEERNQELKKAAINAKLASETLDVTLPGTPVAQGQPHVIQRIIDQLEDMFLGMGYQVVDGPEVEDDHHNFEMMNLPKDHPARDMQDTFYITPEILMRTHTSPNQARAMEAHDSKGPLKMISPGRVYRRDTDDATHSHQFHQVEGLVIDKHVTMADLKGTLEMVAANLFGDEFDVRLRPSYFPFTEPSVEADITCFNCMGKGCAVCKNTGWIEVLGAGMVHPNVLKMAGVDSSVYGGFAFGLGPDRFAMLKYGVDDIRNFYLNDTRFLTQF... 344
201 0.000e+00gi|655260911|ref|WP_028671391.1| phenylalanine--tRNA ligase subunit alpha [Saccharospirillum impatiens]  clstr ali  52  2..ETLAQLHERALEAVRHAKETQELDDLRVRFLGKKGEITAQLKGLGALSAEERPAAGARINEVKSAVADAIAARKADLEEAALSQRLAEEKVDVTQPGRRQGKGGLHPVTQTLRRMESFFTAIGYDVAVGPEIEDDYHNFEALNIPSHHPARAMHDTFYFDATTLLRTHTSPVQVRTMEA--GEPPFRVICPGRVYRCD-SDLTHTPMFHQMEGLMIDTDVSFADLKGTVEEFLRVFFEKELAVRFRPSYFPFTEPSAEVDIECVMCQGDGCRVCSHTGWLEVMGCGMVHPNVLAASNIDSTIYKGFAFGMGVERLAMLRYGVNDLRLFFENDLKFLRQFN.. 338
202 0.000e+00gi|737472149|ref|WP_035452049.1| phenylalanine--tRNA ligase subunit alpha [Alicyclobacillus herbarius]  clstr ali  60  1MQAEISSLRDEALAELDAAHAGKQLEAWRVQYLGKKGPLAQLSRQMANLSKEERPRVGQAVNQAQRALQDAFVRTRQKIEEQALAERLRSERIDVTLPGRAPARGSLHPLTRVIQEIEDVFLGMGFSIAEGPEVETDRYNFEMLNIPKDHPARDMQDTFYLTEELLLRTQTSPMQVRTMEKMRPFAPIKVICPGRVYRRDEDDATHSHAFNQIEGLVVDRGIRMSDLKGVLLQFAKAVFGPEQEVRLRPSFFPFTEPSAEVDVRCTNCGGRGCRVCKHSGWLEILGAGMVHPHVLDGAGYDSREFSGFAFGMGPERIAMLKYGIDDIRLLYQNDLRLLRQF... 350
203 0.000e+00JGI.Meta 7056622396 SRS019161_WUGC_scaffold_11247__gene_18972 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit n  ali  55  23MKEKLEAISKMSKEKIAEIKDSQALNDFKVKVLGKKGELTEILRGMKDIAAEERPVVGSLVNKIRDEIEQMIDEKESEFKNKDLQERLEKEKIDVTLPATKVKRGSEHPLNRVIEEVEDLFVSMGYDVVSGPELETDEYCFERLNLPKGHPARDMQDSFYITSEYLLRTQTSAVQARTMMANTEKTPIRVICPGKTYRK-EDDATHSHQFNQVEGLVIDKNISFADLKGTLEIFMRKMLGENTQLRFRPSYFPFTEPSYEVDVSCFKCGGKGCNLCKQTGWIELLGSGIVHPNVLKMNGYDPEIYSGFAFGTGLDRLAMFKYGITDMRLLYTNDVKFLSQFDRM 365
204 0.000e+00gi|563353455|ref|WP_023660110.1| phenylalanine--tRNA ligase subunit alpha [Congregibacter litoralis]  clstr ali  52  2..ENLEKLAEEARSAINAAPDVPALEAARVDYLGKKGALTALLKGLSSLSAEERPAAGAQINVVKQEMQALIGERKAALEEAAISARLASESIDVTLPGRSVGGGRIHPISRTIERIEAFFGSAGFSVADGPEVEQDYYNFEALNFPPHHPARAEHDTFFVDPTTVLRTHTSPVQVRVMES--SEPPLRIICPGRVYRCD-SDLTHTPMFHQVEGLLVDEHSSLADLKGLIEQFLQVFFEKEFAVRFRPSYFPFVEPGAEVDIQCVHCGGDGCRVCSHTGWLEVMGCGMVHPRVFEMAGIDPERYSGFAFGMGVERLAMLRYGVNDLRLFFENDLRFLAQF... 337
205 0.000e+00gi|517185131|ref|WP_018373949.1| phenylalanine--tRNA ligase subunit alpha [Streptococcus merionis]  clstr ali  60  4.QDKLAELRHSTLEKLKQAEKSKEIQDLRVEVLGKKGSLTEILKGLKDLSAEERPVIGKYVNEVRDVLTEAFDNANALIEEEKIAMQLASETIDVTLPGKPVAVGNRHVLTQTAEELEDIFLGMGFQVVDGFEVEKDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTMDQHDSNGPLKMVSPGRVFRRDTDDATHSHQFHQIEGLVVGENISMGDLKGTLQLISQKMFGEDRKIRLRPSYFPFTEPSVEVDVSCFKCGGEGCNVCKKTGWIEILGAGMVHPSVLEMSGIDSEKYSGFAFGLGQERIAMLRYGINDIRGFYQGDARFSEQFKG. 348
206 0.000e+00gi|749585022|ref|WP_040211971.1| phenylalanine--tRNA ligase subunit alpha [Clostridium polynesiense]  clstr ali  54  1MKNKLSEISEKALNELKSILSISELEAVRVKYLGKKGELTSILRGMGALSPEERPLIGKLANEIREDIEKNIEKISREIKEKEKAEKLEREVIDISMPGRKKSVGKRHPLDLTLENMKDIFVSMGFSIEEGPEVELDYYNFEALNIPKNHPARSEQDTFYINDNVVLRTQTSPVQIRVMENQ--KPPIKMISPGKVFRSDAADATHSPIFYQLEGLVIDKGITFADLKGTLELFAKKMYGDKLQTKFRPHHFPFTEPSAEMDATCFVCQGKGCRVCKGSGWIELLGCGMVHPQVLRNCGIDPEIYSGFAFGFGVDRMVMLKYGIDDIRLLYESDMRFLNQF... 339
207 0.000e+00gi|636726427|dbj|GAK12511.1| LOW QUALITY PROTEIN: phenylalanyl-tRNA synthetase alpha chain [Geomicrobium sp. JCM 19039]  clstr ali  65  1MITRLEELKVEALTGVTNSEDQKQLEHVRITYLGKKGPITEVLRGMGKLSAEERPVVGQKANEVREMIQQAIDEKLALFAEAKLREQLTEEQIDVTLPGHKLTQGATHPLTAVVEQIEDIFIGLGFEVTEGPEVELDYFNFQMMNLPPDHPARDMQDSFYITDDTLLRTHISPVQARTLQAAKGEGPIRKVSLGKCYRRDEDDATHSHQFTQIEGLYVDKNVRMSDLKGVFDAFVKQYFGNDRLIRLRPSYFPFTEPSAEIDVNCGVCGGSGCRVCKHSGWIEVLGAGMVHPRVLEMNGFDPEVYSGFAFGMGVERFAMLKYGIDDIRHFYTNDTRFLSQFKNL 344
208 0.000e+00gi|546176660|ref|WP_021817422.1| phenylalanine--tRNA ligase subunit alpha [Halomonas huangheensis]  clstr ali  52  2..DHLPVLVQQAREAIKAADNMVALDEIRVRYLGKKGELTALLKGLGKLPPEERPAAGEQINQAKQALAQELETRRDTLARAELDARLADERVDVTLPGRGQPAGGLHPVTRTLERIESLFRRIGYDVAVGPELEDDYHNFEALNIPAHHPARGMADTFYFDATRLLRTHTSPVQVRTMKA--GEPPIRIVCPGRVYRSD-SDLTHTPMFHQVEGLLIEEGVSFADLKGTIEDFLHAFFEDDLSVRFRPSYFPFTEPSAEVDIECVMCSGEGCRVCSQTGWLEVMGCGMVHPEVFRHGGIDPERYTGFAFGMGAERLAMLRYGVNDLRLFFENDLRFLKQFH.. 339
209 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  54  1MKQQLEQILASAQKELSECGDLKVMEELRVKFLGKKGELTAILKQMGGLSAEERPVIGQLANKVRSEIEAKITEKAEALRSEAAANKMAAETIDVTLPGKAPEIGRLHPLTAVLEEVKEIFLGMGFDIVDGPEVETDHYCFEALNMPKHHPARDTQDTFYINDNVVLRTQTSSVQIRTMEQR--KPPIRIISPGRVYRSDAVDATHSPLFHQIEGLVIDKGVTLGDLYGTLDLLMKKLYGKDAKIRLRPHHFPYTEPSAEVDLVCFNCGGKGCSMCKGDGYVELLGSGMVHPEVLRGCGIDPEVYSGFAFGIGLERITMGRYNINDMRMLYENDMRFLSQF... 339
210 0.000e+00JGI.Meta 7049534946 SRS051031_LANL_scaffold_64736__gene_141113 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit  ali  55  51.......ILDDAMTQIDSSEHLDRLNEIKVSFLGKKGELTSVLKAMKDVAPEDRPKVGQLVNEARKAIEEKLDEKRDIFEKAVLEEKLKSETIDVTLPGKKLAMGHSHPNTITLEEVEDIFVGMGYEVVEGPEVEYDYYNFEALNIPDNHPAKDEQDTFYITKDILLRSQTSSVQVHEMEK--GKLPIRMIAPGRVFRSDEVDATHSPTFHQIEGLVIDKNITFADLKGTLQEFAKRLFGEDTKVKFRPHHFQFTEPSAEMDVTCFKCGGKGCRFCKGSGWVEILGCGMVHPHVLEMSGIDPEEYTGFAFGVGLERITLFKYEIDDMRLLYENDTRFLKQF... 382
211 0.000e+00gi|653149547|ref|WP_027398717.1| phenylalanine--tRNA ligase subunit alpha [Anaerovorax odorimutans]  clstr ali  53  1MQNQLMTILQEAKEQLNKASSVGETEELRVKILGKKGKLTEILRSMGSMSPEERKEFGKMANSVRSEIESLLDEKFTEMKERQKAAKFKEERIDVTEPGIKISLGSKHPITITIDEISKVFMSMGYSIAEGPEVETVFNNFDALNAGKNHPSRDLSDTFYITDDTLLRTQTSPVQVRTLMKQ--KPPIKVISPGRCFRCDTPDATHSPMFHQVEGLLVDEGVTMADLKGTLDSFAKKMFGSKTKTKFRPHHFPFTEPSAEMDVSCFKCGGAGCRVCKGSGWIEILGCGMVHPNVLKVGNVDTEKYTGFAFGMGVERIAMLKYEVDDIRLFYENDMRFIKQFK.. 341
212 0.000e+00gi|503026166|ref|WP_013261142.1| phenylalanine--tRNA ligase subunit alpha [gamma proteobacterium HdN1]  clstr ali  52  2..EQLQAIVEKALKQIETANNEPDLDNVRVQYLGKKGEITDQLKALGKLPAEERPQAGAEINQAKVQVQDALNLRKALLEQQALERRLAGECVDVTLPGRRSEVGASHPVSVTMSRIEGFFRKAGFSVVEGPEIEDDYHNFEALNIPQHHPARAMHDTFYFDARRVLRTHTSPVQVRVMET--SEPPLRIICPGRVYRCD-SDVTHSPMFHQVEGLLIDENVTFADLKGVLALFLKDFFEQDLAVRFRPSYFPFTEPSAEVDIQCVICGGGGCRVCKQSGWLEVLGCGMVHPDVFRFSGVDTEKFTGFAFGMGVERLTMLRYGVNDLRLFFENDLKFLRQFR.. 338
213 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  51  29MKEKLDAIKESALSQIRATDSLEKLNDIRVAFLGKKGELTEVLKSMKEVAPEDRPKVGQIVNETRQAIEEVLDAAKKDLAAKKRELQMKSEVIDVTLPAKKAELGHKHPNTLAREEIEKIFIGMGYEVVEGPEVEYDHYNFELLNIPANHPAKDEQDTFYINDKIVLRTQTSPVQARVMEK--GKLPIRMISPGRVYRADEVDATHSPCFHQVEGLVIDENITFADLKGTLAEFARELFGPDTKVKFRPHHFPFTEPSAEMDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPHVFEMCGIDKDKYTGFAFGVGLERVALLKYEIDDMRLLYENDTRFLKQF... 367
214 0.000e+00gi|407254360|gb|AFT71467.1| Phenylalanyl-tRNA synthetase alpha chain [Alcanivorax dieselolei B5]  clstr ali  52  1MMENLETLVSEALAQVAEAGDARVLDEVRVRYLGKKGEISALLKSLGGLGPEERPKAGALINEGKQRVQDAIEERKSLLQEQVLNARLAEEALDVTLPGRGEMPGALHPVTRMRRRMEDFFLRLGFDIAEGPEVEDDYHNFEALNIPDHHPARAMHDTFYFGDGRLLRTHTSPVQVRVMKA--GKPPFRIIAPGRVYRCD-SDLTHTPMFHQVEGLLVDEGITFADLKGTVAEFLKFVFEDDLPVRFRPSYFPFTEPSAEVDVGCVSCGGKGCRVCSHSGWLEIMGCGMVHPKVLEHGGVDPERYTGFAFGMGIERLTMLRYGVNDLRLFFENDVRVLSQF... 339
215 0.000e+00gi|566220592|gb|ETI86098.1| Phenylalanine-tRNA ligase alpha subunit [Negativicoccus succinicivorans DORA_17_25]  clstr ali  53  1MKEAMQELQQRALEQIAAAANESELQKIRVAFLGKKGELTAILRGMKDLAAEERPVVGALANEVRGVLEKNLSEKQDELAQKALSERLAAEKIDITLPGRRPLQGHLHPLTQINRRIQDIFMKMGYTIAQGPEIEDDFYNFQSLNFPKDHPARDMQDSFYINDSILLRTHTSPVQARTMQSQEPNTPIRIIAPGKVYRSD-YDATHSPVFHQVEGLLLDQGITFSDLKGTIEHFCREIFGTDTKVRFRASYFPFTEPSAEVDISFRKRHSKGGTVDTSEEWLEILGCGMVHPNVLRLNGYDPEKISGFAFGMGVERIAMLVYGIDDLRLFYDNDVRFLAQF... 340
216 0.000e+00gi|495558690|ref|WP_008283269.1| phenylalanine--tRNA ligase subunit alpha [gamma proteobacterium HTCC5015]  clstr ali  51  1MSNDLQAVIEQAESAIAEAGNLADLDALRVQYLGKKGVITEQLKSLGQLPPEERSAMGQAINQAKQGVAKAIETRRNALAEEQLKAQLAAESVDVTLPGRGEKTGGLHPVSQTLERIRLLFAQMGFSVEEGPEIEDDYHNFEALNIPDNHPARAMHDTFYFEDGRVLRTHTSPVQVRTMEA--VEPPIRIIAPGRVYRCD-SDLTHTPMFHQVEGLLVDERITFTDLMGTLDEFLRAFFEDDLKTRYRPSYFPFTEPSAEVDMQCVMCGGEGCRVCSHSGWIEVLGCGMVHPEVFRHTGIDNEQFTGYAFGMGVERLSMLRYGINDLRLFFENDLRFLKQFN.. 340
217 0.000e+00gi|511293027|ref|WP_016353107.1| phenylalanine--tRNA ligase subunit alpha [Spiribacter salinus]  clstr ali  53  1MSEDLQALTGQAEAAVDTAASVAELEEIRVAYLGKKGRLTEQLKALGQLPAEERPAVGQAINAAKQRVTERLDARRAALAHAELDAALESERVDVTLPGRGDAAGGLHPITRTLERIEGMFRGIGFATAEGPEIEDDHHNFEALNIPADHPARAMHDTFYFDARHLLRTHTSPVQIRVMESDGA--PVRVIAPGRVYRCD-SDLTHTPMFHQVEGLLVDEGVTFGDLKALLDDFVKQFFEADLAVRFRPSYFPFTEPSAEVDVECMFCHGDGCRVCSGSGWLEILGCGMVHPAVFEAVGIDAERYTGYAFGMGVERLAMLRYGVNDLRIFFENDLRFLRQFR.. 339
218 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  60  33LQAQLEELKSSTQAKLAEMNNAKELQELRVQVLGKKGSLTELLKGLKDLSKEMRPVVGKQVNEVRDVLTKAFEEQAKIVEAAKIQAQLESESLDVTLPGRQVNLGNRHVLTQTSEEIEDIFLGMGFQVVDGYEVESDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTLDKHDSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGENISMGDLKGTLEMIIKKMFGEDRKIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVCKKTGWIEILGAGMVHPRVLEMSGVDSEKYSGFAFGLGQERIAMLRYGINDIRGFYQGDVRFSEQFK.. 377
219 0.000e+00gi|300495014|gb|EFK30170.1| phenylalanine--tRNA ligase, alpha subunit [Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437]  clstr ali  60  19LQDRLTELRDQGLADIKSADVLKKVNQVKVDLLGKKGPITEVLRGMRDLSPEERPKVGAYANEVRDRIQAAIDERREELEQAAVNEQLAAEKLDVTLPGREVPQGQPHVITQIITELEDLFMGMGYQIVDGDEVEEDYYNFERLNLPKDHPARDMQDTFYITKDVLLRTQTSADQPRSLENHDSKGPLKVLSPGRVYRRDTDDATHSHQFHQIEGLVVDKHITMADLKGTLILVAKTLFGDQFDVRLRPSFFPFTEPSVEADVTCFNCNGKGCAICKQTGWIEVLGAGMVHPHVLEMSGIDPEEYGGFAFGLGPDRFAMLKYGVDDIRNFYLNDVRFLSQF... 360
220 0.000e+00gi|953548042|ref|WP_058021726.1| phenylalanine--tRNA ligase subunit alpha [Pseudohongiella spirulinae]  clstr ali  52  1MTET-DTLLQTALQAVHGSTDERALDQLRVDYLGKKGRLTELLKGLGGLPADERPAAGERINQAKRQVQQAIEERRQILVEQALAEQLAAETVDVTLPGRRQSEGGLHPVSRTIERIQQLFQSAGYSVAEGPEIEDDYHNFEALNIPGHHPARAMHDTFYVEGSWVLRTHTSPVQVRVMEQ--GEPPFRMICPGRVYRCD-SDLTHTPMFHQVEGLLIDEDVSFSDLKGTLEEFLRAFFEADLAVRFRPSYFPFTEPSAEVDMSCVMCEGKGCRVCKQTGWLEVLGCGMVHPRVLEMSGIDSERYRGFAFGMGVERLAMLRYGVNDLRLFFENDLKFLRQFN.. 346
221 0.000e+00 GL0045161 [Lack 3`-end] locus=scaffold59361_3:1:1041:-  ali  55  1MEKIVEEIKKELEEDLKKISSMNELNDLKVKYLGKKGKITLLTKDMGNRSVEERKEIGRYSNELKSHVASSISQLEQELSQKELEAKLENDRIDPTLPGTAVKVGGVHPLTKVTEEIEDLFVSMGYDVVSGPEVELDLYNFEMLNLPKGHPARDAQDSFYIAEDTLLRSQTSPVQVRTMLKNKEKTEIRIICPGKVYQRDDDDATHSHQFTQIEGLVVGKNISLADLKGTLEIFAKKLFGEDREIRFRPSYFPFTEPSYEVDISCFRCGGKGCNICKNTGWIEILGSGMVHPNVLQMAGYDPKEYTGFAFGIGVERVAMLRYGVNDIRSFYTNDLRFLETYNRV 344
222 0.000e+00gi|499947779|ref|WP_011628513.1| phenylalanine--tRNA ligase subunit alpha [Alkalilimnicola ehrlichii]  clstr ali  53  8...QLEAMLAEAEQAVDQAENPTALDAVRVAYLGKKGRLTEALKGLGKLPAEERPQAGQAINAAKKQLQTRLEARKAILEARAMEQALEAERLDVTLPGRGQHPGGLHPVTRTLERIEQLFAAAGFQVAEGPEVEDDYHNFEALNIPEHHPARAMHDTFYFDAHHLLRTHTSPVQVRVMEKEGA--PLRVIAPGRVYRCD-SDLTHTPMFHQVEGLLVDEGVGFADLKGVLYDFLQAFFERDLEVRFRPSYFPFTEPSAEVDVQCVNCGGTGCRVCGGTGWLEVLGCGVVHPRVFEHSHIDPEHWTGYAFGMGVERLAMLRYGVNDLRLFFENDLRFLAQFR.. 343
223 0.000e+00gi|748168630|ref|WP_039742199.1| phenylalanine--tRNA ligase subunit alpha [Geobacter pickeringii]  clstr ali  54  1MKEQLDQLLQSALQEIAGTKSEDALQELRIKYLGKKGALTALMKGLGTLPAEERPAVGQIVNTVKMQLEARLDDALACVREAAKKERLETERLDVTLPGRRVGRGTKHPVSLVIEEVSEIFAGLGFQVAEGPEIELDFYNFEALNFPKDHPARDMQDTFFVDDNILLRTHTSPVQVRTMLKHA--PPVRIISPGTVYRCD-SDATHSPMFHQVEGLMVDNGVTFGDLKGILTTFVNQYFGKGTGVRLRPSFFPFTEPSAEVDIACVMCRGAGCRICKQSGWLEILGAGMIDPEVYRHVGYDSESISGFAFGMGVERIAMLKYGIGDMRLLFENDVRFLLQF... 338
224 0.000e+00gi|409105426|gb|AFV11551.1| phenylalanyl-tRNA synthetase subunit alpha [Thermacetogenium phaeum DSM 12270]  clstr ali  58  17LKEEILRIKENALRELETAGKREELQDLKVKYLGKKGLLTKVLRGMGSVPADLRPSLGHLANEVRQLLEERLEEKLSAILEQEKKERLVNEAIDVTLPGRPVRRGHRHPLTLILCEIKEIFIAMGFEVAEGPEVETDYYNFEALNIPKGHPARDMQDSFYIGPEILLRTHTSPVQIRTMKRMVPDLPVRIIAPGKVYRRD-DDATHSPMFHQVEGLLVDRQCTLGDLKGVLLTFARQMFGRDREIRLRPSFFPFTEPSAEVDISCISCKGSGCRVCSGTGWLEILGCGMVHPNVLVNSGYDPEEVTGFAFGMGVERIAMLKYGINDLRLFFENDVRFIRQFGG. 358
225 0.000e+00gi|503097468|ref|WP_013332274.1| phenylalanine--tRNA ligase subunit alpha [Halomonas elongata]  clstr ali  52  2..DHLPTLVAEARDAIQAAESMAALDELRVRYLGKKGEITALLKGLGQLPAEERPAAGERINQAKQALSADLEERKQALEKADLEARLAAETLDVTLPGRGQPSGGLHPVTRTLERIEGLFTHVGFDVAVGPEIEDDYHNFEALNIPAHHPARGMADTFYFDATRLLRTHTSPVQVRTMKS--TEPPIRIVCPGRVYRSD-SDLTHTPMFHQVEGLLVDEDVRFSDLKGTIQDFLHAFFEDDLAVRFRPSYFPFTEPSAEVDIQCVMCDGAGCRVCSHSGWLEVMGCGMVHPEVFRHSGIDSERYTGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLQQF... 338
226 0.000e+00gi|227840797|gb|EEJ51167.1| phenylalanine--tRNA ligase, alpha subunit [Oribacterium sinus F0268]  clstr ali  55  12....LQEIVKRAEEQIAGSKDLTALNDIRVQFLGKKGELTEAKKLLKDLSPEERPKFGQLVNEMFQKVEQSIKSHGEALERSLREAKMQEETIDITLPAKKVRYGHPHPNTLALEEVEKIFIGMGYEVVEGPEVEYDSYNFEKLNIPKGHPARDEQDTFYINSNILLRTQTSSVQARYMETH--KPPIRMICPGRVFRSDAVDATHSPSFHQIEGLVIDKNIHFSDLKGTLDLFAKELFGQDTKTKLRPHHFPFTEPSAEVDVSCFKCKGKGCRFCKGEGWIEILGCGMVHPKVLESCGIDSKEYSGFAFGVGLERIALLKYEIDDMRLLYENDLRFLEQF... 346
227 0.000e+00gi|493354401|ref|WP_006311027.1| phenylalanine--tRNA ligase subunit alpha [Caldisalinibacter kiritimatiensis]  clstr ali  52  1MKEKLLQIKENALKELSASSSLDEIEQIRIKYLGKKGELTQVLRSMGKLSKEERPIVGKMANEVRGVIQKELEEVKERIKTDIKKSKLKEERIDITMPARERKLGHRHPLHKVMEELEDIFMSMGFSVIQGPEIETVYNNFDALNSPENHPSRDLSDTFYITENILLRTHTSPVQIRAMKQME--PPLRIVSAGRTFRFDDVDDTHSPMFHQLEGLVVDKNVTMANLKHTIDMFVKQLFGEEMKTRFRPHYFPFTEPSAEVDVSCFKCKGEGCEVCNGTGWMEILGCGMVHPKVLKNCGIDPDEYSGFAFGLGVDRIAMVKYGINDIRLLFENDMRFLEQF... 340
228 0.000e+00gi|321141820|gb|EFX37315.1| phenylalanine--tRNA ligase, alpha subunit [Streptococcus infantis ATCC 700779]  clstr ali  60  52.EEQLKALREETLASLKQAENEKELQELRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDILTAAFEESAKLLEEKKVEAQLASESIDVTLPGRPVATGHRHILTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTEPSVEVDVSCFKCGGAGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQERVAMLRYGINDIRGFYQGDVRFSEQFK.. 395
229 0.000e+00 GL0058959 [Complete] locus=scaffold11468_3:1107:2126:-  ali  52  1MKEKIEQIRQQALAAIEDAAGIDKLNDVKVAFLGKKGQLSSLLKGMKDVAPEDRPKVGQMVNEARAGIEAKMEEKRTAIQKKLREEKMKKEVIDVTLPGKKVAVGHRHPNQIALDDLERVFIGMGYEVVEGPEVEYDHYNFELLNIPANHPAKDEQDTFYITKDILLRTQTSPVQARIMET--GRMPIRVIAPGRVFRSDEVDATHSPSFHQVEGLVVDKGITFADLKGTLQQWAEEFFGPDTKVKFRPHHFPFTEPSAGVDVSCFKCGGKGCRMCKGSGWIEILGCGMVHPKVLSDCGIDPEVYSGFAFGIGLERVTLLKYEIDDMRLLYENDARFLKQF... 339
230 0.000e+00gi|953313102|ref|WP_057973402.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus algidus]  clstr ali  59  3LKEKLLELQEKGLKQIRESEDLKQINDIRVNLLGKKGPITEVLRGMKDLSAEERPKIGSFSNAIKNELAEAIRLKNEELEIKKTAKKLEKEKIDVTLPGAQIQLGQPHVIAQVIEELEDLFLGMGYQVVSGPEIEEDHYNFEMLNLPADHPARDMQDTFYITKELLMRTQTSPVQARTMETHDSKGPLKMVSPGKVYRRDTDDATHSHQFHQFEGLVIDKHVTMADLKGTIELIAKTVFGEEQEIRLRPSYFPFTEPSVEVDVTCFKCHGKGCSICKYTGWLEVLGAGMVHPNVLRMAGVDPEVYGGFAFGLGPDRFAMLKYSIDDIRNFYLNDNRFLSQFTK. 346
231 0.000e+00gi|229792543|gb|EEP28657.1| phenylalanine--tRNA ligase, alpha subunit [Shuttleworthia satelles DSM 14600]  clstr ali  55  59..EKLEEIRRRTLENIARAGNLEELNEVRLTVLGKRGELKELMKGMRELSAEERPKFGQLVNDVRQMVEQELADRKSKMEEELLNRKLASETIDVTLPAKKIKLGHRHPNTRVLDEVERIFIGMGYEVVEGPEIEYDYYNFEALNIPANHPAKDEQDTFYINKDILLRTQTSPVQVRVMEK--GKLPIRMIAPGRVFRADEVDATHSPSFHQIEGMVIDKNITMADLKGTLLEFAHKMFGENVRLKFRPHHFPFTEPSAEVDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPDVLRMSGIDPEEYQGFAFGVGLERISLLKYEIDDMRLLYENDDRFLSQF... 395
232 0.000e+00gi|918061805|ref|WP_052327277.1| phenylalanine--tRNA ligase subunit alpha [Nosocomiicoccus massiliensis]  clstr ali  61  1....MQAIKEKFESLFEDAADRKQLDDLRVKFLGKKGTVTTLMQHMKDIPNEEKKEFGQSVNALRQSIQQKLEQGIEELEARLLKKKLENETIDVTLPGRQRPIGGKHPLQHIIDGIEDIFVGLGYEVYEGYEVESDYYNFEALNLPKSHPARDMQDSFYISNETLLRTHTSPVQARVLNAAKGKGPIKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNISLADLKGTLELFLKEIFGQDREIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVCKQSGWIEILGAGMVHPNVLEMAGFDSNEYSGFAFGMGPDRMAMLYYGVEDIRHLYTNDLRFLEQFK.. 338
233 0.000e+00gi|219569897|dbj|BAH07881.1| hypothetical protein [Clostridium kluyveri NBRC 12016]  clstr ali  54  12MRKKLEQIKENAFKELQDKRKDLDIESIRIKYLGKKGELTHILRGMKELSKEERPIIGKLANDIRTALENAIEEASQRIKSSERESRVKGETIDITMPGIKQNIGRRHPLEQVLEDMKEIFVSMGFTIEEGPEVELDYYNFEALNIPKNHPARGEQDTFYINDNLVLRTQTSPTQIRTMEKQ--KPPIKMISPGKVYRSDSVDATHSPIFYQMEGLVVDKGITFADLKGTLELFARKMFGDEMKTKFRPHHFPFTEPSAEMDATCFVCNGEGCRVCKGEGWIELLGCGMVHPQVLRNCNIDPEVYSGFAFGMGVDRMVMLKYGIDDIRNMYESDMRFLNQF... 350
234 0.000e+00gi|985405126|gb|KXA67143.1| phenylalanine--tRNA ligase, alpha subunit [Megasphaera sp. MJR8396C]  clstr ali  54  13..EKIEAIKTAVMEELAKSEHLQDIQDIRVKFLGKKGELTAIMKEMKNFSKEDRPKIGQLVNTARNAIEEQLTAKLEEVKAKELAAKIESEKIDITLPGRKPATGHEHPLHQTLRLMEDSFLRMGFSIVEGTDIESDYYNFQCLNLPEDHPARDMQDSMYITDNILLRTHTSGMQARTLQSHKPNEPFKIIAPGKVYRCD-YDATHSPVFHQMEGMIIDKNIRFSDLKGMLEDFLRDIFGEDTKVRFRASYFPFTEPSAEVDISCVMCGGEGCRVCSHTGWLEILGCGMVNPNVLRLNGYDPDVVTGFAFGMGVERIAMLKYGIDDLRLFYENDMRFLNQF... 350
235 0.000e+00gi|1004128994|gb|KXZ39339.1| Phenylalanyl-tRNA synthetase alpha chain [[Clostridium] paradoxum JW-YL-7 = DSM 7308]  clstr ali  55  1MKEQLLSIKENALLEINQCTKIEDIENVRVKYLGKKGEITNILKGMGKLSQDERPIIGKIVNTVREELEESIRIKKDHIKENEKYEKLRLETIDVTMPSRKRSIGKKHPITQIMDELKYIFTGMGFKVAEGPEIETVYNNFDALNAPKNHPSREMSDTFYINENLLLRTQTSPVQIRAMKAM--PLPIKIISPGRCFRFDAPDATHSPMFHQLEGLVIDKDINMTHLKGTLDAFVKQFFGESTKTKFRPHNFPFTEPSAEVDVTCFKCKGTGCSMCKGEGWIEILGAGMVHPNVLRNCGIDPNEYSGFAFGMGIDRIAMLKYEIDDIRLLFENDMRFLNQF... 339
236 0.000e+00gi|500041127|ref|WP_011721845.1| MULTISPECIES: phenylalanine--tRNA ligase subunit alpha [Clostridium]  clstr ali  54  1MKEKLQQIKNTALEELNKISNKAELENIRVKYLGKKGELTQILRGMGKLSSQERPVIGKLANEVRGSIEELIEKAVTEIKLKEKEAKLKNEVIDISMPGRKQTVGRKNPLQLTLDSIMDIFISMGFSIEEGPEVEKDYYNFEALNIPKNHPARGEQDTFYINDDVVLRTQTSPIQVRTMENQ--KPPIKMIAPGKVYRSDSVDATHSPIFYQIEGLVIDKGITFADLKGTLELFTKKMFGEKMQTKFRPHHFPFTEPSAEMDATCFVCGGKGCNVCKNSGWIELLGCGMVHPDVLRNCGIDPEVYSGFAFGFGLDRMVMQKYELDDIRLLYESDMRFLNQF... 339
237 0.000e+00gi|654087955|ref|WP_027714201.1| phenylalanine--tRNA ligase subunit alpha [Desulfuromonas sp. TF]  clstr ali  55  1MKDRLEEMSRTATAAMAQTDSEAALQEVRVRFLGKKGELTGLMKGMGQLSAEERPVIGALANRVKEELENLFDSRLAVVREAEISRRLARERIDITLPGRRVFAGSKHPITLVTEEVVEIFAALGFGVAEGPEVEKDFYNFEALNIPKDHPARDMQDTFYITEDVVLRTHTSPVQIRTMLRHA--PPVRVIAPGTVYRRD-SDLTHSPMFHQVEGFLVDKHVTFGDLKGILTAFVTQFFSEKVGIRFRPSFFPFTEPSAEVDIQCVICGGTGCRVCKQSGWLEILGSGMIDPEVFKSVNYDPEVYSGFAFGVGLERLAMLKYGVSDLRLFFENDLRFLRQF... 338
238 0.000e+00gi|1015517882|gb|AMV72199.1| phenylalanyl-tRNA ligase subunit alpha [Desulfuromonas sp. DDH964]  clstr ali  55  1MKDRLIAMLAAGRAALEQAVNETELQDAKVRFLGKKGELTGIMKGMGALSAEERPVIGALANQVKDELEGLFETRAVQLRQAEIARRLERERIDVTLPGRTRPLGSKHPISLVTEEICAIFAGLGFGIAEGPEIEKDFYNFEALNFPKDHPARDMQDTFFVSDDVLLRTHTSPVQIRTMLQQA--PPLRIIAPGTVYRRD-SDITHSPMFHQVEGFLVDQNITFGDLKGVLSAFVSQYFGKEIGVRFRPSFFPFTEPSAEVDIQCVNCGGKGCRVCKNSGWLEILGSGMIDPEVFRAVQYDPERFSGFAFGMGVERIAMLKYGVNDLRLFFENDVRFLQQF... 338
239 0.000e+00gi|389311355|gb|EIM56288.1| phenylalanyl-tRNA synthetase, alpha subunit [ [[Eubacterium] cellulosolvens 6]  clstr ali  52  6.KEKLEGIVSKALNSLEIVSTPDALNEIRVNVLGKKGELKELMKSMKDVAPEDRPKVGQLVNEARDQITEKLEAAKQKIEMQQMELKMAAETIDVTLPAKKNVIGHRHPNTIALEELERIFVGMGYEVIEGPEVEWDEYNFTKLNIPPNHPAKDEQDTFYINKDIVLRTQTSPVQARRME--EGNLPIRMISPGRVFRSDEVDATHSPSFHQVEGLVIDKNITFADLKGTLEMFAKQIFGEETKTKFRPHHFPFTEPSAEMDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPHVLEMCGIDPEEYNGFAFGVGLERIALLKYEIDDMRLLYENDERFLKQF... 343
240 0.000e+00 GL0056543 [Complete] locus=scaffold7169_2:599:1666:-  ali  61  12.EEQLKALREETLAALKQAENEKELQELRVSVLGKKGSLTEILKGMKDVSAEMRPVIGKHVNEARDVLTAAFEETTKLLEEKKVQAKLASESIDVTLPGRPVASGYRHILTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGAERQIRLRPSYFPFTEPSVEVDVSCFKCGGAGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDPTVYSGFAFGLGQERVAMLRYGINDIRGFYQGDVRFSEQFK.. 355
241 0.000e+00gi|499660417|ref|WP_011341151.1| phenylalanine--tRNA ligase subunit alpha [Pelobacter carbinolicus]  clstr ali  53  1MRDKLVAMLELGRKAFESADSAVELQEIRVRFLGKKGELTAIMKGMGQLTPEQRPVVGALANQVKSELEELFEERSRIVGQQEMDKRLKQERVDVTLPGRRNSCGTKHPVTLVIEEITDIFSALGFSVAEGPEIEQDFYNFEALNMPKDHPARDMQDTFYINEDVVLRTHTSPVQIRTMLKHA--PPVRVIAPGTVYRRD-SDITHTPMFHQVEGFLVDRNITFGDLKGILTSFLSQIFGKGLNVRFRPSFFPFTEPSAEVDIQCVMCKGKGCRVCKNSGWLEILGSGMIDPEVFKSVDYDSETYSGFAFGMGVERIAMLKYGVNDLRLFFENDVRFLRQF... 338
242 0.000e+00gi|503303292|ref|WP_013537953.1| phenylalanine--tRNA ligase subunit alpha [Thermovibrio ammonificans]  clstr ali  53  7....IEELKLEFTNKIKSVSTLEDLEKLRVEFIGRKGKVTELLKQIPKLPPEERKEFGRACNALKAEIERAVKEKGAQIKEALKRERLKKEEIDVTLPGRKRPVGALHPVTKTLKEIVRIFTSMGFAVAEGPEVETDFYNFEALNIPKGHPAREMQDTFYITDEVVLRTHTSPVQVRVMESQ--RPPIQIIAPGKVYRKDA-DVTHTPMFHQVEGLMVDERVTFADLKGVLELFLREIFGSDTKVRFRPSYFPFTEPSAEVDIGCVICGGKGCKVCKGTGWLEILGCGMVDPAVFKAVGINPDTYQGFAFGMGVERIAMLKYGIDDLRLFFENDLRFLRQFRGA 343
243 0.000e+00gi|524784641|emb|CDE78406.1| phenylalanine--tRNA ligase alpha subunit [Ruminococcus sp. CAG:353]  clstr ali  54  1MKQQLEQILASAQKELSECGDLKVMEELRVKFLGKKGELTAILKQMGGLSAEERPVIGQLANKVRSEIEAKITEKAEALKSEAAANKMAAETIDVTLPGKAPEIGRLHPLTAVLEEVKEIFLGMGFDIVDGPEVETDHYCFEALNMPKHHPARDTQDTFYINDNVVLRTQTSGVQIRTMEQR--KPPIRIISPGRVYRSDAVDATHSPLFHQIEGLVIDKGVTLGDLYGTLDLLMKKLYGKDAKIRLRPHHFPYTEPSAEVDLVCFNCGGKGCSMCKGEGYVELLGSGMVHPKVLRGCGIDPEVYSGFAFGIGLERITMGRYNINDMRMLYENDMRFLSQF... 339
244 0.000e+00gi|645064002|ref|WP_025435210.1| phenylalanine--tRNA ligase subunit alpha [Eubacterium acidaminophilum]  clstr ali  56  1MKEKLLALKEELASSIKGCVSIEEVESIRINALGKKGEITAVLKGMKDLSDEERPLIGKIANEVREELEELISAKKGELKNAEKLVKLSAETLDVTMPSKQIRIGRRHPITQVFDELKYIFTGMGFKVAEGPEIETVHNNFDALNAPKNHPSRDMSDTFYFDENMLLRTQTSPVQVRTM--QVMKPPIRIISPGRCFRSDTPDATHSPMFHQLEGLVVDKNVTMAELKGTLQAFAELFFGPGTKIKFRPHNFPFTEPSAEVDVTCFKCGGKGCSMCKGEGWIEILGAGMVHPNVLRNCGIDPEEYSGFAFGMGVDRATMLKYEIDDIRLLFENDMRFLNQF... 339
245 0.000e+00gi|655057076|ref|WP_028505453.1| phenylalanine--tRNA ligase subunit alpha [Ruminococcus sp. FC2018]  clstr ali  56  1MKEQLRSIEERAKAELKEISDAKVLEEFRVKYLGKKGEITGILKQMGKLSAEERPAMGQLANKVRADIETALSARVSELKSAAEQVRLKNETLDVTLPGKAPAIGRPHPLDAVLADVEEVFLGMGFEIVEGPEVETDHYCFEALNMPPHHPARDTQDTFYISDSVLLRTQTSSVQIRTMEKM--KPPIRIISPGRVYRSDAVDATHSPLFHQIEGLVIDKGVTMGDLKGTLELLMKRLYGDEAKIRLRPHHFPYTEPSAEVDMMCFNCHGEGCSMCKQEGWVELLGAGMVHPKVLEGCGIDPNVYSGFAFGIGLERITMGRYNINDMRLLYENDMRFLEQF... 339
246 0.000e+00gi|652827857|ref|WP_027113454.1| phenylalanine--tRNA ligase subunit alpha [Lachnospiraceae bacterium NK4A144]  clstr ali  53  1MKEKLEEIREKALSQISESVDLDRLNDVRVEVLGKKGSLTAVLKGMRDVAAEDRPKVGQMVNELRTEIENAMEEAKTRLESAAREVQLAAETIDVTLPAKGSAIGHRHPNQIALEEMERIFIGLGYEVVEGPEVEKDYYNFEALNIPADHPAKDEQDTFYINGEMLLRTQTSGTQVHEMEK--GRIPIRMISPGRVYRADEVDATHSPVFHQVEGLVIDENVSFADLKGTLAEFAKELFGEDTKVKFRPHHFPFTEPSAEMDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPHVLEMSHIDPLKYKGFAFGVGLERIALLKYEIDDMRLMYENDIRFLKQF... 339
247 0.000e+00gi|939715677|ref|WP_054948875.1| phenylalanine--tRNA ligase subunit alpha [bacterium mt3]  clstr ali  60  1MRERLLALKDKALEAVQRISTTKELSDLSVKYLGKKGDLTQLMRQIGKLAPEERPAMGQHVNDVRRAMEQAFATREAELKERALAEQLAKEEIDVTLPGRAFDLGSIHPLTGIIEQIEDIFIGMGFEVADGPLVEWDYYNFEAMNMPKHHPARDMQDTFYITEDILLRTHTSAVQARVMESRKGEVPVKIICPGFVFRRDDDDATHSHMFTQIEGLVVDEGVSMSHLNGVLETFVHKMYGEERRVRFRPSFFSFVEPGTEVDVSCANCGGEGCRICKHTGWLEILGAGMVHPRVLEMCGYDAEKYTGFAFGMGIERVAMLKYGIDNIRDYFNSDLRFLRQFS.. 342
248 0.000e+00gi|737672025|ref|WP_035641379.1| phenylalanine--tRNA ligase subunit alpha [Lachnospiraceae bacterium FE2018]  clstr ali  53  5LRKKLSQVVEKTVSNLQSAGNLETLNEIRVGVLGKKGELKQLMKGMKDIPAEERPRFGQLVNEARDKIEENIDFVKKNLEKAAMEAKIASESIDVTLPARRPEIGHRHPNTIALEEVQRIFVGMGYEVVEGPEIEYDEYNFEKLNIPANHPAKDEQDTFYINKEILLRTQTSPIQARVMEQ--GKLPIRMIAPGRVFRSDEVDATHSPSFHQIEGLVVDKHITLSDLKGTLAEFAKELFGPETKTKFRPHHFPFTEPSAEMDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPHVFEMCGIDPEEYTGFAFGVGLERIALLKYEIDDMRLLYENDIRFLRQF... 343
249 0.000e+00gi|833816207|gb|KLU41006.1| hypothetical protein AA931_02165 [Peptococcaceae bacterium 1109]  clstr ali  57  1MQEKLAEIRAQALDSAKQAATVQELTNAKVRFLGKKGELTQLLRSMGQLPPEERPVFGKLVNEVRDELEEAWAXXXXXXXXXXXXXXXAGEALDWTLPGRKPLRGTLHPITQVINEAKAIFTGMGYEVVEGPEVEWDYYNFEALNIPPDHPARDMQDTFFFSEQLLLRSQTSSVQIRTMEHR--KPPVRIIAPGKVYRADA-DVTHSPMFHQIEGLVVDEGITFADLKGTLQLFIERMFGPEAKARFRPSYFPFTEPSAEVDISCIICGGTGCRVCKDTGWLEILGCGMVDPRVLKIVNYDPDVVSGFAFGMGVERIAMLRYGINDIRLLFENDVRFLKQFAR. 340
250 0.000e+00 GL0022748 [Complete] locus=scaffold1886_4:4097:5140:+  ali  56  1MKEKLETIKKQAKERIEEIKDLQALNELKVKILGKKGELTEILRGMKDLSPEERPIIGSLVNTVRDEIEGTIKSAEELLKQKELEEKLNKEKIDITLPSSKIKRGSKHPINRTIEQIQDLFVSMGYDVVDGPELETDEFCFERLNLPKGHPARDMQDSFYITNEYLLRTQTSAVQARTMLANEEKSPIRIICTGKTYRR-EDDATHSHQFNQVEGLVIDKNVSLADLKGTLEVFVKEMLGDNLALRFRPSYFPFTEPSYEVDVTCFKCGGKGCNLCKQTGWIEILGCGIVHPNVLKMNGYDPEKYAGFAFGTGIDRLAMFKYGITDMRYLYQNDVRFLKQFDR. 345
251 0.000e+00gi|1000062817|gb|KXJ40196.1| phenylalanine--tRNA ligase subunit alpha [Methylothermaceae bacteria B42]  clstr ali  51  1MTDSVEALLAQAENDLESAKDLQSLDQVRVRYLGKKGLFTQRMKALGNLPPEQRPQVGKVVNEARQKFQQALETRQLALQQAQLSERLAAESIDVTLPGRGQRAEGLHPVTLTMRRIEKIFASVGFQVAEGPEIEDDYHNFEALNIPAHHPARAMHDTFYIDEHTLLRTHTSPVQIRVMEA--GSPPFKIIAPGRVYRCD-SDLTHTPMFHQVEGFLVDEGVSFAHLRGILDEFLRNFFEQDVEVRFRPSYFPFTEPSAEVDIACVMCQGKGCRVCGQSGWLEVMGCGMIHPSVFEFVKIDPQRYSGFAFGLGVERLAMLRYGINDLRLFFENDLRFLEQFH.. 339
252 0.000e+00gi|491800430|ref|WP_005606773.1| phenylalanine--tRNA ligase subunit alpha [Granulicatella adiacens]  clstr ali  60  6MKVQFDAIRKDVLASLEEVKTLKELDQIRVQQLGKKGPITEVLKNIKNLANEEKPKVGALANELRSFLEEKIASVKEVLEAKALEEALQSETIDVTMPGRPVERGTAHVLAHVQDQVEDFFIGLGYQVVEGPEVESDHYNFEMMNLPKDHPARDMQDTFYITPEYLLRTQTSPVQARTMEKHDTKGPLKMLSPGRVFRRDNDDATHSHQFYQIEGLVIDKHITMSDLKGTLAAFAKEMFGEDREVRLRPSYFPFTEPSLEVDISCFKCGGEGCSVCKGTGWIEVLGSGMVHPNVLEAAGVDSSVYGGFAFGLGQDRIAMLKYGIEDIRSLYTNDVRFLSQFTK. 349
253 0.000e+00gi|657648582|ref|WP_029453030.1| phenylalanine--tRNA ligase subunit alpha [Clostridium algidicarnis]  clstr ali  53  1MKENLKLIKERAIEELKKVNSTNDIESIKIKYLGKKGELTGILRGMGGLPNEERPIIGKLANEVRESIELYINNVAKNIKETERLEKLSEETIDISLPGKKQIIGKRHPLDLTLESMKEIFMSMGFSIEEGPEVELDYYNFEALNIPKNHPARSEQDTFYINEKVVLRTQTSPVQVRVMENQ--KPPIKMISPGKVYRSDAVDATHSPIFYQMEGLVIDKGVTFADLKGTLDIFAKKMFGSNVKTKFRPHHFPFTEPSAEMDATCFVCEGKGCNVCKNSGWIELLGGGMVHPDVLRNCGIDPEVYSGFAFGFGVDRMVMLKYGIDDIRLLYESDIRFLKEF... 339
254 0.000e+00gi|490988047|ref|WP_004849780.1| phenylalanine--tRNA ligase subunit alpha [Coprococcus eutactus]  clstr ali  53  1MKDKLEAIKAEALAKIESAEVVSTLNDVKVAILGKKGELTQVLKSMKDVAPEDRPKVGQMVNEARQAIETALDEKTKSINRALRAEKMKRETIDVTLPGVKKLTGHRHPNQIALEDLERVFIGMGYEIVEGPEVEYDKYNFELLNIPANHPAKDEQDTFYVTKDILLRTQTSPVQARIMEK--GNLPIRILSPGRVFRADEVDATHSPSFHQVEGLVIDKGITMADLKGTLAQWAKEFFGENTKVKFRPHHFPFTEPSAECDITCFKCGGKGCRVCKGSGWIEILGCGMVHPKVLRDCGIDPEVYSGFAFGIGLERVTLLKYEIDDMRLLYENDMRFLDQF... 339
255 0.000e+00gi|984725342|gb|AMB98900.1| phenylalanine--tRNA ligase subunit alpha [Aerococcus urinaehominis]  clstr ali  57  6...NLQEIEAELYQKIDQAESLADIKTIRIEYLGKKGPITQALREMKNISNEDRPKVGTYANNMKQKVGQLLDEKEAKLEAAALDEQLAAEALDVTLPGEPDKIGTPHIISQVMTEIEDLFLSLGYEVITGPEVESDYYNFERMNLPQNHPARDMQDTFYINDEILLRTHTSPVQARTMDQHDSQGPLKMISPGKVYRRDDDDATHSHQFHQIEGLVVGENITLADLKGTLEVFAKHVFGEDREIRLRPSYFPFTEPSVEIDISCFKCGGQGCNICKQTGWIEILGGGLVHPNVLEMSGLDSKKYTGFAFGLGPDRVAMLKYGVDDIRHFYQNDLRFLKQFS.. 345
256 0.000e+00gi|522164645|ref|WP_020675853.1| phenylalanine--tRNA ligase subunit alpha [Geopsychrobacter electrodiphilus]  clstr ali  55  1MKDQLLDLENDALAVIAGAESMIALQDIRIRYLGKKGAVTDVMKGMRELDPEERPVLGALVNRLKETLEEAFGERSKLLRQTEVANRLASEKIDVTLPGRQSFSGSKHPVTLVTEEIVDIFSSLGFCVEEGPEIEQDFYNFEALNIPKDHPARDMQDTFYVSDDVVLRTHTSPVQVRTMLKQ--KPPVRVIAPGTVYRRD-SDITHSPMFHQIEGFLVDEHVTFGDLKGILTHFLTSYFGKDLGVRFRPSFFPFTEPSAEVDIACVMCGGKGCRVCKGTGWLEILGCGMIDPEVFKSVHYDAEKVSGFAFGMGLERIAMLKYGVSDLRLFFENDLRFLRQF... 338
257 0.000e+00gi|974234026|gb|KUO73992.1| phenylalanine--tRNA ligase subunit alpha [Clostridia bacterium BRH_c25]  clstr ali  56  1MKETLEKIKLQSVKELESVQSQKQLEELRIKYLGKKGELTQVLRGMGGLTPEERPVIGQFANEIRDYINERIEETAYCLKRKDMETRLRSEFIDVTMPSKRKALGNKHPLTKVQDEINQIFIGMGFTIVEGPEIETAYYNFDALNHSKYHPARDIQDTFYVNDEILLRTQTSPMQVRTMEQQ--KPPIRVLVPGKVYRRDEIDATHSPMFHQIEGLVVDKGITMANLKGTLDVFAKRLYGENTRTRFRPHHFPFTEPSAEMDCTCAACKGAGCRVCKNEGWIEILGAGMVHPNVLRNCGIDPEVYSGFAFGMGLDRITLLKYDVEDLRLFFENDKRFLAQF... 339
258 0.000e+00gi|780902252|gb|KJS70213.1| phenylalanine--tRNA ligase [Desulfotomaculum sp. BICA1-6]  clstr ali  57  1MEEKLKNLLLDASQALSSATDLDQLNEIRVRYLGKKGILTGVLRGMGALSAEERPRIGQLANEVREKLEDVLNSRTYKIKNRVKEARLEQEKIDVTLPGTAFMTGSRHPLAVIQEEMEDIFLWMGYAIEVGPEIELDYYNFEALNFPAEHPARDMQDSFFTAPGVLLRTHTSPVQVRTMERTNPALPVRIIAPGRVYRRD-DDATHSPMFNQVEGLVIDKRVTFGDLKGTLRVFAEKMFGPETRTRFRPSFFPFTEPSAEMDISCTTCGGKGCRVCSHTGWLEILGCGMIHPRVLEAGGYNPEEVTGFAFGMGVERIAMLKYSLDDMRLLFDNDLRFLAQF... 340
259 0.000e+00gi|765289842|ref|WP_044617554.1| phenylalanine--tRNA ligase subunit alpha [Gynuella sunshinyii]  clstr ali  54  2..ENLEKLVSQAEIEINESNEVSALEQLRVQYLGKKGEITSLLKALGTLPPEERPAAGARINEAKEKVSNFINARRDKLETDVLNAQLNQETLDVTLPGRGQNIGGLHPVTRTIQRMEDFFGSIGYKVAEGPEIEDDYHNFEALNIPGHHPARAMHDTFYFDANTLLRTHTSPVQVREMEK--GKLPIRIICPGRVYRCD-SDLTHTPMFHQVEGLLVDEKVSFSDLKGTIQRFLQVFFEKDLGVRFRPSFFPFTEPSAEVDMECVMCNGKGCRVCSHTGWLEVMGCGMVHPNVLEASGVDSTRYQGFAFGMGVERLTMLRYGVNDLRIFFENDLNFLRQFS.. 338
260 0.000e+00gi|759390057|ref|WP_043115455.1| phenylalanine--tRNA ligase subunit alpha [Solemya velum gill symbiont]  clstr ali  52  1MSSELEQLLETAIAAVAEAMDLQALDAVRVSYLGKSGAFTEQLKQLGKLPKEERPAAGQVINQAKQALQQKIQEKKVQLETAGLQQRLEQERIDVTLPGRGQGTGGLHPVSRTMRRIETLFRSAGFDVAEGPEIEDDFHNFEALNIPEHHPARAMHDTFYFDEHLLLRTHTSPVQIRTMEN--AEPPLRVIAPGRVYRCD-SDLTHTPMFHQVEGFVVDKNVTFADLKGILHDFLVSFFEAELKVRFRPSYFPFTEPSAEADIECVICGGEGCRVCSHTGWLEVLGCGMIHPEVFRHVGIDNEEFTGYAFGMGVERLTMLRYGVNDLRLFFDNDLRFLEQF... 338
261 0.000e+00gi|498265558|ref|WP_010579714.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus vini]  clstr ali  58  3LQEKLQRLEQQALAEIKQTDNLEKINKIRVHLLGKKGPITEILRGMRDLPKEQRPQVGSFANAVRDELTAAIAKQKEQVELILNSKKLEREAIDVTLPGVPVKAGTPHIIMQVIDQIEKLFLGMGYQVVDGPEVEEDHYNFEMMNLPKDHPARDMQDTFYITDQILMRTQTSPVQARTMEKHDSQGPLKMISPGKVYRRDTDDATHSHQFHQVEGLVIDKHVTMADLKGTLEKIAQTVFGAKRQIRLRPSYFPFTEPSVEVDVSCFKCGGKGCQVCKQTGWIEVLGAGMVHPNVLKMAGVDPQIFGGFAFGLGPDRFAMLKYGVDDIRDFYLNDVRVLEQFSQ. 346
262 0.000e+00gi|928955076|ref|WP_053979755.1| phenylalanine--tRNA ligase subunit alpha [Marinagarivorans algicola]  clstr ali  53  2..ENLAELTTQALKLVAEANELAELDHIRVEYLGKKGQITAQLKSLGKLSAEERPAAGAKINDAKVQVQDAMNARKAALENAAINAQLAAETIDVTLPGREAERGSLHPVTHTLNRIEDIFVRAGYSVEQGPEVEDDFHNFEALNIPSHHPARAMHDTFYVDERHVLRTHTSPVQIRTMLKRSG--PLKVICPGRVYRCD-SDLTHTPMFHQVEGLVVDKDVSFADLKGVVSQFLRTFFEADVPVRFRPSYFPFTEPSAEMDIQCTHCQGEGCRVCKQTGWLEVGGCGMVHPNVFKACDINPEEVSGFAFGMGVERLAMLRYGIKDLRMFFENDLEFLQQF... 337
263 0.000e+00 GL0131249 [Lack 5`-end] locus=scaffold33693_4:2:1027:+  ali  51  3MKERLQEIRERALEQINSTDSLEKLNEVRVSILGKKGELTEVLKGMKDVEPKDRPMVGQIVNETRQAIEEVLENARKELSEKMREIQMKAEVIDVTLPAKKNNVGHSHPNTLALGEIKKIFVGMGYEVVEGPEVEYDYYNFEALNIPANHPAKDEQDTFYINDKIVLRTQTSSVQVREMEK--GKLPLRMISPGRVYRADEVDATHSPCFHQVEGLVIDENITFADLKGTLVEFAKEVFGPETKVKFRPHHFPFTEPSAEMDVSCFKCGGKGCRMCKGEGWIEILGCGMVHPHVLEMSGIDTDKYTGFAFGVGLERIALLKYEIDDMRLLYENDARFLKQF... 341
264 0.000e+00gi|648504788|ref|WP_026196539.1| phenylalanine--tRNA ligase subunit alpha [Fangia hongkongensis]  clstr ali  51  5.....EEIRSEALAEVEKTLNRQDLDQIRVQYLGKKGKLTAIMKELGKLPKEEKPKLGQAVNVAKDDLQSAINARLEAIDAKELSERLAKEKIDITLPGVGQVQGHIHPVSKTLQRIEQFFTEMGFSIEHGPEIEDDYHNFEALNIPSHHPARAMHDTFYFNPNSVLRTHTSGVQIRTMKKQA--PPIRMIAPGRVYRCD-SDMTHSPMFHQVEGLWVDEDVSFADLKGMLQAFLSAFFEKDLKMRFRPSYFPFTEPSAEADMECVMCNGKGCRVCKQTGWLEVLGCGMVHPNVLEAGGIDSKKYQGFAMGMGVERLAMLRYGISDLRLFFENDLRFLKQF... 337
265 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  54  1MKERLSQIRAEALKQITGSDSLEKLNEIRVNFLGKKGELTSVLKSLKDVAPEDRPKVGQLVNETRAEIESVLEEATQKMQRLARERKMEAERIDVTLPAKKNNVGHRHPNTMMLEEVERIFIGMGYEVVEGPEIEKDYYNFEALNIPADHPAKDEQDTFYISGDFLLRTQTSGCQVHEMEK--GRLPIRMIAPGRVFRADEVDATHSPSFHQIEGMVVDKNITFADLKGTLLQFAKELFGEDTRVKFRPHHFPFTEPSAEMDVSCFKCGGKGCRFCKGEGWIEILGCGMVHPNVLKMSGIDPNEYSGFAFGVGLERIALLKYEIDDMRLLYENDIRFLKQF... 340
266 0.000e+00gi|518850523|ref|WP_020006413.1| phenylalanine--tRNA ligase subunit alpha [Salinicoccus albus]  clstr ali  63  6....IDEIRHAFDEALKSVEHKKDLQDLKVEYLGKKGKVTGLMKEMKNLSEEDKPVYGQKVNEVRTHIQGIIDDTLEKFENEALEAQLKAETIDVSLPGRRFQLGSPHPLSRTIEDIEDFFIGLGYRVAEGYEVETDYYNFEALNLPKSHPARDMQDTFYFSDEILLRTHTSPVQVRTMRSEKGGGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDENIRMSDLKGTLQLFAKEIFGPDREIRLRPSYFPFTEPSVEVDISCFNCRGAGCSVCKDSGWIEILGAGMVHPNVLEMAGFDPDKFSGFAFGMGPDRVAMLKYGIEDIRNFYTNDIRFINQFK.. 343
267 0.000e+00gi|822638498|ref|WP_047012324.1| phenylalanine--tRNA ligase subunit alpha [Spongiibacter sp. IMCC21906]  clstr ali  54  2..DNLSGLAAEAEQKIAAADSGQVLDQVRVEYLGKKGHITALLKGLGNLSAEERPAAGAEINKVKAQLAEKISQRKAALEEAEVNAKLAAETIDVTLPGRGQQLGGLHPITRTIERVSAFFEGIGFDVVEGPEIEDDYHNFEALNIPAHHPARAMHDTFYVDDTHVLRTHTSPVQVRVMES--SEPPMKLICPGRVYRCD-SDLTHTPMFHQVEGLMISENCSFADLKGMLESFLRSFFEKELAVRFRPSYFPFTEPSAEVDIQCVMCGGDGCRVCSHTGWIEILGCGMVHPRVFEFSNIDTERFTGFAFGLGVERLAMLRYGVNDLRLFFENDLQFLGQFR.. 338
268 0.000e+00gi|499908385|ref|WP_011589119.1| MULTISPECIES: phenylalanine--tRNA ligase subunit alpha [Alcanivorax]  clstr ali  53  2..ENLNALVDAALAEVEQAGDIRALDDVRVKYLGKKGEISALMKGLGKLSAEERPQAGAVINEGKQKVQDAIADRKSAMEEAALKQQLASETVDVTLPGRGELPGGLHPVNRMRRRIEDFFLRLGFDISEGPEVEDDFHNFEALNIPSHHPARAMHDTFYFGDGRLLRTHTSPVQVRVMEQ--GKPPFRIIAPGRVYRCD-SDLTHTPMFHQVEGLLVDKGITFADLRGTVAEFLRYTFEEDLPVRFRPSYFPFTEPSAEVDVGCVSCGGEGCRVCSHTGWIEIMGCGMVHPTVLEAGGVDAEEYSGFAFGMGIERIAMLRYGVNDLRLFFENDTRFLSQF... 338
269 0.000e+00JGI.Meta 7035680763 C1923145__gene_132734 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit number 1 of subject 1  ali  55  1MKEQLNAIYEKAIESIKNAEQMKDIDELKVKILGKKGELTGILKGMGKLAPEERPVIGELANKIRADIENKIDETKKEFAAKEQQKKLNEETIDVTMPGKKCECGHKHPMSIVIDEISDIFIGMGYEIVEGPEVELDYYNFEALNIPANHPAKDEQDTFYINGDILLRTQTSPVQVRTMER--GVLPIRAVCPGTVYRADEVDATHSPVFHQCEGIVIDKGITMGDLKGALEVFAKELFGKDIKVRFRPHHFPFTEPSAEMDVTCFACGGKGCRVCKGEGYIELLGCGMVHPKVLKMSGIDPEVYSGFAFGMGLERVAMQRYGITDLRLLFENDTKFLKQF... 339
270 0.000e+00gi|780804058|gb|KJS09516.1| phenylalanyl-tRNA synthetase subunit alpha [Gammaproteobacteria bacterium BRH_c0]  clstr ali  52  2..ENLATLADEAIKAVNAATDEAALDQVRVEYLGKKGKLTELLKGLGKLSAEERPAAGAKINEVKELVQQHIQTCKLQLETSSIAAQLAAESLDISLDGRRVEQGGLHPVTRTLARIEEFFVSVGYQVAEGPEIEDDYHNFGALNIPEHHPARAMHDTFYIDASTVLRTHTSPVQIRTLEQQA--PPIRIICPGRVYRCD-SDLTHTPMFHQVEGLVVDRDVSFADLKGTVDQFLKAFFEADLPVRFRPSYFPFTEPSAEVDIQCTNCRGAGCRICKNTGWLEVMGCGMVHPEVFRQCDVDSETYSGFAFGMGVERLAMLRYGVTDLRLFFDNDLRFLSQF... 337
271 0.000e+00gi|501009953|ref|WP_012062854.1| phenylalanine--tRNA ligase subunit alpha [Alkaliphilus metalliredigens]  clstr ali  54  1MEAKLKQLEEKAKQDIQASTSTDSLEKVRVKYLGKKGELTEVLRGMGSLSKEERPLVGKIANLVREQIEEALELAKGAVKDKELESKLKMESLDVTMPGKTREIGKRHPLIQAMDELKSIFIGMGFKVAEGPEVETVHYNFDALNAAPNHPSRDMSDTFYINDHIILRTQTSPVQVRTMELQ--KPPIRIISPGRCFRNDTPDATHTPMFHQLEGLVVDKGITLGDLKGTLEVFIKQFFGNDTKVKFRPHHFPFTEPSAEVDVTCFKCAGHGCSMCKGEGWIELLGAGMVHPNVLRNCGIDPEIYSGFAFGMGIDRLTMAKYEIDDIRLLFENDMRFINQF... 339
272 0.000e+00gi|652464968|ref|WP_026859724.1| phenylalanine--tRNA ligase subunit alpha [Jeotgalicoccus psychrophilus]  clstr ali  60  1MTQVMETMQLEFNDKLSGIDNSKALADLRVEYLGKKGKVTGLMKEMKNLSNEERPAYGQKVNVLRNDIESKLSELEAELSKRALEAKLAEETIDVTLPGRTLEIGGSNPIDRIVENIEDFFIGLGYEIKEGYEVEQDYYNFEALNLPKSHPARDMQDSFYISEDILLRTHTSPVQARTLEAQKGEGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIHLSDLKGTLELFAKEIFGNDREVRLRPSYFPFTEPSVEVDISCFKCKGSGCNVCKQTGWIEILGAGMVHPNVLEMAGFDSEEYSGFAFGMGPDRVAMLKYGIEDIRHLYTNDLRFIDQF... 341
273 0.000e+00gi|503539823|ref|WP_013773899.1| phenylalanine--tRNA ligase subunit alpha [Melissococcus plutonius]  clstr ali  60  3LQKQLEILHDETLKSIKTSQSLTKLNQIRVEILGKKGPITEILRGMKNLSAKERPMVGSFANNVRDLLVQAIEERKEVLEQEALEQSLAKETLDVTLPGKQMKQGTRHIISQVIEEIEDIFIGMGYQVIDGYEVESDYYNFERMNLPKEHPARDMQDTFYISNEILIRTHTSPIQARTMEKHDSKGALRMISPGKVFRRDTDDATHSHQFHQIEGLVIDKNVTMGDLKGTLEIMMKKMFGKDRRIRLRPSYFPFTEPSVEVDVSCFKCEGDGCGVCKQTGWIEILGAGMVHPNVLAMSGIDAKEYSGFAFGLGPDRIAMLRYGVNDIRSFYQNDLRFLGQFK.. 345
274 0.000e+00 GL0106043 [Complete] locus=scaffold12312_2:5151:6173:-  ali  57  2MKEQIKHIREMAEQALLSAKSEQDIEALRIRFLGKKGELTAVLKQMGGLSAEERPMIGQLANQVRAFLEQEISEXXXXXXXXXXXXRLELETIDVTMPGRAVTLGQKHPLNIVLDEIKEIFLGMGFDIAEGPEVELDYYNFEALNIPKDHPARDTQDTFYITDNILLRTQTSPVQVRVMEKQ--KPPIRIISPGRVYRSDAVDATHSPVFHQIEGLVVDKGITMGDLKGTLEDFAKRLYGDDSVFRFRPHHFPFTEPSAEMDTMCFNCGGKGCRLCKGEGWIEILGGGMVHPKVLENCGIDPEEYSGFAFGLGLERIVMRRFNIDDMRLLFENDIRFLNQF... 340
275 0.000e+00gi|751923899|ref|WP_041138740.1| phenylalanine--tRNA ligase subunit alpha [Clostridiaceae bacterium GM1]  clstr ali  60  1MNE-LLKIKEDALSQIEACPDLKVLNDLRVHFLGKKGPIQEAMKSMKTMAPEERAAFGQVSNEVKQAITAAIDEAKVKLEAAAINQKLAEEVIDITLPSFHVHEGTKHPLTMIEEEMEELFLGMGYQIAEGPEVELDHFNFELLNLPKDHPARDMQDTFYIDENTVMRTHTSPVQARTLLSAKGKGPIKIICPGKTYRKDDDDATHSHQFTQCEGLVIDENITMADLKGTLQVFADKIFGEGREIRFRPSFFPFTEPSVEVDISCFSCGGKGCSICKQTGWIEILGAGMVNPKVLDMCGFDSKKYQGFAFGIGLERVAMLKYGIDDIRHFYSSDLRFLNQFNR. 342
276 0.000e+00gi|938704489|ref|WP_054653137.1| phenylalanine--tRNA ligase subunit alpha [Lactobacillus equigenerosi]  clstr ali  57  3LQEQLAEIKAQALAAIEASDAEKSLNDVRVKFLGKKGEITSVLRGMKDLSAAERPQAGKLANEVRDAIQSQLDEKKAALATTVLNAKLAHETVDVTLPGSPVMQGQPHVIQQIIDQLIDLFVGMGYEVATGSEVEEEVYNFEKLNLPKDHPARDMQDTFYITPSILMRTQTSPMQARMMEQHDSKGPLKMISPGKVYRRDTDDATHSHQFHQVEGIVIGEHITMADLKGTLKAVAQNLFGDSLDVRLRPSYFPFTEPSVEADITCFNCHGDGCNICKGTGWIEALGAGMVHPNVLKMSGVDPEVYGGFAFGLGPDRFAMLKYGVEDIRNFYLNDVRFLTQFNQ. 346
277 0.000e+00gi|494432020|ref|WP_007225326.1| phenylalanine--tRNA ligase subunit alpha [marine gamma proteobacterium HTCC2143]  clstr ali  51  2..ENLESLANEARTAIASAEDPAALDQVRVDYLGKKGSITGLLKGLGKLSAEARPAAGAEINQVKQALQESIAERKDILEGAAVAEKLAAETIDITLSGRGQATGGLHPVTRTIERIADFFEAIGFETVEGPEIEDDYHNFEALNIPAHHPARAMHDTFYIDESTVLRTHTSPVQVRVMES--SEPPLKIICPGRVYRCD-SDLTHTPMFHQVEGLLISENSSFADLKGIVEEFLRVFFEKELAVRFRPSYFPFTEPSAEVDIQCVMCNGEGCRVCSQTGWLEVMGCGMVHPRVFEYSNIDTEKFTGFAFGMGVERLAMLRYGVNDLRLFFENDLRFLEQFR.. 338
278 0.000e+00JGI.Meta 7034485567 SRS014459_WUGC_scaffold_54171__gene_80461 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit n  ali  55  5MKEQLEKIKSEALAKIDASDALEKLNEIRVAYLGKKGELTTVLKSMKDVAPEERPKVGQMVNEVRALIEERLEETKTALARKAREEQMKREVIDVTLPAKKANTGHKHPNTIALEEVERIFVGMGYEVVEGPEVEYDLYNFEKLNIPKGHPARDEQDTFYINDSILLRSQTSPVQARVMEKQ--KPPIRMIAPGRVFRSDEVDATHSPSFHQIEGLVIDKHITFADLKGTLAEFARELFGEDTKVKFRPHHFPFTEPSAEVDVSCFKCGGKGCRFCKGSGWIEILGCGMVHPHVLEMCGIDPEEYTGFAFGVGLERIALLKYEIDDMRL............... 331
279 0.000e+00gi|403122044|gb|EJY56292.1| phenylalanyl-tRNA synthetase, alpha subunit [Alicyclobacillus hesperidum URH17-3-68]  clstr ali  60  35...QLRRLQETALAELTKISATKDLTNWRVQYLGKKSELNALSKQMGGLRQEERPLFGERVNEVRNALEAAYLERQTALAAAEQALRLAQETIDITLPGRAIGRGAIHPISRVIQEIEDIFLGMGFSIVDGPEIETDHYNFELLNLPKDHPARDMQDTFYLSDELLLRTHTSPMQVRTMERMQGDVPIKVIVPGRVYRRDEDDATHSHQFTQIEGLVVGEGIRMSDLKGTLESFAKALFGPEQRVRLRPSYFPFTEPSAEVDLLCVHCHGEGCRVCKGTGWIEILGAGMVHPRVLDMSGYDSTRYSGFAFGMGPERIAMLRYGISDIRLLYQNDLRFLAQFARA 375
280 0.000e+00gi|500056250|ref|WP_011736167.1| phenylalanine--tRNA ligase subunit alpha [Pelobacter propionicus]  clstr ali  58  1MREQLEQLRCEAFQAIADASTGEALQNIRIKYLGRKGAMTALMKGLGALSAEERPVVGQMVNSIRDEIESGIEAGLFAARERARDEKLRSERIDVTLPGRRPGCGSKHPITLVIEEVCDIFAGLGFSVAEGPEIEHDWYNFEALNFPPEHPARDMQDTFFVDNNLLLRTHTSPVQIRTMLKR--KPPLRIIAPGTVYRCD-SDATHSPMFHQIEGLMVDQGVSFGDLKGILTIFTNQLFGQKTGVRLRPSFFPFTEPSAEVDIACVICGGKGCRVCKNSGWLEILGAGMVDPEVYRHVGYDAEAVSGFAFGMGIERIAMLKYGISDMRLLFENDVRFLRQF... 338
281 0.000e+00gi|948955352|gb|KRN68248.1| phenylalanyl-tRNA synthetase subunit alpha [Pediococcus parvulus]  clstr ali  60  32LHEQLEELKKKSLHEISRTDGLKGLDAIRVNVLGKKGPLTEILRGMRDIPKTERPKVGELSNRVRDNITAAIEEKRAELEKAVIAKKLENEKIDVTLPGKPVLQGQPHVIQQIIDNIEDLFLGMGYQVVQGPEVETDKYNFEMLNLPKDHPARDMQDTFYITDEILMRSQTSPVQARTMEKHDSKGPLKMISPGVVYRRDTDDATHSHQFHQVEGLVIDKHITMGDLKGTLETLAKELFGDRFEVRLRPSYFPFTEPSVEADVTCFNCMGKGCSVCKQTGWIEVLGAGMVHPNVLRMAGVDPEVYGGYAFGLGPDRFAMLRYGVDDIRNFYQNDVRFLSQFSK. 375
282 0.000e+00gi|736413055|ref|WP_034435544.1| phenylalanine--tRNA ligase subunit alpha [Candidatus Contendobacter odensis]  clstr ali  51  2..DALPELLLVARTTITGADDLAALDQWRVHYLGKKGVLTERLKELGRLPPEQRREAGQAINEAKQALETALTLRKTALEAVALNARLASEAIDVTLPGRGQQPGGRHPLSRTLARIEAFFTGIGFAVAEGPEVEDDFHNFEALNIPPHHPARAMHDTFYFDAHTLLRTHTSPVQIRVLEQQA--PPVRIIAPGRVYRCD-SDLTHSPMFHQVEGLLVDEAVSFADLKGVLDDFLRHFFERDLAVRFRPSYFPFTEPSAEVDIQCVICGGSGCRVCKHSGWLEVLGCGMVHPAVFAKVGIDSERYTGYAFGMGVERLTMLRYGVNDLRLFFENDLRFLRQFQ.. 338
283 0.000e+00 GL0022489 [Complete] locus=scaffold4312_1:4523:5569:-  ali  60  3LREKLAELREEGLQDIKQSEDLKRINEIRVKMLGKKGPITSVLRGMRDLSAEERPKVGQFANKVRDELSAAIEEKRAELEQAAMNAKLAAQTIDVTLPGTPVAQGQPHVIQQIIDQVVDLFVSMGYEVAVGDEVEQEVYNFEKLNLPKDHPARDMQDTFYVTPSVLMRTQTSPMQARMLEKHDSQGPLKMISPGKVYRRDTDDATHSHQFHQIEGMVVGKNITMADLKGTLEAVAQNLFGDKLKVRLRPSYFPFTEPSVEADITCFNCLGKGCAICKQTGWIEVLGAGMVHPNVLKMSGVDPEEYGGFAFGLGPDRFAMLKYGVDDIRNFYQNDVRFLNQFDQ. 346
284 0.000e+00gi|493519851|ref|WP_006474008.1| phenylalanine--tRNA ligase subunit alpha [endosymbiont of Tevnia jerichonana]  clstr ali  52  1MKDNLQQLMADAECAVASADDLTALDEVRVKYLGKSGLLTDQLKQLGKLPKQERPQAGQAINQAKQALQRAIETRKALLEEQALAARLSSEQIDVTLPGRGLAKGGLHPVTRTLERIERLFAHAGFDVHEGPEIEDDYHNFEALNIPAHHPARAMHDTFYFDAHMLLRTHTSPVQIRTMES--GTPPMKIIAPGRVYRCD-SDLTHTPMFHQVEGFLIDRDVSFADLKGVIYDFLSSFFEKDLKVRFRPSYFPFTEPSAEVDMECVMCGGEGCRVCSHTGWLEVLGCGMIHPEVFRHVGIDSEEYTGYAFGMGVERLTMLRYGVNDLRLFFENDLRFLKQF... 341
285 0.000e+00JGI.Meta 7056887829 C2628644__gene_284405 phenylalanine--tRNA ligase, alpha subunit [Human Stool microbiome from visit number 2 of subject 7  ali  54  1MKDKLAGIVEDALSKIEKSEKLDVLNDIRVSYLGKKGELTSVLKSMKDVLPEDRPKVGQMVNDARSTIEKKLEEKKTAFEKRIREEKIKSETIDVTLPGKKPHMGHRHPNSIALDDVERIFTGMGYEVVEGPEVEYDYYNFEALNIPDNHPAKDEQDTFYINNNIVLRTQTSSVQVHVMEQK--KLPIRMIAPGRVFRADEVDATHSPSFNQIEGLVIDKNITFADLKGTLAEFAKRMFGETTKVRFRPHHFPFTEPSAEMDVSCFKCGGSGCRFCKGEGWIEILGCGMVHPHVLEMRDIDPEEYQGFAFGIGLERIALLKYEIDDMRLLYENDIRFLEQF... 339
286 0.000e+00gi|517420518|ref|WP_018592046.1| phenylalanine--tRNA ligase subunit alpha [Terrisporobacter glycolicus]  clstr ali  57  1MKEQLISLKERALSEIKAASSMEELDSLRVKYSGKKGELTAILKGMGKLSAEERPEIGKIANEVREAIENEINLIKEEIKKIELNKKLAEEVIDVTMPGKILKVGKRHPITQIIDEVTEIFMGIGFSVAEGPEVETVGNNFDALNAPKNHPSRDMTDTFYFNDELLLRTQTSPVQVRTM--RNEELPIKIISPGRCFRNDSLDATHSPMFHQIEGLVVGKDITMAQFKGTLELFVKKLFGDNTRTKFRPHNFPFTEPSAEIDVTCFKCGGKGCQMCKGEGWIEILGAGMVHPNVLRNCEIDPEIYSGFAFGMGVERLAMLKYEIDDIRLLVENDMRFLDQF... 339
287 0.000e+00 [EC:6.1.1.20][KEGG:K01889] phenylalanyl-tRNA synthetase alpha chain;|[COG0016] Phenylalanyl-tRNA synthetase alpha subunit  ali  59  2MRKLLEEIRKRAEGELDSGADA---ESIRIKYLGKKGELTAVLRQMGSLSAEERPVIGGLANEVRTYIEERIAKRADELKNAALRAKLASEKLDVTVPGTPSAFGRRHPLAQTEELMRDVFIGMGFTIAEGPEVEYDYYNFEALNLPKNHPARDTQDTFYITDNILLRSQTSPVQVRAMEQ--SKPPIRIISPGRVYRADPADATHSPIFHQMEGLVVDKGITMGDLKATLELFAQKMFGPETKIRFRPHHFPFTEPSAEVDVSCFVCGGKGCRVCKGEGWIEILGAGMVHPFVLSNCGIDPEVYSGFAFGMGIERITMCRYGMDDLRLLYDNDMRFLSQF... 338
288 0.000e+00gi|505071892|ref|WP_015258994.1| phenylalanine--tRNA ligase subunit alpha [Thioalkalivibrio nitratireducens]  clstr ali  52  2..EQLQKLVAEAVARIEQAEGLADLDALRVRYLGKKGALTALLKELGRLPAEERPRAGQAVNEAKGELSGRIEARQRELAAAEVARKLREERVDVSLPGRRPATGSLHPVTQTIERIREFFAGMGYRVAEGPEVEDDFHNFEALNIPEEHPARAMHDTFYFDAHRVLRTHTSPVQIRAMKEQ--RPPLRIIAPGRVYRCD-SDLTHSPMFHQVEGLYVDSGVTFADLRGVLSAFLQALFEDDLKTRFRPSYFPFTEPSAEVDIQCVHCGGSGCRVCKQTGWLEVMGCGMVHPNVFGHVGIDAERYTGFAFGLGVERMAMLRYGVNDLRLFFENDVRFLGQFARA 341
289 0.000e+00gi|737505768|ref|WP_035485298.1| phenylalanine--tRNA ligase subunit alpha [Alicyclobacillus contaminans]  clstr ali  59  4....LQSLRDRALGELADAQDMRQLDEWRVQYLGKKSDLTQISRQMGQLPAEERPVLGEHVNQVRSVLQDALTKKQEALHAAELERRFAAETIDVTAPGRRKPRGSMHPLTQIIEEIVEIFVAMGYEVAEGPEVETDEYNFEKLNLPKHHPARDMQDTFYLTESLLLRTQTSPMQVRTMERMRPNVPVKVIAPGKVYRRDEDDATHSHMFHQIEGLVVGEGIRMSDLKGTLELFARSVFGADQTVRLRPSFFPFTEPSAELDIRCTNCGGSGCRMCKDTGWLEILGCGMVHPRVLDGAGYDSRRFSGFAFGMGPERIAMLKYGIEDIRLLYQNDLRLLRQFHRV 343
290 0.000e+00JGI.Meta 7063938252 SRS049318_LANL_scaffold_179336__gene_259339 phenylalanine--tRNA ligase, alpha subunit [Human Supragingival plaque microb  ali  53  12MKEKLEELRQRALEKIKSIEELDALNELRIAYLGKKGELTQILKAMKDVSDEERPKIGQMVNETREIIEENLNQIKDKLNKRIRDEKIASETIDVTLPAKTVSLGHLHPNTIALAEIEKIFIAMGYEVVEGPEIEYDEYNFTKLNIPANHPAKDEQDTFYINKDIVLRTQTSPVQARVMET--GKVPIRMISPGRVFRSDEVDATHSPSFHQVEGLVIDKNITFSDLKGTLAEFAKRLFGEDTKVKFRPHHFPFTEPSAEMDVSCFKCKGKGCRMCKSSGWIEILGCGMVHPHVFDMCGVDKSVYQGFAFGVGLERIALLKYEIDDMRLLYENDIRFLKQF... 350
291 0.000e+00gi|472233631|dbj|BAN06596.1| Phenylalanyl-tRNA synthetase alpha chain [Lactobacillus brevis KB290]  clstr ali  56  43LRDKLNELHERGLAEIQKSTDLKDVNQVRVSLLGKKGPITEVLRGMRDLDAEERPKVGAFANEIRDDLTAALTKRREELENAVLNARLAKEAIDVTLPGTPVAKGEPHVIQQIIDQIEDLFLGMGYQVLSGPEVEEDKYNFEMMNLPKNHPARDMQDTFYITKEILMRTQTSPMQARTLEKHDSQGPLKMISPGVVYRRDTDDPTHSHQFHQVEGLVIDKHITMADLKGTLQVLAHELFGDKFDVRLRPSYFPFTEPSVEADITCFNCGGKGCNVCKNTGWIEVLGAGMVHPNVLKMAGVDPDVYGGFAFGVGPDRFAMLKYGVDDIRNFYLNDVRFLTQFTK. 386
292 0.000e+00gi|656031782|ref|WP_029070951.1| phenylalanine--tRNA ligase subunit alpha [Kandleria vitulina]  clstr ali  60  2..DNLRKIREEALEKINEAADLKELNALRVAFLGKKGPLQKAMKAMKDMAPEERKSFGQVSNKAKQEIAKAIETMKENLEEAEMNARIKREDIDVTLPARKLPTGSLHPITMVKEDIEELFLGMGYTVAEGPEVETDHYNFELMNLPKGHPARDMQDTFYIDENTLMRTHTSPVQAHVLLEAKGKGPIKIICPGKTYRRDDDDATHSHQFAQCEGLVVDKNVTMGDLKGTLEFFAKRTFGEKREIRLRPSYFPFTEPSVEVDISCGNCGGKGCAMCKGTGWIEILGAGMVNPHVLEMCGFDPKEYQGFAFGIGLERVAMLKYGIDNIRDFYNDDLRFLNQFAR. 342
293 0.000e+00gi|652835335|ref|WP_027118278.1| phenylalanine--tRNA ligase subunit alpha [Lachnospiraceae bacterium YSB2008]  clstr ali  56  1MGKTLEEIRKEAAEKISSSATVEALDEIRVSILGKKGELTQILKSMKDIAPEERPKVGQMVNEVRAMLEENIEAKKKELNRKLLTEKMKRETIDVTLPGTKLMRGHKHPNQIALEDLEKVFIGMGYEVVEGPEVEFDRYNFELLNIPANHPAKDEQDTFYITKDILLRTQTSSVQARIMEQ--GKLPIKIISPGRVFRSDEVDATHSPSFHQVEGLVVDKGITMADLKGTLDQFAKNFFGPETKTKLRPHHFPFTEPSAEVDVTCFKCHGKGCSVCKGSGWIEILGCGMVHPHVLEMCGIDPNEYSGFAFGIGLERVALLKYEIDDMRLLYENDIRFLKQF... 339
294 0.000e+00gi|167651829|gb|EDR95958.1| phenylalanine--tRNA ligase, alpha subunit [Anaerostipes caccae DSM 14662]  clstr ali  54  30MKEKLEAIKKEALEKINTADAMDTLNDIRIAVLGKKGELTQVLKGMKNVAKEERPMVGQMVNDTRAAVEQALEKEMALLKKKIMEEKLKTEVIDVTLPGKVHEKGHRHPNQIALEDLERVFIGMGYEVVEGPEVEYDKYNFEMLNIPENHPAKDEQDTFFISKDILLRTQTSPVQARVMET--GQMPIRMIAPGRVFRSDEVDATHSPSFHQVEGLVVDKGITFADLKGTLQQFATEFFGPETKVKFRPHHFPFTEPSAEVDITCFKCGGKGCRMCKGSGWIEILGCGMVHPNVLRACGIDPEVYSGFAFGIGLERVALLKYEIDDMRLLYENDKRFLSQF... 368
295 0.000e+00gi|149830912|gb|EDM86002.1| phenylalanine--tRNA ligase, alpha subunit [Blautia obeum ATCC 29174]  clstr ali  53  11MKERLQELAEAARKRIEESDGPDKLNEVKVAYLGKKGELTAILKSMKDVAPEDRPKVGQMVNETRAKIEEHLEATRKKLEEALREEKMKSEVIDVTLPAKKAKIGHRHPNSIALEEVERIFIGMGYEVVEGPEVEYADYNFTKLNIPEDHPARDEQDTFFINDSILLRSQTSPVQARTMEK--GNLPIRMIAPGRVFRSDEVDATHSPSFHQIEGLVIDKNITFADLKGTLQEFAQELFGPETKTKFRPHHFPFTEPSAEVDVSCFKCGGKGCRFCKGSGWIEILGCGTVHPNVLRMCGIDPDEYTGFAFGVGLERIALLKYEIDDMRLLYENDVRFLKQF... 349
296 0.000e+00gi|332699969|gb|AEE96910.1| phenylalanyl-tRNA synthetase, alpha subunit [Mahella australiensis 50-1 BON]  clstr ali  55  2LHDELDEVKQGFVNELEQISDSEALEALRVKYMGKKGLITSLLKGMGKLPSEERPATGQAINGLKEELTVLLEDKALQIKAMERQRKLEAEAIDVTMPGKRPVIGGRHPLSIVRRQIEDIFIGMGFEIADGPEVEYDYYNFEALNIPKDHPSRDLQDTFYITDNIVLRTQTSPVQIRVMESH--RPPI<