current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit, from COG1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# E-value Template Links and tools%idFirst MREQLEALRDDAIKKIEQAQEKKVVQEIRVKYLGKKGPVTEVLRGMGKLSPEERPVIGQLANDVREAIGKAIESKMEALEQAEIHRKLQEETIDVTLPGRPVLKGGAHPLTATITEVEDLFIGLGFSVAEGPQIETDYYNFEALNLPKDHPARDMQDSFYFTDELLLRTQTSPVQARTMEKYKGKGPIKIICPGKVFRRDDDDATHSHQFMQIEGLYVDHGVRMSDLKGVLQAFAKSFFGEERSIRLRPSFFPFTEPSVEVDVSCGICHGDGCRVCKQTGWIEILGAGMVHPRVLEMSGFNPNEYSGFAFGMGVERLSMLKYGIDDIRHFYTNDRRFLAQFKRVLast
1 1.000e-70UniRef50_P17921 Phenylalanine--tRNA ligase alpha subunit n=2072 Tax=root TaxID=1 RepID=SYFA_BACSU  ali  71  1MEEKLKQLEQEALEQVEAASSLKVVNDIRVQYLGKKGPITEVLRGMGKLSAEERPKMGALANEVRERIANAIADKNEKLEEEEMKQKLAGQTIDVTLPGNPVAVGGRHPLTVVIEEIEDLFIGMGYTVEEGPEVETDYYNFESLNLPKEHPARDMQDSFYITEETLMRTQTSPVQTRTMEKHEGKGPVKIICPGKVYRRDNDDATHSHQFMQIEGLVVDKNISMSDLKGTLELVAKKMFGQDREIRLRPSFFPFTEPSVEVDVTCFKCGGNGCSVCKGTGWIEILGAGMVHPNVLKMAGFDPKEYQGFAFGMGVERIAMLKYGIDDIRHFYTNDVRFISQFKQ. 343
2 1.000e-69UniRef50_A0A1A7T4I5 Phenylalanine--tRNA ligase alpha subunit n=72 Tax=root TaxID=1 RepID=A0A1A7T4I5_ENTFC  ali  61  3LQEQLEALKSQTLAKIDAADELSTVEAIRVETLGKKGPITEVLRGMRDLSAEERPKVGAFANEIRDLLAQAVEERKAALTELALEKKLAAESLDVTLPGKQPAHGTRHVLTQIMEEIEDTFVGMGYQIVEGTEIESDHYNFERMNLPKDHPARDMQDTFYISDDVLLRTHTSPVQARTMEKHDFSKALRMISPGKVFRRDTDDATHSHQFHQIEGLVVDKGITMGDLKGTLEVLLKELFGADRSIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVCKYTGWIEILGAGMVHPNVLEMSGIDSKEYSGFAFGLGPDRIAMLRYGVNDIRNFYLNDVRFLEQFKG. 346
3 1.000e-66UniRef50_A0A1V4IGE1 Phenylalanine--tRNA ligase alpha subunit n=43 Tax=Bacteria TaxID=2 RepID=A0A1V4IGE1_9CLOT  ali  54  1MKEKLNAIKELAEKEISNAVNISDFEALRVKYLGKKGELTAILRGMGALSAEERPVIGKIANQVRAAIEDALESSVKKIKEKAKQEKLQNDVIDISLPGRKNRVGRKHPLELALDGMKDIFISMGFTIEDGPEVELDYYNFEALNIPKNHPARSEQDTFYINDNVVLRTQTSPVQIRVMENQKP--PIRMISPGKVFRSDAVDATHSPIFYQMEGLVVDKGITFADLKGTLEMFAKKMFGDDVKTKFRPHHFPFTEPSAEMDATCFVCNGEGCKVCKGSGWIELLGCGMVHPDVLRHGGIDPEVYSGFAFGFGIDRMVMLKYALDDIRLLYESDMRFLNQF... 339
4 1.000e-66UniRef50_A0A1M5XK47 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=root TaxID=1 RepID=A0A1M5XK47_9CLOT  ali  53  1MQKKLEQIKTDALAVLEKAMSKKEIEEIRIKYLGKKGELTSILRGMGGLSSEERPIIGKLANEVRENLETIINNASKSISEKEKNSKLQSEIIDISMPGNRKSLGHKNPLQLTLDSINEIFLSMGFAIEEGPEVELDHYNFEALNIPKNHPARGEQDTFYINDDVVLRTQTSPVQIRTMENQKP--PIKMISPGKVYRSDAVDATHSPIFYQIEGLVVAEGITFADLKGTLELFTKKMFGDKMKTKFRPHHFPFTEPSAEMDATCFVCGGKGCNVCKGSGWIELLGCGMVHPQVLRNCGIDPEVYSGFAFGFGLDRMVMLNYAIDDIRLLYEADMRFLQQF... 339
5 3.000e-66UniRef50_A0A1G1X406 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1G1X406_9BACT  ali  43  1MEQQLEDLQKQANKELAEVSDASALEAWRVLYIGRKGKLPELLRGVKDLGDEEKRVIGKAANILKRTLEEAYSVKQESFIASAPNKLMKALPAGRQVQANEASVGHLHPITLTIERVQNIFAAMGFIIADGPEVEEARYNFDALNIPSDHPARGEGDTFMIDPDVVLRTQTSPMQIRSVETMRLTPPFYVIAPGRVYRREKVDATHESTFYQFEGLGIGEDITIADFKGVIAAFFSTFFQKDVTVRLRPSYFPFVEPGFEVDMSCVFCAQKGCRVCKYTGWIEVMGAGMVHPNVLKNMNIDPTKYQGFAFGGAIDRLTMIRHGINDIRMFWSGDIRFLRQFSN. 350
6 3.000e-66UniRef50_A0A0P8UXL9 Phenylalanine--tRNA ligase alpha subunit n=15 Tax=Bacteria TaxID=2 RepID=A0A0P8UXL9_9CLOT  ali  50  1MKEKLNAIKESALNEIKKVADLEKLEELRIRFLGKKGELTQVLRGMKDLSKEERPIIGKIANEVREMIEGEIEKLKLDLKEKVQREKLAAEKIDISMPGREKIIGHRHPLISVMEELENVFMNMGFSVVQGPEVETVYNNFDALNSPENHPSRDPSDTFYITEDILLRTHTSPVQIRVMKQVKP--PLRIVSAGRTFRFDDVDDTHSPMFHQFEGLVIDKNITMANLKDTIYKFVTEIFGEGMKVRFRPHYFPFTEPSAEVDVSCFKCKGKGCPACNGTGWMEILGCGMVHPKVLKNCGIDPEIYSGFAFGLGIDRIAMVKYGINNIRLLFENDMRFLEQF... 340
7 6.000e-66UniRef50_Q7NGP0 Phenylalanine--tRNA ligase alpha subunit n=1949 Tax=root TaxID=1 RepID=SYFA_GLOVI  ali  52  1MQQQLDALQLEALKAIREAADLTILERIRVDFLGKKGKLSALLGGMARLPAEERPVVGALVNQVKARVEEALAAQQTHLQDQLIELRLVAEALDVTMPGRFVPPGRLHPLTATTDRIVDVFVGLGFTVASGPQIETEYYNFEALNTPADHPARDMQDTFYLSDGLVLRTQTSSVQI--RYMEENDPPVRICVPGRVYRRDQVTNRHSPVFHQLELLAVDEEITFGDLKGTLTFFTQEMF-GDRPVRFRPSFFPFTEPSAEVDVQCRFCDGKGCRTCSHTGWLEIAGCGMVDPNVFQAVGYNPEKVQGFAAGMGIERIAMLLYDINDIRLFYTNDLRFLRQF... 338
8 8.000e-66UniRef50_D1C4D6 Phenylalanine--tRNA ligase alpha subunit n=105 Tax=root TaxID=1 RepID=D1C4D6_SPHTD  ali  46  1MNDELEQIRQRAEQDLAAACDSQALAAWYAQYLGRKGEVTSLTRRLGALPPEERPAFGQAVNALKTTLQGSFDRRQEEVRRAELTQRLEAEAVDITLPGRAPDIGTLHPVTQMIREVTDIFAHLGFQTVEGPEVEDAYYAFDALNIPKEHPARDVWDTFIHSESREIVLRPHTSPMQIRTMEQSTPPVRVVVPGRCYRYEALDATHEWHFHQIEGLAVDERITMSDLKGVLAEFARQIFGRERKVRFRCDYFPFVEPGVDFAIDCMVCKGVGCRVCKGTGWIEILGAGMVHPNLLINVGYDPSRYTGFAFGMGVERLVMLKYGVQDIRAFYQGDVRFLAQF... 342
9 3.000e-65UniRef50_A0A1E8CHY8 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=root TaxID=1 RepID=A0A1E8CHY8_9GAMM  ali  53  11...........ALQAIDATTDERALEQLRVDYLGKKGQLTDLLKGLGKLPAEQRPAAGESINIAKRRIQEALDARRETLVAQAMESQLAQETIDVTLPGRRQSAGGLHPVSRTIDRIQRLFESVGYSVAEGPEIEDDYHNFEALNIPGHHPARAMHDTFYINPSTVLRTHTSPVQVRVMEQGKP--PFRMICPGRVYR-CDSDLTHTPMFHQIEGLLIAENVSFADLKGTLEDFLRAFFEADLAVRFRPSYFPFTEPSAEVDMSCVMCEGKGCRVCKQTGWLEVLGCGMVHPSVLEASGIDSEQYRGYAFGMGVERLAMLHYGVNDLRLFFENDLRFLKQF... 337
10 1.000e-64UniRef50_A0A1Y4DQF6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A1Y4DQF6_9BACT  ali  49  12......TIEQEYKAKIGQAADLAAVEELRVAALGRKGALTELLKGLKDFSIEEKKEAGPLGNALKAALTAAFDEKTEFFAAKEINDELNKVNLDLTLPGYPVAKGHRHPLSVAQDRMTDILSRLGFEWAEGPWVEDEKHNFDLLNIPLHHPARDAQDTFFVDGKMPLVLRTHTSNVQSRYMEKHKPPLRIMAPGRVFRNDSLDATHSPVFHQIEGLYVDKHVSLADLKSDLTAFMKGLFGNKAEIRFRPSFFPFTEPSVEVDVKCVFCQGKGCNVCKGNGWIEMLGAGVVHPNVLRNCGIDPEVYSGYAFGMGVERLAMMMLNIKDIRTFYENDLRVLKQF... 346
11 3.000e-64UniRef50_A0A1Y1RJX9 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Bacteria TaxID=2 RepID=A0A1Y1RJX9_9BACT  ali  47  1MKNKIKSLKEEAFSDLNRVSQLKELDRLRIKYMGRKGAIQSIMKGLKSVDPKDRPLIGRLVNSFKSEFGAKYEEKREELRQRAEQERLGKEWIDVTLPGVRQRSGKIHIIQQTLDEISSIFKGLGFSVADGPEIESDYYNFDALNIPKDHPARDMWDTFYIDDQTDRTVRTHTSPVQIRTMERRQPPVRIIVPGRVYRNEAIDASHHAVFYQVEGLYVDNNVTFRDLKGVLSYFSRQMFGDNLLVRFRPSFFPFTEPSAEVDISCVMCSGKGCAVCKYTGWVEILGCGMVDPAVYRYVNYDPEIYSGYAFGLGVERIAMLRYQINDIRLFLDNDVRFLEQF... 345
12 3.000e-64UniRef50_A0A2H6ID11 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A2H6ID11_9BACT  ali  46  2..EDINKLREEFVRECKGISSLKQLNDLRIKYLGKKGLLTQRLKALSALPPAERPAAGKEINILKRYVEAEIKRLEGDLSTLESRKKVATGFIDITIPGKYIPAGSRHPINRVLDEIVDIFLFMGFTVEEGPEVEMDYYNFEALNIPRDHPARDMQDTFYVETDSDVVLRTHTSPVQIRVMEKQKPPLRFIAPGKVYR-CDSDVSHTPMFHQVEGLMVGEDITFANVKSVLKLFVQSLFSVDTPVRFRPSYFPFTEPSAEIDIGCVLCSGAGCRVCKGTGWIEVLGAGMVHPKVFEGVGYDTEKYTGFAFGMGVERLTMLKYGIDDIRLFYENDLRFLRQF... 354
13 6.000e-64UniRef50_K0C0P2 Phenylalanine--tRNA ligase alpha subunit n=22 Tax=Bacteria TaxID=2 RepID=K0C0P2_CYCSP  ali  50  1MENSLENIVKQAQKELADASSLSVVEEIRVTYLGKKGVFTRQMKTLGKLSAEERPKVGAVINQAKQEFQAHLEQRKVQLENELLAKRLIEETIDVTLPGRGQSVGGVHPVTRTMRRIEQIFNRVGFDVATGPEVEDDFHNFEALNIPSHHPARAMHDTFYFDEHTLLRTHTSPVQIRVMENQQP--PLKVIAPGRVYR-CDSDITHTPMFHQVEGFVVDKDINFADLKGVISAFLKAFFEKDVKVRFRPSYFPFTEPSAEVDIECVMCEGEGCRVCGHTGWLEVLGCGMIHPEVFRHINIDADQFTGFAFGMGVERLTMLRYKINDLRLFFENDLKFLKQF... 338
14 5.000e-63UniRef50_Q6LQ72 Phenylalanine--tRNA ligase alpha subunit n=574 Tax=root TaxID=1 RepID=SYFA_PHOPR  ali  52  3...QLDEILANATTAIETAASLVALDEVRVQYLGKKGELTSQLQSLGKLPPEERRTAGQEINKAKGAVQQAIAARKDALQRAELETKLAAETIDVSLPGRRIENGGLHPVTRTVERIEQFFGELGFSTESGPEIEDAFHNFDALNIADDHPARTDHDTFFFNPDLMLRTHTSGVQIRTMEHGKP--PFRFIAPGRVYRND-YDQTHTPMFHQVEGMLVDENVNFAQLKGILNEFLCNFFEEEVEVRFRPSFFPFTEPSAEVDV-----------KRKDGKWLEVLGCGMVHPNVLRSVGIDPEKYSGFAFGMGVERLTMLRYGVNDLRSFFENDLRFLKQFK.. 327
15 6.000e-63UniRef50_A0A1V4XC65 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Bacteria TaxID=2 RepID=A0A1V4XC65_9DELT  ali  56  1MREELEKLQRDAEEELLGARTDEAVQAVRTKYLGRKGALTSILRGLGSVAPEERPAMGQLANQVKEALSQRIDAVLGEIAASKKDGRLLQERVDVTLPGRAFARGTLHPITRVTQEICGIFASLGFAVAEGPEVELDYYNFEALNMAKDHPSRDMQATFYITGNLLLRTHTSPVQVRVMERQKP--PVRIIAPGKVYRPDA-DISHSPMFHQIEGLYVDRRVTFGDLKGTLTFFLKHVFGEEIGVRFRPSFFPFTEPSAEVDIQCVMCRGKGCRVCGQSGWLEILGSGMVDPEVFKAVGYDSEEYTGFAFGLGVERIAMLRYGISDIRLFTENDRRFLEQF... 338
16 7.000e-63UniRef50_A8AWJ8 Phenylalanine--tRNA ligase alpha subunit n=431 Tax=Bacteria TaxID=2 RepID=A8AWJ8_STRGC  ali  58  5IEEQLKSLREETLASLKKAENQKELQDLRVAVLGKKGSLTEVLKGMKDISAEMRPIIGKHVNEARDILTAAFEKTAQEMEEQLVALKLAEESLDVTLPGCHIPLGSRHILSQTSEEIEDIFIGMGYQVVDGFEVEKDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDHDFSKGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGENISMANLQGTLQLIVQKMFGQDRSIRLRPSYFPFTEPSVEVDVSCFKCGGAGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDAEKYSGFAFGLGQERVAMLRYGINDIRGFYQGDIRFSQQFK.. 349
17 8.000e-63UniRef50_F9MTB7 Phenylalanine--tRNA ligase alpha subunit n=79 Tax=Bacteria TaxID=2 RepID=F9MTB7_9FIRM  ali  52  1MREKLELIEKESLDQIANCQSLEALDKIRVATLGKKGQLTGILKGMGKLSPEERPKMGALANEVRARIEEALAGKKEKLEDDQLNQQLDKEWIDISLDKKQARRGHIHPLSQTKEELEDLFVQMGFIVYEGPEIESVANNFDALNAPMSHPSRDKTDTFYIDDTTLLRTQTSPVQIRAMKELG--APLRMVCSGRVFRPDDVDDTHSPMFHQLEGLVVDEKVSMANLIHTLDVFIHEMFGQDMQTRYRPHYFPFTEPSTEVDVTCHACHGAGCKACHGTGWMELLGAGMVHPNVLRNCGIDPEKYSGFAFGMGIDRIAMVKYGISDIRLLFDNDERFLNQF... 340
18 1.000e-62UniRef50_R5VJF7 Phenylalanine--tRNA ligase alpha subunit n=26 Tax=Bacteria TaxID=2 RepID=R5VJF7_9CLOT  ali  57  1MKEKLSQILDSALGQIEASKELDKLNEIRVSFLGKKGELTSVLKSMKEVAPEDRPKVGQMXXXXXXXXXXXXXXXXXXXXXALREEKMKAEVIDVTLPGKKMKMGHRHPNTITLEEVEKIFIGMGYEVVEGPEVEYDYYNFEALNIPANHPAKDEQDTFYINDKILLRTQTSSVQVHE--MEKGKLPIRMISPGRVFRSDDVDATHSPSFHQIEGLVIDKNVTFADLKGTLEQFAKKLFGENTKVKFRPHHFPFTEPSAEMDVTCFKCGGKGCRFCKGEGWIEILGCGMVHPHVFEMSGIDPEEYKGFAFGVGLERIALLKYEIDDMRLLYENDKRFLDQF... 339
19 1.000e-62UniRef50_K2AHD3 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2AHD3_9ZZZZ  ali  44  1MKDELKKLEGEALEAIESSETSDVLEELRVKYLGRKGEVSLLLRKIKGLSDEEKRVVGKIGNEIRSTLEAAFEDKKVGINSEKYKNIAEEEWVDVTESGIPPEVGSLHPITQMRNEVEDVVTRMGFEIVDTPEVDSDYYCFESLNLPKGHPARSAWDTFYLENGMIPRVHTSTMQVRVMEKRKP--PLCVINIGRCFRNERTDASHDHTFYQIEGFVADKKITISNLSATLKFFFELIYKKKVEIRLRPGFFPFVEPAMELELRCVICGGEGCSVCKHSGWLEMLGCGMIHPKVFEFAGYKKGEYTGFAFGMGLDRIVMMKHGIKDIRNFHSGDLRFLKQF... 339
20 8.000e-62UniRef50_A0A109W7F1 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A109W7F1_9FUSO  ali  45  1MLEKLAQLRQDVLKKLDEIETLDEVNDLKVKILGKKGEFTAIMKEMANIAAEKRAEFGKTTNEIKKVLQTKFDETTVNLKEIAKQERLKNETIDITLPGRVANIGSLHPITKTVMEIKDIVSEMGFDIVDGPEVEFVKYNFDDLNIPKTHPSRELTDTFYIKDDVVLRTQTSGMQI--RYMKDKVPPFRMISVGKVYRPD-YDVSHTPMFHQVEGLMVGEDVSFANFKAVLENIVKKIFGKDRNVRFRPHFFPFTEPSAEMDVECGVCKGKGCRVCKGTGWLEILGSGMVNSKVLENAGIDAKKYQGFAFGLGLERITMLKYGIDDLRAFFENDERFLDQF... 338
21 8.000e-62UniRef50_A0A2M9DR54 Phenylalanine--tRNA ligase alpha subunit n=14 Tax=root TaxID=1 RepID=A0A2M9DR54_9DELT  ali  54  1MEKDIAQIQEEALEKIAGATDREGIEALNVQYLGRKGQVTLFLRNIAGLPPEEKPAAGKMANQVKMAIEKAFDNAFTALEAREAEFSGA---IDVSLPGRPMPQGALHPVTQVSAEICDIFEKLGFTIGEGPEVETDHYNFEALNIPKHHPARDMQDTFYVADDIVLRTHTSPMQVRMMEKTDP--PLRVIAPGKVYR-CDSDITHTPMFHQVEGLMVDTNVSFGDLKGILTTFVHRMFGIETAVRFRPSFFPFTEPSAEVDIRCVICKGEGCRICSKTGWLEVLGSGMVHPAVFESAGYDTSRYTGFAFGMGVERIAMLKYRIDDIRKFYDNDIRFLGQF... 335
22 1.000e-61UniRef50_Q9A0I1 Phenylalanine--tRNA ligase alpha subunit n=1968 Tax=root TaxID=1 RepID=SYFA_STRP1  ali  59  3LQAQLEELKTKTLETLQSLNHTKELQDLRVAVLGKKGSLTELLKGLKDLSNDLRPVVGKQVNEVRDLLTKAFEEQAKIVEAAKIQAQLDAESIDVTLPGRQMTLGHRHVLTQTSEEIEDIFLGMGFQIVDGFEVEKDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARTDQHDFSKGPLKMVSPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMGDLKGTLEMIIKKMFGDERSIRLRPSYFPFTEPSVEVDVSCFKCGGKGCNVCKKTGWIEILGAGMVHPSVLEMSGVDAKEYSGFAFGLGQERIAMLRYGINDIRGFYQGDQRFSEQF... 346
23 1.000e-61UniRef50_A0A1I2QX15 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A1I2QX15_9FIRM  ali  56  1MKERLQKIQEDAMRQINEAVNLSVLNDVRVAFLGKKGELTAVLKGMKDVAPEDRPKVGQFVNEAXXXXXXXXXXXXXXXXXXXXXKKLKEEVIDVTLPAKRNKIGHRHPNTLVLDEVERIFTGMGYEVVEGPELEYDYYNFEALNIPANHPAKDEQDTFYIDDKILLRTQTSPVQVRVMEKQKP--PIRMIAPGRVFRADEVDATHSPSFHQIEGMVIDKNVTFSDLKGTLTMFVQQMFGKDTKVKFRPHHFPFTEPSAEMDISCFKCGGKGCRFCKGEGWIEILGCGMVHPRVLRMSGIDPEEYQGFAFGVGLERISLLKYEIDDMRLLYENDERFLKQF... 339
24 1.000e-61UniRef50_A0A224A044 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=1 Tax=Lactobacillus curtus TaxID=1746200 RepID=A0A224A044_9LACO  ali  66  1........................................................................................................................................................RDMQDTFYLTPELLMRTHTSPNQARAMENHDNKGPLKMVSPGRVYRRDTDDATHSHQFHQVEGLVVDKHVTMGDLKGTLELVAANLFGDEFDVRLRPSYFPFTEPSVEADITCFNCMGKGCAVCKYTGWIEVLGAGMVHP.................................................... 141
25 2.000e-61UniRef50_A0A1F6P9A2 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1F6P9A2_9BACT  ali  41  1MQEKLKQLKTEALLALKSIKDKAQLEELEVRFLGRKGELTELLKGLKDLSDDAKREVGQLANEVKTSLEEAVSAKKKEFSKIEMAGLLEKESLDISQPALPPKFGHLHPNTIIQNDLEDFFTSMGFMVLDGPELESEYYNFSALNIPPDHPARDMQDTFYIKNHTDWVMRTHTSPVQVRAMQKYGAPLRMIVPGKCFRNEATDVRHEHTFYQLEGVVIDKDISFAHMKGVLESVAKHLYGPDTKINMRPKFYPFVEPGVNLEVTCFVCQGKGCRLCKQSGWLEIGGAGMIHPNVLRESGIDTKVNQGFAFGFGLTRLVMLKYGIEDVRLLESGNMKFLEQF... 343
26 3.000e-61UniRef50_A0A0G1Z0B3 Phenylalanine--tRNA ligase alpha subunit n=24 Tax=root TaxID=1 RepID=A0A0G1Z0B3_9BACT  ali  42  3...KLEDIRTHALSLIEGVSDLLVLDNARTKILGRKSELSLFLRSLKDMPPENQRGVGAAANALRAELEELFEEKRRELSAASYESVLKGERIDVTRPGLKHARGHIHPISRVIKDIVSIFSSMGFEVVEGPEVETEYYNFDALNIPANHPARDMWDTFWLKPESRLLLRTHTSPVQVRYMENHNPPLKIIVPGRAYRYEATDASHEFQFFQLEGLVVDRQISIANFKGVIQEFFSRLFKKEIIVRLRPSFFPFVEPGFEVDISCVACAGAGCSICKKSGWLELAGAGMVHQNVFKAAGYTPGEWQGFAFGFGIDRIAMMKYKIPDIRLFHSGDLRFLKQF... 368
27 3.000e-61UniRef50_A0A1V5XXL8 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Firmicutes bacterium ADurb.Bin182 TaxID=1852884 RepID=A0A1V5XXL8_9FIRM  ali  47  1MNKELERIKLNAMAAVREALTEADIDRISVSVLGRSGSLTEILRGMSRLDKDERAKAGQQANEVKKELETALTERKKELSDAFLRQRLKNESIDVTEPGRRLPRGRLHPMTQVYRQIRDALIGMGFTMFNGPEVELDDFNFTKLNVPPDHPARDMQDTFYVSDSVVLRTHTSPCEARALLELSP--PFRLVIPGRVFRVDEVDATHSPVFMQMEGFAVDRNITLANLKGTIDVFVKAVFGKGVKSRLRPSYFPFTEPSGEVDISCTICGGSGCGVCKGTGWIEIMGCGITNPHELENCGYDPKEWSALAFGLGVDRIAGLKYGIPDVRLLYENDARFLEQF... 340
28 3.000e-61UniRef50_A0A1I4SMZ9 Phenylalanine--tRNA ligase alpha subunit n=53 Tax=Bacteria TaxID=2 RepID=A0A1I4SMZ9_9DELT  ali  54  1MEEQIKELLEQALRDLEAASDLKEIDGVRVKYLGKKGQLTALLRKLGTLDPALRP---VAXXXXXXXXXXXXXXXXXXXXXXXXAVILRIEPFDVTVPGRRPAVGSIHPITQTAREIARIFVQMGFEIVEGPEVELDYYNFEALNIPKDHPARDMQDTFYVSEDVVLRTHTSPIQIRVMEKRKP--PVQIIAPGKVYR-CDSDMTHSPMFHQVEGLMVGKNVSFADLKGVLTLFVHQMFGTHIGVRFRPSFFPFTEPSAEVDIQCVICGGSGCRVCSETGWLEILGCGMVDPAVYGYVGYDPEEVTGFAFGMGIERIAMLKWGINDLRMFFENDIRFLHQFR.. 337
29 3.000e-61UniRef50_A5N254 Phenylalanine--tRNA ligase alpha subunit n=579 Tax=root TaxID=1 RepID=SYFA_CLOK5  ali  56  1MRKKLEQIKENAFKELQDKRKDLDIESIRIKYLGKKGELTHILRGMKELSKEERPIIGKLANDIXXXXXXXXXXXXXXXXXXXXXSRVKGETIDITMPGIKQNIGRRHPLEQVLEDMKEIFVSMGFTIEEGPEVELDYYNFEALNIPKNHPARGEQDTFYINDNLVLRTQTSPTQIRTMEKQKP--PIKMISPGKVYRSDSVDATHSPIFYQMEGLVVDKGITFADLKGTLELFARKMFGDEMKTKFRPHHFPFTEPSAEMDATCFVCNGEGCRVCKGEGWIELLGCGMVHPQVLRNCNIDPEVYSGFAFGMGVDRMVMLKYGIDDIRNMYESDMRFLNQF... 339
30 1.000e-60UniRef50_A0A1R0IQ65 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Sulfobacillus TaxID=28033 RepID=A0A1R0IQ65_SULTH  ali  50  1MDKQFEEWHTEIMQQIHAAQTLSELQSLRSHWLGRRGIITLAMKGLSSLSIEERRSQGQQLNALRETVLELLTSRQQEMELAEETMQLQREQFDMTLPGSWPQTGLLHPITRTRRFIEDVFLRMGFSLEYGPEIEHEWYNFEALNMPANHPARDMQDSFFINPGMVLRTHTSPVQIRAMKKYQGRLPVRIIAPGRAFRRDD-DATHVPMFFQVEGLVIDHGITLADLKGTLTTMAQELLGTDIRTRFRPSYFPFTEPSVEMDVTCASCGGTGCRVCKGTGWVEILGSGMVHPVVLTNGGYDPSQVSGFAFGLGIERLAMRIFGIDDLRLLYQNDMQFLSQFQ.. 342
31 2.000e-60UniRef50_A0A1W9RXM0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=candidate division Zixibacteria bacterium 4484_93 TaxID=1970780 RepID=A0A1W9RXM0  ali  46  1MPEDIQNVQKRFEELIKQVTTLTELDSLKVEYLGKKGIVTGLLKKIPTLPASERKSFGTAVNSLKSLCGRLIQEKRESILKSQETTDV-----DISLPGRKGYLGSRNPIITIIEEITHIFYSMGFEVIEGPDIETEYYNFDALNTPDYHPSRDIQDTFYLA-MPGYLLRTQTSPVQIRTMETHPLPIRMISPGRCYRRDAIDPTHYICFHQVEGLYIDRNVTMAMLKGVLSVFARRLLGKQTQIRFRPHFFPFTEPSVEYDITCTICGGKGCRVCKNTGWLEISGAGMVHPKVLEISGIDPKKFRGYAFGMGVERLAMIKYQIDDIRHFYNNDIRFLSQFRG. 337
32 2.000e-60UniRef50_Q72M80 Phenylalanine--tRNA ligase alpha subunit n=232 Tax=root TaxID=1 RepID=SYFA_LEPIC  ali  43  3LSEELDSIYKEAIQKIGSSISEEDLDKNKNDFIGKKGKLTAVLKNVASLSIEEKKTVGQKANELSKKLETFISETKTSLKKKLFEKQAASEFFDVLRPLSKPSNGSLHPITQIQYEIEDIFASMGFSVMDGPEIETDTNNFGALNFTEDHPAREMQDTFYLENGNLLRTHTSAIQVRTLRKLKP--PFRIIAPGRVFRYEEVDASHEHTFYQIEGMVVGKDISAANLIDTMQVLLSRIFEKEIKTRLRPGYFPFVEPGFELDISCLVCDGKGCPVCKQSGWLELLPCGLIHPNVLSHAGLDPKEWTGFAFGLGLDRLVMMRYGIHDIRYFQSGNLRFLKQF... 341
33 4.000e-60UniRef50_C7RDV0 Phenylalanine--tRNA ligase alpha subunit n=19 Tax=Tissierellia TaxID=1737404 RepID=C7RDV0_ANAPD  ali  46  1MEENLTKVLETFTNEIKAAKSLDDLEKLRIKYLGKKGEITDLKKSIAKLPNEEKPAAGKLINKTSKEIEEKLLXXXXXXXXXXXXXXXXXXXXXVTAHFDKYESGHLAVINQTMEELESIFQNMGFDVVEGPEVDTVKFVFDDLNSPEDHPARSTSDTFYINEEVLLRPHTSSMQIRV--MNEGKLPIKMVSAGRVFRNDEVDATHSPMFHQLECLVVDENVSMANLKATLETFIKEMFGDEMKLRYRPHHFPFTEPSLEVDVTCPICKGEGCPACGNTGWMELLGGGMVHPNVLEACGIDSEKYTGFAFGLGVDRIAMVKYGLDDIRLLYDNDKRFMEQF... 340
34 6.000e-60UniRef50_A0A0S7X4A4 Phenylalanine--tRNA ligase alpha subunit n=27 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0S7X4A4_9BACT  ali  43  2..KRIISLKKEVQKEIKLAKSLRELDQIFRKYLGKKGEITFLLRGLKNFPKKKRLTLGREANLLKKFVKREIERRTERLKEKSEKEIFKKEWIDITAPGKKIPIGHLHPITQVKKEVEEIFQSMGFSVVEGPEIENEWYNFDALNIPKDHPARDFWDTLWL-KLDKLLLRTHTSPVQVRFMEKNNPPLKIIVPGRVFRHEATDVSHEINFYQVEGLMIGKDISVANFKAIIQEFFRRFFRKKIEIRLRPSYFPFTEPSFEVDITCLNCGGKGCSACSKTGWMEMMGAGMVHPNVFKNSGLNLKNWQGFAFGMGLDRLAMMKYKINDIRLFYSGDLRFLNQF... 339
35 9.000e-60UniRef50_B0VGJ1 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Candidatus Cloacimonetes TaxID=456828 RepID=B0VGJ1_CLOAI  ali  47  1MEEELRKLVEYAEKDIFACSSPNDLLNVKAKYLGKKSLLSSLYAQMRNIPVEERPAFGNLXXXXXXXXXXXXXXXXXXXXXNAWKKNEAKAGTDLTMPGIFSSRGGLHPLTIIRREIDEVFLGLGFEIAEGPDIDDDFHNFDALNTPLDHPSRNLADTFYLEGGGLLRTHTSTVQVRVMEKYPP--PIKIISPGRCYRNDKPDPSHSPVFHQVEALVVDKGISLADMKDMLSQFASIMFGKDVSSRIRPHFFPFTEPSAEMDISCVVCGGTGCRVCKYSGWLEMGGAGMVDPNVFDILGIDSEFYTGYAFGLGIERIAMLKYNIPDMRILYENDLRMLRQFKG. 341
36 1.000e-59UniRef50_A7GTL0 Phenylalanine--tRNA ligase alpha subunit n=372 Tax=Bacteria TaxID=2 RepID=SYFA_BACCN  ali  73  26.........................NDVRVAYLGKKGPITEVLRGMGKLSPEERPRMGALVNEVREAIQTRLEEKVSNLEKAVMEAKLASETIDVTLPGRPVETGCHHPLTAVVEQIEDVFIGMGYEVAEGTEVEKDYYNFEALNLPKDHPARDMQDTFYITEETLLRTHTSSVQARTMENNKEKGPIKIICPGKVYRRDDDDATHSHQFMQIEGLVIDKNIRMSDLKGTLQVFVKKMFGEDREIRLRPSFFPFTEPSVEMDISCMMCHGKGCGTCKGTGWIEILGAGMVHPNVLEMAGYDSKEYQGFAFGMGAERIAMLKYGVDDIRHFYTNDVRFLQQFK.. 342
37 1.000e-59UniRef50_A0A2G9YE51 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A2G9YE51_9BACT  ali  45  1MRNNIQQLKNRALKEIEDSSDLETLRNIEIKYLGRKGELTKILRSIKDLPKKKRPLVGQLANEVRRELEKILRIKKQGLEIEKFKDLAQEEWIDVTSRVEGLKSGHLHPNSTLQYELEDIFVSMGFMVLDGPELESDYYNFEALNIPYWHPARDIQDTFYVKSEIDLLLRTQTSSVQVRALEKYGVPLRAIVPGRCFRNEATDASHEHTFYQLEGLMVDKDISIANLVSVMKALLEGIFKKEVKIRLRPGYFPFVEPGFELDISCLICGGKGCSVCKGSGWVELLPCGLVHPNVLKYGGVDPKKFSGLAFGLGLTRLVMMKYGIDDIRLFQSGDLRFLEQF... 381
38 1.000e-59UniRef50_A0A2E9X1M8 Phenylalanine--tRNA ligase alpha subunit n=28 Tax=Bacteria TaxID=2 RepID=A0A2E9X1M8_9BACT  ali  49  1MIQTLQELETEALDAIRAALDGEALEVLRVSYLGRKGRVSGILRGLGDLSADERPPVGAEANRVKEVLQEALEARETEVSASREEIGAPAE--DLTLPARHRWSGGVHPVNQVIDEIWTIFQSMGFVRARGPEADTEWYNFLALNTPLDHPAVDEQDTFYLKDFVLLRSHTSPVQVRTMEKHEP--PIRILAPGMVYRRDSYDATHTPAFAQIEGLVVDEGITFVDFKATLAEFARRFWGPGTKVRFRPSFFPFTEPSAEVDVKRMITMKDGTRVESD--WIEIMGAGMVDPNVLENVGYDPEHYTGFAFGMGPARIALLKYGVPDLRMFFQNDVRFLSQF... 335
39 1.000e-59UniRef50_A0A2A4YDH5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Aerophobetes bacterium TaxID=2030807 RepID=A0A2A4YDH5_9BACT  ali  44  1MKEKISQLNESFTKELDEASSSDQIQNLKIKYLGKKGPIQALMPLLKDCTSDERPLVGKMINELKQDISSKVENRLQTLLRREQNDRISSENEDVTLPGRKRYLGKEHPISSMMQQVLDILIQMGFSVQTTPEIESEYYNYGGLNYPEDHPARDMQDTFYLTKDLLLRSHTTSIQQRIMEKHTP--PIRIVSYGKCYRNETITTRSHVLFHQVDGLYIDKNVTFADLLATKKEFYSKIFEKDVKVRVRPSYFPFVEPGLEIDISCTSCDGKGCRLCKTTGWLEVCGAGMVHPEVLKQGGLDPEVYSGYAWGGGIERLVMLKYGITDIRMFTENDARFLGQF... 339
40 3.000e-59UniRef50_I0GK52 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0  ali  47  4....FDDIKKEFQDKVDKVNNLEELKQIEVFFLGKKGKIQELFKQIKSIADKDRKEFGENVNKLKEYIENTIKEKERKLLDILKEEKLKSEAIDITAPGLIVERGHEHILNKVIEEVKSIFISMGFDVFSGPDIETDYYNFEALNIPEHHPARDMQDTFYLAEKMLLRTQTSPMQIRTMESQKP--PIRMIAIGRCYRRDALDSSHSPQFHQIEGLVVDKNISFANLKATLSEFSKKMFGELTKVRFTPSYFPFVEPGAETSITCVICGGKGCPVCKYTGYLEMGGSGMVHPNVLRNVNIDPEEYQGFAFGWGIERIAMVKYGIPDIRYFLQNDMRFLKQF... 338
41 3.000e-59UniRef50_A0A0G0D5A9 Phenylalanine--tRNA ligase alpha subunit n=43 Tax=root TaxID=1 RepID=A0A0G0D5A9_9BACT  ali  41  1MLEKIKKIKNEAIVNILKTDSIAELENLRINYLGKKSEFNQILKGLKDLNEEEKKAVGPEANKAKKDIQDALEKRIDDLEEM---VDTEKEWIDVTAPGKKIKRGHLHPITIVQRDIEDIFTSMGFEIADGPEVESEFYNFDAVNVPEEHPGRDMQDTFWIEKGTGTVLRTQTSSVQVRYMQTHKPPFRIIIPGRVFRQEATDASHEHTFHQFEALVVGKKVSVANFLYIAETFFSQFFGKKLNVRLRPSYFPFVEPGFEFDISCTNCGGKGCSSCKQTGWLEVGGAGMVHQNVFEAAGYEKGKYQGFAWGFGLERLAMMKYKIDDIRHFHGGDVRFTRQF... 344
42 4.000e-59UniRef50_Q728R9 Phenylalanine--tRNA ligase alpha subunit n=552 Tax=root TaxID=1 RepID=SYFA_DESVH  ali  48  3LLKELESLVPELERGLGQASSLQELEEQRIAFLGRKGRLAQVMAHLPELAPAERPRVGQAANTVKQALTELFEQRKVVLEQAKEAA--ALSRFDPSLPGRMPWRGSLHPVTLVMEEICSVFGALGYDIVTGPEVENDYHNFEALNMPPEHPARDMQDTLYITESILMRTHTSPLQVRTMKSLRP--PVAAIAPGKVYRRDS-DITHTPMFHQIEGFMVDHNVSMAELRGTLTSFLRTVFGGDTRVRFRPSFFPFTEPSAEVDISCCICGGKGCRVCKTTGWVEILGCGMIDPEVFKSVGYDPEVYTGFAFGLGVERVAMLKYGIGDLRMFFENDVRFLSQF... 344
43 4.000e-59UniRef50_A0A2H9SNQ2 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Chlamydiae TaxID=204428 RepID=A0A2H9SNQ2_9BACT  ali  48  1MNKTIDSLRDEFANELRSARSTTDLEHIKVKYLGKKGPLQNLMKSLRDVAPEHRPEVGKLINILKEEIESALEGMQTQLISIEEHDQLQKEIIDITLPGRKKFAGRKHIITQVLDQMIDILVEMGFSVQYGPDIDSDYYNFEALNFPPDHPARDMQDTFYLSSDMLLRTQTSNIQARIMEAQRP--PIRMICPGKVYRNETITARSHVFFHQVEAMYIDIGVTFTDLLATMDQFVAKFFGREIETRYRPSYFPFVEPGMEVDISCLNCHRSGCNLCKHTGWLEIAGAGMIHPEVLKFGNIDSELYTGFAWGMGVERLILLKHGVNDIRLFTENDTRFLAQFPEV 342
44 4.000e-59UniRef50_A0A1F8MBD5 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8MBD5_9CHLR  ali  42  1MQNEIEKIKTEALKQLGGIETVKDLESWRVHYLGKKSPLTQILRGLASLSIEERKAVGAAANQVKNLLETSAVEKGKLLRDVQLKSVAQKESIDISLPGRPYSVGRRHPITEAIEEICDIFVSMGFQVKEGPDVEWDYYNFEALNIPPEHASRDTMSSYWIDEKGKQLLRTHGTAVSARICETMKPPIRTIEPARVYRYEATDATHLNIYHNIDGLAIDKNITMGDLKGVLFEFVRRYFGGERKARFRTDYFPFVEPGGEIAIDCIVCKGSGCRVCGNSGWLELGGCGMTHPDVLRRGGIDPEEYTSFAFGLGLERMPMQRYGIDNIRFLYNNDLRFLRQF... 345
45 5.000e-59UniRef50_A0A202DJ26 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium E08(2017) TaxID=1932693 RepID=A0A202DJ26_9BACT  ali  46  2...NIEELKAKMEEGIAEANTREAVEAVRIKYLGRKGLLPQAMKMLKEAEATERAEIGKGANIFKQKMNAILQEKADSLDAAAG----TAPGFDCSIPGRWQALGSTHPISAVIKETVDIFRSLGFTVADGPDIETRYRNYTALNTPEHHPSMDEQDTFWIEGD-DLLLRTQTSPVQVRVMEKQEPPVRIVTPGRCYRRDTTDATHSANFHQIEGLYVDRKVSLADLKGVLAHFAHKLMGPKVSVRFRPHFFPFTEPSVECDFSCHVCGGDGCRVCKNSGWIEIAGAGMVDPRVFEMVGYDPEEFTGYAFGMGIERIVMVKYGVPDIRMLYENDLRFLEQF... 337
46 7.000e-59UniRef50_A0A212KTZ2 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Chlamydiia TaxID=204429 RepID=A0A212KTZ2_9CHLA  ali  47  1MEQAVEEIRQKFIQDLKSSDSAKAAEDLKVFYLGRKGPIQQLMKGLKDVASDLRPQCGKLINDLXXXXXXXXXXXXXXXXXXXXXVRLESEEVDITLPGRRQFSGRKHPITQMMDVVIEALVEMGFTVQCGPDIESDYYNFEALNFAKDHPARDMQDTFYIAPEVLLRTHTSNVQVRVMETSKP--PIRVISPGKCYRNETITARSHVFFHQVEALYVDDHVSFADLMSAMNEFLSKLFARKVETRFRASYFPFVEPGMEVDVGCLLCDAKGCAVCKHTGWLEVAGAGMVHPEVLKNGGIDPEKYSGYAWAVGIERLVMIKHGIKDIRLFTENDMRFLHQF... 339
47 1.000e-58UniRef50_A0A0S8E3H8 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Bacteria TaxID=2 RepID=A0A0S8E3H8_9BACT  ali  46  5...NLEDLNNQIEQDFATISTLEDLEALRIKYLGRKGILAELTAGIADLPSEQRPQFGQQINRIKQKVSQLLEKKKQGFKDKAPVVKMQAKVMDVTLPGIRQALGHRHLITQVTEEICDIFIRLGFVVVEGPEIETEYNNFTALNIPLEHPSRDMFDTFYIKSHVTRNTLHHTSPVQIRAMQSRKPPLAVVVPGKVYRPDAVDASHSFMFHQIEGFMVDYNIGFSDLKGTLEFFTKSVFGVATKMRFRPHFFPFTEPSAEVDISCIICQGRGCSVCGHKGWLEILGSGMIHPNVFRHVGYDPVRYSGFAFGMGVERIAMLKYGINDIRLFFENDLRFLKQF... 366
48 1.000e-58UniRef50_Q3APW3 Phenylalanine--tRNA ligase alpha subunit n=252 Tax=Bacteria TaxID=2 RepID=SYFA_CHLCH  ali  40  1MEERILQAKQEILEA--PLTTLAELESFRLHFTVRKGLVAALFGELKNVASADKPRIGQLLNELKQTAESRVSD-AEAHLAAAQNSKQQPSLLDLTLPGRRSFCGSEHPVQKVLGDMKSIFNAMGFTIATGPELEVGNYNFDMLNFAPDHPARDMQDTFFVRNTPDVLLRTHTSPVQIRVMLDEKPPIRVICPGKVYRNEAISARSYCVFHQLEGLYIDKNVSFADLKATIYSFAQQMFGSDVKLRFRPSFFPFTEPSAEVDVTCYLCGGKGCRVCKKSGWLEILGCGMVHPNVLRNCGIDPEEWSGYAFGMGVDRTVLLRYKIDDIRLLFENDVRMLQQFK.. 343
49 1.000e-58UniRef50_A0A2A4T5E9 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=SAR324 cluster bacterium TaxID=2024889 RepID=A0A2A4T5E9_9DELT  ali  42  1MKEKLELVENSFRQALAVTSDTKGLEALKVKYLGKKGELSGFMRLLKDIPNDQKAAAGQMINRIKKSFQGQLDDRREELKKVEFEKQMDSEWIDITLDPLQTHAGSLHPVSLVQQRLERIFESMGFQVLDGPHIETEHYNFEALNVPAHHPARDMQDTFYFEDGHLLRTQTSTIQIHGMENLEP--PIRIIGPGKVFRCERTDASHDSCFHQLEGMMIDKDISVSHLIHFMRTMLGEIFESDVKVRLRPGYFPFVEPGFELDISCLLCKGKGCSVCKKVGWIELLGCGMVHPNVLRAGNIDPSIYSGFAFGMGLDRLAMMKYGITDIRPLHGGNLNFMRRF... 339
50 1.000e-58UniRef50_B4U9B8 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Hydrogenobaculum TaxID=168657 RepID=B4U9B8_HYDS0  ali  44  6.....DAILRELNEELASVSSLQDLEKLKSKYLGKTGVVKELSKAIKDIPPEERKTYGSLLNELKENVEELFSQKFLYFKSLEERKNLSKEFVDPTLPPTNQI-GSLHPITLTLDRILSILKSMGFLEQQGPELEKEEYNFDMLNIPKYHPSRDMQDTFYVNKEGYVLR-THTSPIQIRTMLSNKPPIYITAPGKVYRKDD-DPTHSPMFFQVEGLAVDKHINLRHLKYVLDTFLQLFFNKSLKTRYRSSYFPFTEPSFEVDIQCVICEGSGCRVCKQTGWLEVMGCGMVHPNVLRNCNIDPSLYTGFAFGMGVERLAMLYYGIDNIKLFYENDIRFLAQFEQ. 340
51 1.000e-58UniRef50_A0A2M7TSF2 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium (Candidatus Torokbacteria) CG_4_10_14_0_2_um_filter_35_8 TaxID=2014297  ali  39  1MKKKLVSIRSQVIIQIQSVKDKKSLDKIRVDILGRKGKISQILKEIPNFPKSERPKIGKLTNDLKKELETLISQKEK---ELKFSGKGKGLLLDITQPGIKQERGHLHPLTQIRKEIEDIFTSMGYLIYTGHEIVTDYQNYDSLNFKKDHPARDIMDTYWISDKTMPRSHTSSMQV--EIMKKYGAEVKAIVPGRCYRHEATDASHETVFYQVEGLVVGKKINLKNLKATQKTVLSKIFGQEVNVRLRPGYFPFVEPGFELDMKCVLCKGRGCSACKRTGWIELIPCGMVHPNVIKNGGLDPKKYTGFAFAIGLDRLAMMRYEIEDVRHFHSGDLRFLNQF... 336
52 2.000e-58UniRef50_A0A1G0HVX0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_42_10 TaxID=1798285 RepID=A0A  ali  48  2...QLETLLQQAEHAIKSTTSIQDLEQCRVEYLGKKGSLTEIIKTIGQLPPDERKLAGQNINLAKENIEQWIKEKSILLKNNQLKQQLEKETIDITLPGRDTGCGSIHPVTQSIEDLQRIFEQMGFISLEGPEIEDDEHNFTRLNTPPFHPARAMQDTFYFPNGLLLRTQTSAVQIRAMKYMQP--PLRMISIGRVYRR-DFDLTHTPMFHQIEVLVIDEDATLATLKHLLTQVLQAFFAREVTIQFRPSYFPFTEPSLEVDIGCIACNGRGCRVCKQTGFVEVLGCGMVHPHVLKMADVDTKRYRGFAVGAGIDRLTMLKYGILDLRSLFENDVRFLKQF... 338
53 2.000e-58UniRef50_A0A2N2MUF9 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A2N2MUF9_9CHLR  ali  43  8..QELEDALAKGLEDLKSVASEEALLAWRNQYLGKNTAITQAFQSLGKLSAEMRPQVGQAANRVKVALEAALAERSESIKESALAASIASEKLDVTLPGRPMTPGRLHPDTQMLRELYRVFGEMGFQVYRSREVETDEYNFQLLNFPVGHPARDMQDTYFVDNPIVMRTHTSPGQVRSMREYENPPAIRLVLPGMCYRYEQTDARHETQFDQIEGIAVGEGITFSNLKATLSDLARRLFGQNVRTRFRASYFPFTEPSAEFDVECFLCGGKGCAVCGG-GWLEIGGCGMVNPNVLRNGGYDPERYSGFAFGLGPQRIAMLRYGINDIRYFWENDLRFLEQF... 356
54 2.000e-58UniRef50_A0A1C7GPE4 Phenylalanine--tRNA ligase alpha subunit n=53 Tax=Bacteria TaxID=2 RepID=A0A1C7GPE4_9FIRM  ali  39  1MKERIEGLRQSFEQELQRAGSSDAVEKLRVAYLGKKGSVTELLKGLKEVGAEQKKELGQHINALKRGVEERLSERIEEIRVAEEQREIEAAEQYDVTLPVAGDPGSYHPITIVQRQLEEVFTSMGFIVEDFKEIVTDYECFEAVNIPKDHPARDMQDTYYLENGQLLKTHTSAAQNFILRKYG--APVRAIFPGRCFRNEATDASHENTFFQMEGIMVDKNISISNLIYFMKTMLSEVFERDVKVRLRPGFFPFVEPGFELDISCLICGGEGCSTCHHSGWVELCPCGMIHPNVLKLGGVDPEEYTGFAFGLGLTRLVMMKYGVKDIRDLNSGNLKALSQFRH. 341
55 2.000e-58UniRef50_A0A2H0U9Y6 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=11 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2H0U9Y6_9BACT  ali  51  9.......................................................................................................RGHLHPISSLVREAHAIFHAMGFELAEGPLLESEWYNFDALNVPKDHPARDMQDTFFIKDEYVLRTHTSPVQVRYMEAKRKAGPYRVIVPGKVFRNEATDMTHEAEFFQIEGLAVGEDVSLAQLKGTLRFFAELFKGASVEIRFRPSFFPFVEPGVEVDMRVV---GESAPEKLRDKWIEMMGAGMVHPSVLENAG............................................. 207
56 3.000e-58UniRef50_A0A150LPM6 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A150LPM6_9BACI  ali  76  183.........................NEVRVAYLGKKGPITEVLRGMGALSPEERPVIGALANEVXXXXXXXXXXXXXXXXXXXXXKKLAAEAIDVTLPGRPVRRGNHHPLTRVIEEIEDLFIGMGYTIAEGPEVEKDYYNFEALNLPKGHPARDMQDSFYITEEILLRTHTSPVQARTMEKHQGRGPVKIICPGKVYRRDNDDATHSHQFTQIEGLVVDENIRMSDLKGTLREFARKMFGEDREIRFRPSFFPFTEPSVEVDVSCFHCGGHGCSVCKGTGWIEILGAGMVHPNVLEMAGFDSKKYTGFAFGMGPERIAMLKYGIDDIRHFYQNDIRFLQQFHRV 501
57 3.000e-58UniRef50_A0A136MXA2 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A136MXA2_9BACT  ali  46  8LQNQLESIRQEALAELSAASDLRALEEVRIHFLGRKGKIKDLLKSLGSLPPDERPLVGAQVNRLHDEVELELNNTRINLEEKALEARLAGEKIDISLPGRDADIGAFHPVSLIIDEIASLFLRMGYDVYDDREIETDYYNFEALNFPADHPARDMQDTFFLDGGLLLRSHTSNGQIHYMENHKP--PLKVIVPGRVYRRDS-DPTHLPMFHQVEGLVVGKGVSMANLKWTLETMMKALFGPDSTLRLRPSFFPFTEPSAEVDMWFDTGNGQG-------RWLEMGGAGLVHPNVLLACQIDPEEWSGFAFGMGVERLAMIRYRVPDIRMFYENDVRVLEQFRG. 340
58 3.000e-58UniRef50_A0A1B1FUL0 Phenylalanine--tRNA ligase alpha subunit n=50 Tax=Bacteria TaxID=2 RepID=A0A1B1FUL0_9BACT  ali  45  1MLEQIKKIEEQIEKA--TAATKEDLENFRVGVVGRKGIIADLFSKMKEVAPEERKTFGQTVNALXXXXXXXXXXXXXXXXXXXXXDIN---HHDLTLPNVPNEMGTVHPITKVREEISRIFERVGFNISEGPEIEDDWHNFSALNFPPNHPAREMQDTFFLEKDPDIALRTHTSSVQVRVMENQKPPIRTLSPGRVYRNETISARAHCIFHQVEGLYIDKNVSFKDLKDTLYYFAKEFFGPNTKIRLRPSYFPFTEPSAELDVSCTVCGGKGCNICKYTGWVEIGGCGMVDPNVLKASGIDPEEYTGFAFGMGIERMTMLKYRINDLRLFTENDLRFLRQFSSL 339
59 4.000e-58UniRef50_A0A0G1TVC9 Phenylalanine--tRNA ligase alpha subunit n=28 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G1TVC9_9BACT  ali  42  14LQKDFGELKNRADNEIEASANLQELDAIFRKYLGKSGELTHFLRSLKDLPDFERREAGLKANALKNELLAAFAQKKSGLSEKSGQEMENSEWFDITVPGQKREAGHLHPLTLVRRQASEIFQQMGFSIALGPEIENEWYNFDALNIPKDHPARDIWDTLWLNKNKKLLLRTHTSPVQIRHMEKENPPLRIIAPGRVFRHEATDASHEVNFYQIEGLMVDKDISVANFKAIIQEFFRRFFAFPPEIRLRPSYFPFVEPGFEVDIACLSCGGKGCSACSQSGWLEIMGAGMVHPRVLEAVKLNPKDWTGFAFGMGLDRLAMMKYKINDIRLFYGGDLRFLKQF... 367
60 5.000e-58UniRef50_Q8ZDX0 Phenylalanine--tRNA ligase alpha subunit n=1241 Tax=root TaxID=1 RepID=SYFA_YERPE  ali  53  4....LAELVAKAKAAVEGAQDIAALDLVRVEYLGKKGHLTLQMTSLRELPAEERPAAGAVXXXXXXXXXXXXXXXXXXXXXAVLNARLAAETIDVSLPGRRMENGGLHPVTRTIERIETFFGELGFSVESGPEIEDDYHNFDALNIPAHHPARADHDTFWFDATRLLRTQTSGVQIRTMQEQQP--PIRIIVPGRVYRND-YDQTHTPMFHQMEGLIVDRDISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMG-----------KNGKWLEVLGCGMVHPNVLRNVGIDPEIYSGFAFGMGMERLTMLRYGVTDLRAFFENDLRFLKQFK.. 327
61 6.000e-58UniRef50_A0A0G1KZ67 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=candidate division Kazan bacterium GW2011_GWA1_44_22 TaxID=1620410 RepID=A0A0G1K  ali  44  1MGEQIKKILETAESAIALCADELALQLAEAKFLGRKSQLAELMSNLSGLSPEERKTAGMLLNEAKQTIAELVAKKRAELGLVKQKLALSRD---VTLPGIRPEIGHLSPLTYINRELVDIFKELGFEVAEGPEAETESNNFDLLNIPANHPARDQWDTFWLDGNDNTLLRTHTSPVQIRFMLAHQPPIRIIAPGRAFRYEAEDATHSAVFSQIEGLMIDKEINVAHLKATVLHFVRRILGEERNIRLRPSFFPFTEPSFEVDVSCGLCEGKGCKSCSHKGWLELMGAGMVHPQVLRNVGIDPEVYSGFAFGAGIERLTMLKYGITDIRLFLNGDMRFIKQF... 342
62 1.000e-57UniRef50_A0A0G1ME59 Phenylalanine--tRNA ligase alpha subunit n=73 Tax=root TaxID=1 RepID=A0A0G1ME59_9BACT  ali  42  69MQQKFSDLKKTFDAALADLKDGVDLEEIKNKFLGRKGYLATLMKEMADLADDERKAIGRLANETKMAMEEGFARAEA---ARKTNQILEGEWLDVSEPVFPADHGHLHPVTRVQEELEDLFTSMGFMIADGPELESDFFNFTALNIPPTHPARDMQDTLYIKNHPDQVMRTQTSPVQVRAMRKYGAPLRLVVPGRCFRNESTDARHEHTFYQLEGLVVDKGINFAHMKASLEKVAKHLFGEEAEMRLRPKFYPFVEPGVRGEVTCFLCHGKGCRVCKNSGWLEVLGAGLVHPNVLREGGVDPNEYQGFAFGFGLSRLAMLKYNIDDARLMQGGDVRFLQQF... 407
63 2.000e-57UniRef50_A0A0K2JGI1 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=cellular organisms TaxID=131567 RepID=A0A0K2JGI1_SPIKU  ali  47  1MEKELDLLFTQATKNIKAAKTVEEVNAVKLKYLGKKSMLNDLLKKMKDLRHQERLTIGQKANQIKVELTELCQVKKTELENALLIATIEQEKIDLSLPGDNLVLATKHPLNQVIDEISQLFQELGYDIVFGTEVDDDEYNFQRLNLPLGHPARDMQDTFYLSKNKLLRTHCTNMTARVSQMKSKNEIIAMISTGNTYRRDDDDSTHSHQFMQVDGFLVAPNITFANLKWTIQYFCQRMFGEATQIRLRPSFFPFTEPSVEVDVTCVNCKGKGCSICKQTGWIEIMGSGMINPLVYQACGQDPE-LTGFAFGIGIERIAILKYGIDDIRRFYTNDIRFLEQFKK. 343
64 2.000e-57UniRef50_A0A1V6M1Y2 Phenylalanine--tRNA ligase alpha subunit n=34 Tax=Bacteria TaxID=2 RepID=A0A1V6M1Y2_9BACT  ali  52  26.........................EQLRVKYLGRKGIVNDLMKRIPTLPIEKRVDFGRQVNSLKNEIADSIDALIKRLSAQSV-STSKAELFDISLPGKPQFVGKKHPLTQTIDDVKEVFACLGFDVAYGPEVELEYYNFEALNIPADHPSRTDFDTFYIKDDVLLRSQTSTVQIRIMENQKP--PIRIIAPGRVYRPDTVDARHSFMFHQVEGLLVDEGVSFADLKGVLYQFIKAYFGQNIQMRFRPSFFPFTEPSAEVDISCSLCEGKGCSVCSYSGWVEILGAGMIDPNVFKAVHYDGEKYTGFAFGMGVERITMLKYGIGDIRLFYENDLRFLLQF... 338
65 2.000e-57UniRef50_A0A1V4Y322 Phenylalanine--tRNA ligase alpha subunit n=28 Tax=Bacteria TaxID=2 RepID=A0A1V4Y322_9DELT  ali  55  27..........................AVKTRYLGRKGLLTGLLRNIAGVPVEERPLFGKRSNEVKEALIRKIDSALQDIAFRNRGEALLREKMDVTLPGRGIRYGRLHPVTQIRREITEIFSMLGFSVEEGPEVETDYYNFEALNIPKNHPARDMQDTFYVEENIVLRTHTSPVQIRTMEKRKP--PVRILSPGRVYRPDS-DVSHTPMFHQIEGLLVDRGITFGDLKGTLTFFIRKVFGEATAIRFRPSFFPFTEPSAEVDIRCVMCHGSGCRVCGQSGWLEILGSGMVDPQVFINVGYDPEAVSGFAFGLGLERIAMLKYGVSDIRLFYENDRRFLEQF... 338
66 2.000e-57UniRef50_A0A2H0DLY1 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Bacteria TaxID=2 RepID=A0A2H0DLY1_9BACT  ali  48  7.EQRLRGLEDSAVASVSGATDLESLEAVRVDLLGRKGRLTGLLKGLKDLTIDDRKTLGPQANRLRDEVARLIEDRRTSLERAAIDAELASVSLDASLPPRDLGLGRRHPITKTIEDMAGILSRLGFAWADGPRVESDRYNFTALNIPEDHSARDMQDTFYLENGQLLRTHTSPVQIRYLEKHAP--PVRIMAPGRVFRHEAEDAGHAAVFHQIEGLYVDRGVTMADLKNTLSVFMKGLFGAQTKIRMRPSYFPFTEPSAEVDVQCLLCKGDGCSACKQSGWMEMLGSGVVNPAVLKGVGLDTEIWSGFAFGVGVERIAMLRLGIPDIRMFYENDLRFLRQ.... 343
67 2.000e-57UniRef50_A9Y6V7 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=75 Tax=Bacteria TaxID=2 RepID=A9Y6V7_LACLC  ali  66  1................................................................................................................................................................................RTMDAHDSKGGLRMIAPGRVYRRDTDDATHSHQFHQIEGLVVDKNITMADLKGTLDLVMKKMFGQERELRWRPSYFPFTEPSVEVDISCFKCGGKGCNVCKHTGWIEILGAGMVHPXVLEMSGLDSSVYSGFAXGLG............................... 138
68 3.000e-57UniRef50_A0A1V4IS78 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=root TaxID=1 RepID=A0A1V4IS78_9CLOT  ali  41  1MEDIIIQLKDAVDKALQQVNTIEEAEQVRISFLGKKGELTNILKSLSKYSIDERKLIGAKGNKLKNYITEKVEEL-----KDKFEKSDLKSKFDITLPASDFEEGTYHPITIVQREIEEIFKGMGFMIADTDEVETDYYNFEALNIPKYHPARDMQDTYWLENGMVLRSQTSAGQQHIMHEYKP--PIRAIIPGRCFRNEDIDASHENTFYQLEGIVIDKDISVANLMYTMEIMLSEVFGRKTEVRLRPGYFPFVEPGFELDIKCQICGGKGCPTCKHSGWLELLPCGMIHPNVLKYGGIDNEKYTGFAFGLGLTRLAMMKYGIPDIRVFNSGNLKILKQFK.. 335
69 5.000e-57UniRef50_A0A2G9Z071 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2G9Z071_9BACT  ali  45  5...NLKTLKNKAKKEIEKIKDLKGLNEVFNNYLGKKGELTLILRSLEKLPKAKRIKIGKAANELKNILKVEFDKKSQETKERIRKEAEKKEWIDITVPGERPVFGHLHPLTITRRKCEEIFQTMGFTVVEGPEIETEWYNFDALNIPKDHPARDLWDTFFLKNGLLLRTHTSPVQI--RYMEKNNPPLRIIVPGTIFRHEATDVSHEFQVFQIEGLMVDKKISVANLKAIVGEFFRRFFEKEVQFRLRPDFFPFVEPGFDISVTCLICGGKGCPVCKKTGWLEMAGAGIVHPNVFKNSKLIAKDWQGWAFGFGLERLTMLKYKINDIRLFRSGDLRFLQQF... 340
70 6.000e-57UniRef50_A0A2E2WU85 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A2E2WU85_9G  ali  44  6LKKDLKKILEEASKSIKNIKSISDLEKSRVQFLGKKSLLISLMKSLSNLSKEEKSVAGKNLNDVKNEINDLLAEKKVSLSKINDVKKDNFD---LSMPGKASSVGSMHPISKTMECAIQIFESLKFECVEGPEIEDEFHNFTALNIPDSHPARAMHDTFYIENNLLLRTHTSSVQVRA--MSEKTAPIRIIAPGKVYRKDS-DITHTPMFHQIEGLYVDKEVSFSNLKSIINIFLKSFFEEDLKIRFRPSYFPFTEPSAEVDIEYIDS-------KGNKSWLEILGCGMVHPNVLDMANIDSSIYSGYAFGLGVERLAMLKLGITDLRLFYENDLRFLKQFQRI 337
71 8.000e-57UniRef50_Q5F9U0 Phenylalanine--tRNA ligase alpha subunit n=2780 Tax=root TaxID=1 RepID=SYFA_NEIG1  ali  45  2..ENVNRIVAEGIAAVEAAQDFNALEQIKARYLGKTGELTGLLKTLGQMSPEERKTIGAHINECKNRFQTAFNAKRDALNEAKLQARLAAEALDITLPGRAQEGGSLHPVTLTLQRVVELFHGMGFEVADGPEIEDDFHNFQALNIPANHPARAMQDTFYVENGDVLRTHTSPIQI-RYMLDKKEPPIRIIAPGRVYR-VDSDATHSPMFHQAEGLWVEEGVTFADLKAVFTDFIRRFFRDDLQVRFRPSFFPFTEPSAEIDIMG-----------ENGKWLEVGGCGMVHPNVLKNVNIDPEKYTGFAFGIGLDRFAMLRYNVNDLRLFFDNDLNFLKQFE.. 329
72 8.000e-57UniRef50_A0A1J4VHR0 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1J4VHR0_9BACT  ali  46  8.......IAAEAKDHINSCQDKVALDAARVKYLGRKGIIAELFSKLSALPQEERKVFGASLNVLKQAIEESLRQKEEALSASRDPTSHGALDLDITLPGKKPMLGRQHPLTQVETEICDIFGRLGFKAFEGPEVETEYNNFEALNIPLEHPSRDAFDTFYIKEFSGSRVDEHTSPAQIRALKACHPPMAVVVPGRVYRPDAVDASHSFMFHQVEGIAVSEKIRFSDLKGVLMAFATEMFSEKTKLRFRPSFFPFTEPSAEVDIACFLCAGYGCPVCKKSGWLEIGGCGMVHPYVLKSGGCDPKVWRGFAFGMGVERIAMLKFGIKDIRMFFENDIRFLEQF... 370
73 1.000e-56UniRef50_A0A2D3R8I6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Legionella endosymbiont of Polyplax serrata TaxID=2005262 RepID=A0A2D3R8I6_9GAMM  ali  39  3.EKDIDILKKEIQIAIDRVDNLSLLEKIRIKYLGKNGCLKKIIKNLLNLSIDQRPIIGNKINKIKNEIEILFLKKKNFLKKKELLEKLSTEYLDISLSGRNNHCGSFHPITQVKHMVYDYFSYFGFDFINGPEIETKFYNFEALNISNHHPACTEQDTFYINNSDKLLR-THTTTIQIRMIENCLPPLRLISLGKVYRKD-FDRTHTPMFHQVEGLWIDKSINLSNLKWLLEDFFNYFFKKKIVLRFRSSYFPFTEPSAEMDIRCINCSGAGCKLCKFIGWIEVLGCGLVHPNILNNINSAFKDYQGLAFGIGLDRLAMLYFGIDDIRIMFENDLSFLRQF... 340
74 1.000e-56UniRef50_W0GLM9 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Entomoplasmatales TaxID=186328 RepID=W0GLM9_9MOLU  ali  48  1MEKELQELIANAIKEINTSSSLEELNNMQIKYLGKKSTINDLLRGLKDLKHEKRVAMGALANKAKSELTTLWQTKKQELELVYLNNKLENEKIDLTLREYQLKFANKHPLNIIIDEISQIFQELGYDTVFGPEVESDEYNFQQLNLPVSHPARDMQDTFYISDSILLRTHCTNVTARISGMTSQDQVLAIISAGNTYRRDDDDATHSHQFMQIDGFLVAPNVSFANLKWTLQYFCQRMFGDKTQIRMRPSYFPFTEPSVEVDVTCICCGGVGCNLCKFTGWIEILGAGMINPLVFEACGQ-SKDLTGFAFGIGIERIAMLKYGVDDIRRFYTNDLRFLDQFKG. 343
75 1.000e-56UniRef50_D4TSR1 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=cellular organisms TaxID=131567 RepID=D4TSR1_9CYAN  ali  52  5LEDQLLALREEAQTAIAQTETRERLEELRVNYLGKKGQLGVLLRSMGNMSAEERPKIGAIANTVKDSIQERLELRRRELEAQEIERQLELETLDVTMPGTYRPQGKIHPLNGIIDQAIDIFMGMGYTVAQGTEMETDYYNFEALNTPPDHPARDMQDTFYLPDGNLLRTHTSSVQIRYMEKEEP--PVRIVAPGRVYRRDDVDATHSAVFHQIELLAVDEGLTFTDLKGTVKVFLQSMF-GDLPIRFRASYFPFTEPSAEVDLEW------------NGRWLEVMGCGMVDPNVLKSVGYDPEIYSGFAAGFGVERFAMVLHQIDDIRRLYNSDLRFLRQF... 330
76 1.000e-56UniRef50_A0A1W9VTV6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Cloacimonetes bacterium 4572_65 TaxID=1972455 RepID=A0A1W9VTV6_9BACT  ali  44  24.......................ELLNVKSRLIGKKSALTELMKTMKEVPAEKRREFGKMINETKNYLQELIDTRNGVIDELIYKEQIESSRIDLTMPGRRTVQGGLHPLTKIWREIEDTFISMGFEIADGPDVEDEFHNFDALNAPADHPSRDLADTFYVKDNVLLRTQTSTIQIRVAENHNP--PIRIIAPGRCYRNDKMDASHSPVFHQVEAFVIDENVTFADLKDTLNIFVKLMFGKGVKSRIRPHFFPFTEPSAEIDISCVSCGGEGCRICSGSGWLEMGGAGMVDPAVLQNVGIDSEKYTGFAFGLGIDRITMLKYNIPDIRVLFENDLRFLKQYK.. 340
77 1.000e-56UniRef50_Q319M1 Phenylalanine--tRNA ligase alpha subunit n=48 Tax=Terrabacteria group TaxID=1783272 RepID=SYFA_PROM9  ali  47  20IEEKLNNLSLTAKNNIDNASTHEELDKLRVSLLGKKGDLSIILKIMGQLSAAERPIVGQKANFIKINLQDLLNKRKNQLNNEALDQQIKNEKIDVTIPSIGTPPGSKHPLISTQDEIIDIFCGLGYTVESGPEIESDFYNFESLNIPKNHPARDMQDTFYLDENRLLRTHTSPVQIRYLEKNPP--PVRIIAPGRVYRRDAVDATHSPVFNQVEVLCIDQDINFSHLRGTVLTFLKTFF-GDIPVRFRASYFPFTEPSAEVDVQW------------KGKWLEVMGCGMVDPKVLEKLGIDSEKWTGFAAGLGVERFCMVRHQIDDIRKFYTNDLRFLEQF... 345
78 2.000e-56UniRef50_A0A2A4MEA2 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A4MEA2_9BACT  ali  48  1MTDQIQKVRAEFSSDLESLSSENXLDQIRIKYLGRKGLVASLFVQMGTVAADERPKMGQVLNELKSDITAEIDGISSTVSDS---SKSATPHIDYTLPGDPIPVGSIHPLTQVMEEIKSIFLRLGFSIXYGPEIDTDFYNFEALNIPXHHPARDMQDTFYITDNVLLRTHTSDTQIHFMENHEP--PVRIIAPGRVYRNEDVSVRSYCLFHQIEGLYVDSKVTFAELKGTLDYFARELFGQNVKTRFRPSYFPFTEPSAEMDVSCIFCKGKGCGICKKTGWLEILGCGMVDPEVYKSVNYXPEKWTGFAFGMGIERMAMLKYGVQDIRLFYSGDVRFLRQF... 337
79 3.000e-56UniRef50_B2IUA1 Phenylalanine--tRNA ligase alpha subunit n=34 Tax=Cyanobacteria TaxID=1117 RepID=SYFA_NOSP7  ali  50  5LEAQLLALRQEGEKAIAAADTLERLEELRVNYLGKKGELGALLRSMGQMSAEERPKIGAIANTVKESLQTSLDQQRVALEAAQIQVQLEAETLDVTMPGIYSPQGRIHPLNGIIDRALDIFVGMGYTVAQGPEMETDYYNFEALNTPPDHPARDMQDTFYLPDGNLLRTHTSSVQIRYMEREEP--PIRVVAPGRVYRRDNVDATHSAVFHQIELLAIDEGLTFTDLKGTIKVFLQAIF-GDLPIRFRASYFPFTEPSAEVDLQW------------NGRWLEVMGCGMVDPNVLKSVGYDPEVYTGFAAGFGVERFAMVLHQIDDIRRLYASDLRFLQQF... 330
80 3.000e-56UniRef50_A0A1W9NBX6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Spirochaetaceae TaxID=137 RepID=A0A1W9NBX6_9SPIO  ali  40  1MLEKLKNLEESFRQALKNIDSEAKLADLKARFLGKKGELSAILKTLSNASMEERKKLGQAANELKDRLTARLEEAKLILDRKITDAKLAADWTDITLMAESVKESGQHPLSIVQRELEDIFLSMGFDILDGPHIETDWYNFTALNIPESHPARDMQDTFWFKDMKHLLR-THTSTIQIRGMEHKTPPFRFVAPGKVFRCETTDASHEAVFHQMEGMLVGKDISVAHLIYFEKTLLSEIFQREVEIRLRPGFFPFVEPGFELDINCLICSGKGCSVCKQTGWVELLPCGMTHPNVLRYGGIDPEEYTGFAFGLGLDRLVMMRYGIDDIRLIHSGNLDFSRQF... 344
81 5.000e-56UniRef50_A0A2V5NB25 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5NB25_9BACT  ali  40  5..DDIEPLKQAALTELKSAPDLATLDQAKGNWIGAHGKFTALMKQLGSLSKEDRPAAGKLINQAKIELEAALAARREELELKAALPK---EPTDFTLPGRRRALGKLHPLTQVTEDIVRVFRKIGFAVADGPEIEDEYHCFDALNTPADHPARDMQDTFYVSERKSLLLRTHTTSVQVRVLESQQPPVRIIVPGRVYRRDNADATHNPTFQQIDGVYVDKGVTVSDLKGTVEFVFQQVLGEDVKIRFRPHYFSYTEPSFEIDFSSPLTRKIG------KEWLEIAGCGMIHPAVFENVGYDPEVWTGWAFGFGIERIAMIRYGISDIRLFYENDVRFLRQF... 350
82 7.000e-56UniRef50_A0A286RC45 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Thermogutta terrifontis TaxID=1331910 RepID=A0A286RC45_9PLAN  ali  45  2.....DDILQQLRQDLDAAQDSKQLEQVRIKYLGRKGLITTLAKSFSRLSPEEKRSFGQRLNTLXXXXXXXXXXXXXXXXXXXXXRVRRIAGLDLSLPSIDRRMGSIHPIALVQMELEEIFQGMGFRVLTGYEVELEYYNFDALNIPPDHPARDMQDTFWLENGMLLRTHTSANQVRALETYG--VPLRAIFPGRCFRNEAIDASHENTFYQLEGLLVDRDISVAHLIAVMKTLLSQVFRREVTVRLRPGFFPFVEPGFELDVQCLICGGKGCSTCKQTGWIELIPCGLVHPKVLEYGRVDPQVYSGFAFGMGLTRLAMMKYGIPDIRLFNSGDIRFYEQF... 337
83 1.000e-55UniRef50_A0A291IRJ9 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Mesoplasma lactucae ATCC 49193 TaxID=81460 RepID=A0A291IRJ9_9MOLU  ali  44  1MKDKIQHILDGFNKEIKKVKTPNELEEVRRQFAGKNSPLVEILKGMKQATPEEKKEIGQLTNDARSEINSQINELNEQFQQEILNEKLKKEQVDVSLPGERLGFGTLHPLNLVIDEIANIFEELGFQMISGTEVDSDEFNFQKLNLPKGHPARDMQDTFYIDEDTVLRTHSTNMTSHTELSKNNGHNLACISYGNVYRRDDDDATHSHQFMQIDGFAVGDNITFANLKWLLTYMCQRLFDEKARVRFRPSYFPFTEPSVEADISCFKCDGEGCDLCKQSGWIEVLGAGLINDQVFEENGFDPKSISGLAFGIGIERIAMLKFGIANIRDFYENNVQFLEQFK.. 344
84 1.000e-55UniRef50_A0A1Y5F966 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Bacteria TaxID=2 RepID=A0A1Y5F966_9PROT  ali  43  1MIEKLDSLYKEFEEKITGLGNQADILNLKSEYLGKKGHISEVLKSLKNATNEERKLIGPKANEIKNEITNSVAKKLTFIETEEINKKLANEKIDITVRSNNNYSGGFHPRTLIQREIEDIFLSMGFDILDGPHIEDEFHNFEALNIPGDHPARDMQDTFWFHDPNKHLLRTHTSTVQVHGMQARKPPFKFIAPGTVFRCERTDASHEMVFNQLEGMMVGENISVSHLIYFMKTILKEIFKKEVEVRLRPGFFPFVEPGFELDIKCLICSGKGCSVCKQVGWLELLPCGMVHPNVLKAGGIDPEKYNGFAFGLGLDRLVMMKYGIDDIRHLQSGDLRFNSQFR.. 352
85 1.000e-55UniRef50_A0A2A5AJ95 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2A5AJ95_9BACT  ali  49  1MNPKLEAIWNNLNEESSKIKNTKDALTLKGKYIGKQGLVPSLLKAIKDLPIEEKKTFGKEVNQLKVKIQDKLFSLV------ESFENKSSSSIDLSMPGIQTKTGTLHPISKTIQEVTHIFKKLGFAVETGPEIENDYYNFEALNIPQHHPARDTQDTFFIDQKHVLRTQTSGIQIRTMENQKP--PIRIIAPGKVFR-VDHDVTHSPVFHQIEGLMVDKDINFRHLKYILRLLIHELFGKERAVRFRPSFFPFTEPSAEMDVECFKCGGKGCRLCSNTGWIEILGCGMVDPNVLTGVGINPDEYSGWAFGVGIERIAMLKYAITDIRLFYENDLRFLQQFQ.. 333
86 2.000e-55UniRef50_A0A2H5WTR5 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5WTR5_9BACT  ali  45  2..ETVQQLLDQARAEIERCGSTAELDAVELRYLGKKGAIGALLRQIGSLPPEQRPTFGQAVNQAREQIEQWLDTRRAQLERLELAQRLQAERIDITLPGMPIRPARLHPLTLTMRRVKAALIGLGFEFVEGPELEHFRYNFGALNYPEDHPAMDEQNSFHVGDGWLMRTQTTAIQGRIFEQVQRTLPLRIAIIGRCFRYENVDATHSHTFHQVDAFMVDEGVSMAHLKGTLTQFARMMFGQEVHVRFRPDYFPFVEPGVDFAISW------------KGGWLELGGAGLIHPNILENYGIDSERYSGFAFGLGIERIPMLQYGIDDLRLFLENDLRFLTQFPLL 334
87 2.000e-55UniRef50_A0A0G1B862 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G1B862_9BACT  ali  39  33LQEKFKKIKQEIIDELQRTKTLEQLDDLQKKYFSRTGELTKLVKEIKNVAEAERPKIGKIANEVKK-EAVEMFERIKKNLETGKQSQDNSRIFDPTIPGKKEEAGRLHILTQMRREVEDVCVGMGFMIVDGPELESEWYNFEAVNVPAWHPARDMQDTFYIKKSRNLVLRTHTSNVQVRAMEKYGVPLRCIAPGRTYRNEATDARHEHTFHQVEGLMVDKNISIANFKAVFDAIVKAILGADFKTRIRPGYFPFVEPGFEVDLSCALCQGQGCRVCKHTSWVEFCGAGMVHPNVLKTGGVDPKKYSGFAFGFGLERLTMMRYGINDIRLFHSGDLRFLRQF... 393
88 2.000e-55UniRef50_A0A1G5E875 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1G5E875_9FIRM  ali  41  1MDNKINVIKDEIKQKLANTTDLVDLDKIRVAYLGKKGSITALLKGMKELSNEERKSFGAEVXXXXXXXXXXXXXXXXXXXXXEIEREISAMPQFDITVLPELARGSYHPITLVQRQCESIFKSMGFTVEDYPEVVTDYECFEAVNIPKDHPARDMQDTYYLENGQLLKSQTSAAQNAILKKYAKDIPIKSIFPGRCFRNEATDASHENTFFQMEGIMVDKDISISNLIFFMKTMLSEVFQRDIKVRLRPGFFPFVEPGFELDISCLICGGEGCASCKHSGWLELCPCGMIHPNVLREGGIDPDKYTGFAFGLGLTRLAMMKYKIKDIRDLNSGSLKALAQFTD. 347
89 2.000e-55UniRef50_A0A0T6AP17 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A0T6AP17_9BACT  ali  41  1MQDEIARLRQEAEHDVVVAETAGALEEVRRIYLGRRGRLAVLFDRLPQLPESERRAAGQALNEVRAQIEERFRRRAAVVAGRDRSAQLEQERLDVTLPGWHRHLGRRHILSRTVEEVQEIFIRMGFDLVDGSEVETDECNFEHLNIPRDHPARDTMDTFYISDELLLR--THTTVVDARIMRERRPPMRVLAAGRCYRRDVVDATHMPVFHQVDGFMVGEGITFADLKGVLLAFARQMFGQEARLRFEPDYFPFTEPSAQVAVWF------------NDTWLELGGCGMFHPRVLEMAGIDPERYTAFAFGGFGDRVVMARYGIPDIRLFWENDLRLLRQF... 327
90 2.000e-55UniRef50_B2KBL6 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Bacteria TaxID=2 RepID=B2KBL6_ELUMP  ali  49  7.KEKCSAAEAEYRDIISNAASSDALEAARVNCLGRKGVLTELLKNLKDFTIEEKKEAGPLGNKIKKDLEDAFYSKKNALESAALNEELAKTNIDLTLPGWPVANGHKHPLTIAMDRMTAILSKLGFVWAEGPQIEEEKYNFDFLNIPLHHPARDVQDTLIIKKGMVLRSHTSNVQV--RYMEKNKPPLRIMSPGKVFRRDDIDASHSPVFHQIEGLYVDKNVSLADLKSDLTAFMKGLFGNKAEVRFRPSFFPFTEPSVEVDVKCVFCDGKSCSFCKGTGWKEMLGAGIVHPNVLRNVGIDPEIYSGYAFGMGVERLAMLMLGIKDIRAFYENDLRIWKQF... 349
91 3.000e-55UniRef50_A0A1Q7D9I3 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Bacteria TaxID=2 RepID=A0A1Q7D9I3_9ACTN  ali  45  6......RLRDQALAAIARASTEPDLEAVEVEYLGRRGKISQLLSGIAKLAPEQRAALGQEANEARRAVEAALEARRAEQKAAQLADIAQTEAIDVTFPAPPLPRGHIHVLSQVRHELEVIFARIGYTVEEGPEIETDWYNFEALNLPKGHASRDVQETFFLDEAEEVVLRTHTSPVQIRMQRIGTPPIYIIAPGRVYRRDNLDATHLPYFMQLEGLAIDEGLTVGDLKGTLLYMTQSLFGQERQVRMRPHHFGYTEPSYEFDTMCGRCLGKGCRSCGGAGWLETGGCGMVHPQVLRNGGIDPDRYSGYAWGFGIERMALLKYDVEDLRLFYENDIRFNRQF... 343
92 3.000e-55UniRef50_A0A1F4GVD6 Phenylalanine--tRNA ligase alpha subunit n=33 Tax=Proteobacteria TaxID=1224 RepID=A0A1F4GVD6_9BURK  ali  43  2..NELDALVDSARAGFAQAATPADLENAKAQYLGKSGRITELMKGMAALPVEEKKTRGAAINVAKQAIEAALNERRQALADAELETQLKAEALDVSLPGRQRGQGGLHPVSLTLERIEAIFSSQGFEVAEGPEIESDWFNFTALNTPEDHPARSMHDTFYVEGPNLLRTHTSPMQIRHAVQHVPMPEIRVIAPGRTYR-VDSDATHSPMFHQCEGLWIGENVSFKDLKVVFTDFCRTFFEDDLVLRFRPSFFPFTEPSAEIDIQFQSGPLAG-------RWLEVAGSGEVHPNVVRNMGLDPERYIGFAFGMGPDRLTMLRYGVNDLRLFFDGDIRFLSQFR.. 350
93 3.000e-55UniRef50_A0A1F9YNV1 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=root TaxID=1 RepID=A0A1F9YNV1_9BACT  ali  44  3............EAGVEACADLPKLEEVRVRFLGRKGELTELLKSLKDLPLEDRKLLGPKGNALKESFESKLTQARARIEDAADAAGSAADAFDLTLPSIRAPRGRLHPLTTALAEISRIFQLLGYSWAEGPFVEDERHNFSALNIPEDHPARDSHDTFYLQGL-PLLLRTHTSTVQIRTMESRKPPIRVVCPGRVFRHEQIDATHSAVFHQVEGLVIDSGIGFADLKGHLQAFLQELLGSATQTRFRPSYFPFTEPSTEVDVKCFFCPGSGCPACKHTGWIEILGAGVVNPAVLRTVDYDPERFSGFAFGIGVERVAMLLHGVKDLRDFYSNDLRFLAQF... 330
94 3.000e-55UniRef50_A0A2E5WN24 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E5WN24_9BACT  ali  42  1MEKQLNQIQIDAEKDIKESSSLDQLLEVEKKYLGKKGSLKAILSQIKDLSIEEKKAFGKLSNQIKVVLNELIFKQKKLIEDQEIQNQLQNEFLDVTLPSIETQKGSTHVLKQVQKKLEEIFINLGFEVVDGPEVESEKHNFEDLNIPQSHPARDMYDTFFIDKYNRLLLRTHTSPVQIRQMLKQGAPIKVLIPGRTFRYEEADATHEHTFMQYEGLYIDKDISLSHLKGYIEEIFGQFFGSKIEVRFRPGFFPFTEPSLEFEISCPF-CEKGCKVCKQTKYIELGGCGMVHPNVLKAAGVDPEKFQGFAFGGGLDRLAMLITQTNDLRLFRQNDLRFLKQF... 344
95 3.000e-55UniRef50_A0A2M7RNW1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium (Candidatus Howlettbacteria) CG_4_10_14_0_8_um_filter_40_9 TaxID=20142  ali  38  2..EKIAIIEKSFDKDIAKVVSKEELEQIKIKYLGRKGEIARLSKTFGSLSISQKKDFGRKLNELKKHIEADVSTKERSLKG----AVSKTEAIDITAPGSEFPEGHLHPVTQFLEKATSVFQTMGFEIYESPEVEKAFYNFDAINVPKDHPARDSWDTFYVDDNRTLDDRTHTSNAQVRAMADRKPPVRVIVPGKCFRNEATDASHETTFYQLEGFVIDEGISVSDLIGALTHFAKKMFGNDVKTRFRPHYYPFTEPSIDMDISCFFCKGKGCSFCKKSGWIEVMPCGMIHPNVLKNMNVDSDKYSGFAFGFGIDRLTMLYYGIEDMRLIHSGDLRFINQF... 342
96 5.000e-55UniRef50_A0A2E3CLQ8 Phenylalanine--tRNA ligase alpha subunit n=22 Tax=Bacteria TaxID=2 RepID=A0A2E3CLQ8_9ACTN  ali  43  5..DQIAEAKAASVGEIEKTGDLESLKAIEPMLFGKKSTLGGLKRLMGEVDAQERADVGQALNEAQLFVREAHEAAKKKFELSDRRAQLETERLDLTESLHVANRGHLHLVTQTMERLEDVFVGMGFTVSEGPQAETDWYNFEALNLPAAHPARSMFDTLYLDEATNILLRTHTSPVQVRVMESTAPPIYTVCPGRVFRRDTADASHMPVFHQIEGLVVDRGISLADLAGTLNEFTAAYFGGAISSRLRPSYFPFTEPSAEFDITCVICEGDGCQTCQRTGWIELGGCGMVHPNVLANCGVDSEEWTGFAFGFGIDRLALMRYGIKDLRDMYTNDVRFLEQF... 356
97 5.000e-55UniRef50_Q6F165 Phenylalanine--tRNA ligase alpha subunit n=59 Tax=Mollicutes TaxID=31969 RepID=SYFA_MESFL  ali  40  1MLKKINKIKDQFISDLNKVKTIEEAEKLKKSLLGKESELSEILKSLKDSDTNDKQAIGIASHELRTFIASTIDEFVARIKKEALDAKLASEKIDVSLTGTLARFGTKHPLNIVVEEITQIFTEIGFDVLNGNDVESDEYCFQKLNLPVGHPARDMQDTFYIDEETVLSTHCTHMTARVLTQMAKDENFACVAIGNVYRRDDDDATHSHQFMQLDLLCIGKKITFANLKWVLKYMCKRLFGEEVNIRLRPSLFPFTEPSVEVDVSCFKCSGKGCSICKYSGWIEILGSGIINEQVMLLNGMDPEKNTALAFGAGIERIAMLKFGISNIRNLYENNVQFLEQFK.. 346
98 7.000e-55UniRef50_A0A2A5DDM7 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5DDM7_9BACT  ali  43  1MRDRLEALRRDGLAAVSEAQDLDTLYGVESRLLGRTGALTAELKGLGKLSPEDRPVVGKLANEIKQALQGALEERRTAIESAELAADLVGEGLDPSLPGAPAPKGGVHPVLAIARELEDVFSSMGYVVWDGPEIETEANNFDALNIPADHPAREGHDTIWMEGSPRRCLRTHTSPVQVRALREFGAPLRVIAPGRVFRQEAQDATHDHTFHQMEGLVVDKGVGVPHMLHAMNTLLEGVFGRKLETRLRPGFFPFVEPGFELDARCPF-CKEGCKVCKGSTWIELMPGGLVHPNVLTAVGLDPEEYSGFAFGLGLSRIAMLRYGINDIRWMMSGDLRFLEQFQ.. 344
99 8.000e-55UniRef50_D3P0F2 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=D3P0F2_AZOS1  ali  41  1MSTNTELLQNQLAAELSEAREPKDIEALRVKYLGRQGLIAGEVRGFSTLSEEEKREAGRRVSSLKAFAEAAIGEARAKTEERAARARRRG-LVDLTLPGTGARAGSLHPVTQTQMFLEDVFQSMGFRVETGFEVEDEFYNFDALNIPGDHPARDMHDTFWLEDGRLLRTHTSATQVRAMRMYG--APLRAVFPGRCFRNEATDTSHETTFHQFEGLMIDEDVTVATVLAVMEALLRQVFGREVSVRLRPGYFPFVEPGFELDLRCLICGGNGCRVCKQTGWVELMPCGMVHPNVLRAGGIDQDRYRGFAFGLGLTRLTMMNFSIPDIRLLGSGDLRLLDQFPAV 343
100 9.000e-55UniRef50_I4BW85 Phenylalanine--tRNA ligase alpha subunit n=17 Tax=Bacteria TaxID=2 RepID=I4BW85_ACEMN  ali  43  6..DAILEIKEAFMKELEKAENIEALNELRVRYLGRRGTVTQMLKSLGTLPEDERPKMGKAINDLKNDIEDMIKKRQQELIDLEESSLERLDAIDVTQPPKGRPWGGFHPVVEVMHELIDIFLGLGFSVALGPEVEDDFHNFEALNIPPHHPARDMQDTFYLEGS-ELLLRTHTSPVQVRSMLKYGAPLRIVCPGKVYRRDS-DPTHSPMFHQLEGLLVDTDVSVSDLKGCMIHFIDKVFGRPLKSRFRASYFPFTEPSLEMDIECCSGKDPSCRICKGTGWLEVCGMGMVHPNVLRAGGIDPEIYNGFAWGLGIDRVAMLKYGLNDLRMLFSGDIAFL...... 341
101 1.000e-54UniRef50_A0A1H3HXW9 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1H3HXW9_9FIRM  ali  48  10...KLSEIKAKIESDLTEIKSSKGVFEYRKSVMSKEGKIGSLMKEMGKIPKELKADYGKMVNEIRNWATERFDALDAEFKAAEQKARYDAETIDVTLPSKKLKKGYLHPNTQVRNQIVDIFGSMGFSVYEGNEIETDHYNFTALNIPKDHPSRDMQDTFYLSPEFLLRTQTSAGQVHVMESQQP--PIKIISPGKVFR-SDDDATHSPMFSQMEGLVVDEGITLCDLQGMLDVFVKKIFGEETRTRLRPSYFPFTEPSVEVDVSCFQCGGKGCKLCKGTGWIEVLGAGVVNKKVLEGCGIDSDKYSGLAFGIGIDRIAMLKYGINNIKLLFESDLRVLEQ.... 344
102 1.000e-54UniRef50_A0A2D5ZAJ6 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Planctomycetes TaxID=203682 RepID=A0A2D5ZAJ6_9BACT  ali  43  1MLDRIEQLEREADADLAAVSGADDLEAFRIKYLGSKGALKGLMGLLKEVPPDQKPAFGQGANRLRKKLQESFEAAKGEYVSAGGGRRG--PKLDVTEPAMPPRLGREHVITQTIDALIDVFGRMGFDVATGPEVEDEYHNFIALNIPQAHPARDPLDNFYLENPHLLRSQTSTIQIRVMETTPP--PVRIIAMGRVYRPDAHDATHYSMFHQVEGLYVDENVSMVDLKTTLIQFAHAYFGAEAEVRLVPSYFPFTEPSAELYVKM--------KVRDRWEWIEIGGCGMVDPAVFEAVGYDPERWTGFAFGLGIERLAMRKHGIQDIRWLFENDLRFLRQF... 334
103 2.000e-54UniRef50_B1ZQM9 Phenylalanine--tRNA ligase alpha subunit n=49 Tax=Bacteria TaxID=2 RepID=B1ZQM9_OPITP  ali  40  1MQEQLSALLAKAQNELPALKTRPEFEAAKARFVGPHGELTALMKQMGTVPKEQRPALGKLINETKGQLQQQLDAALRTIEAGELQAQLG-PAVDPTLPSPDAGPGTYHPLTLVREEMCRILRKVGFTVADGPEVETEFYCFDALNTPPDHPARDAQDTFYFPDHEKYLLRTHTSSVQIRTMLKGEPPIRIVSPGRVYRRDTTDATHSANFHQLECLYVDKHVTVRDLKALLDYIFASLLGPDTKTRFRPHYFGYTEPSFEVDLTAKHLPKV------NKEWIEIGGCGMVDPAVFAAVGYDPETWTGYAFGMGLERLAMLLYGIDDIRYFYQNDLRFLKQF... 346
104 2.000e-54UniRef50_A0A1G0WHU3 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A1G0WHU3_9BACT  ali  46  6IKKESERILSRLHSEKSDVITKEKLESFKITFLGRNGEITALSGMLASIDKSLKPEAGRILNETKKEVASEIESLSN---QIESASMSNTEFVDITLPGRAWKYGKKHPITQTIDDCVAIFRRIGFIVADGPCIETIHHCFDALNTPKDHPSREKSDTFYFPDGRLLRTQTSTVQIRVMESQEP--PIRIIAPGPCFRPDTPDATHSANFYQIEGLYIDKNISMADLKSTLMYFARELMGENVQIRFRPHFFPFTEPSVEYDFSCIMCEGKGCNVCKRSGWLEMGGAGMVDPNVLRNVGCDPSIWSGFAWGMGVERIAMIRHRINDIRYFYDNDVRFLNQF... 341
105 2.000e-54UniRef50_A1B4B8 Phenylalanine--tRNA ligase alpha subunit n=924 Tax=cellular organisms TaxID=131567 RepID=SYFA_PARDP  ali  40  3...DLSTLRQSYLDRISAAADGDALEQVRLAALGKKGEISGMMKELGRMTPEERQTTGAALNRLKDEIDAALRARKQGLEDAALDARLKEEWLDVTLPGRPRPQGTIHPISQVTEEVTAIFADMGFRVAEGPQIESDWFNFDALNIPPEHPARQEHDTFFMDPRPPQVLRTHTSPVQIRAMQATGAPIRVICPGRVYRMDM-DQTHTPMFHQVEGLALGKDISMANLKWTLEEFCRAFFEDEVELRFRASHFPFTEPSAEVDIRCSWEGGKLT-IGQGESWLEILGSGMVHPKVLAAGGIDPEQWQGFAFGMGIDRIAMLKYGIPDLRAFFESDLRWLRHY... 344
106 2.000e-54UniRef50_A0A2N2EZB8 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Elusimicrobia bacterium HGW-Elusimicrobia-1 TaxID=2013763 RepID=A0A2N2EZB8_9BACT  ali  43  7IIKSLEKIKSEYSAGADRAKSAAELADWKARYLGKKGELAAIMSSLGGLSVDDKKIAGRLANEIKTAVEEIYEKSIRSIHESEYIARLGA-VSDLTLPSVGVPRGRTHPLSDTMEEISSIFVSLGFAVADGPEIEDDYHNFAALNFPDSHPAKEMQDTFYVSEGAEKLLRTHTSPVQIRSMKGGTPPFKFIAPGRVYRHEAVDATHSYVFHQVEGFCVDKKTNLADLKTVLETFIEKFFGKKSSVRFRPSYFPFTEPSVEVDVECLVCSGAGCKACKNSGFIELLGAGMIHPNVLSNCGLDPNVWQGYAFGIGVERFAMQKYGVDDMRLFYKNEMRFLRQF... 347
107 2.000e-54UniRef50_A0A0G1K082 Phenylalanine--tRNA ligase alpha subunit n=15 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G1K082_9BACT  ali  39  7..QKLANIKTKAVAEFFSLQNDAEIEKWRVKYLGRKGALSALFEEIGKFRTEERQYLGKAANELKKELEEKLRAASDRTKSHGKGE----ESFDETAPGIPVPRGTKHPLTQFTDRICAVFTSMGFEIVEDREVEKVEYNFDKLNMPDNHPARDMWDTFYIKSQHEVVLRTHTSPVQLRAMETRKPPVRLVVPGRCYRHDATDASHETGFYQLEGLVIDKGVSVANMIYVLDSVLKRLFGNFVKIRIRPSFFPFVEPGHEIDMSCMICEQKGCSVCSKTGWLEMMGSGMVHPVVLNNMGVDSELYTGFAFGMGIDRLMMLYYGVDDIRLSYSGDLRFLKQF... 349
108 2.000e-54UniRef50_G4CQG6 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Proteobacteria TaxID=1224 RepID=G4CQG6_9NEIS  ali  46  3...NVDQIAAAGIAAVESAQDFNSLELIKAQYMGKTGELNLLLKQLGQMSPEERKTAGAHINECKNRFQEAYNNKRDALNAAKLEAQLAAEALDVTLPGRGQSDGGLHPVTLTLQRVVELFHGMGFEVADGPEIEDDFHNFQALNIPQNHPARAMQDTFYVENGDVLRTHTSPIQI-RYMLDKKEPPIRIIAPGRVYR-VDSDATHSPMFHQAEGLWVEEGVTMADLKAVFTDFIRRFFRDDLQVRFRPSFFPFTEPSAEIDIMGD-----------NGKWLEVGGCGMVHPNVLNNVNIDPEKYTGFAFGIGLDRFAMLRYGINDLRLFFDNDLNFLQQFR.. 329
109 2.000e-54UniRef50_A0A1J4U7F0 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=Bacteria TaxID=2 RepID=A0A1J4U7F0_9BACT  ali  39  3MKEQLSSLKKEFEAQLKHASSLLQLEELEQTIFGRKGAFTTLAKQMKDVANDQKKTIGELMNTVRTKIATELEDKRALLQREEMKKIVETESIDVTQPQPKEEHGHIHPMAQVEMELSELFRSMGFMVLDGPELESDYFNFEALHIPLSHPARDSQDTFFIKDHPEWVMRTHTSPVQVRAMREHGAPLRAVVPGRVFRNEATDGSHEHTFAQLEGLVIDTDISIADLIGVMKGLLSGILKRDVEVRLRPGFFPFVEPGFELDMRCQVCDGAGCGACKHSGWVEMIPCGLVHPEVLIAGGIDPDVYSGFAFGLGSMRLVMQKYGIEDIRHFQSGDLRFLQQF... 345
110 2.000e-54UniRef50_A0A1H8G469 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1H8G469_9BURK  ali  42  2..NDLDAIVASAQQSFAEAATPNDLENAKARFLGKAGQITELMKGMAKLSVEEKKTRGAAINQAKQAIEAALTARRNALAEAELQAQLQAEALDVTLPGRTRGAGGLHPVTLTLERIESIFGSMGFEVARGPEIESDWFNFTALNTPEDHPARSMHDTFYVEGPNLLRTHTSPMQIRHAVQHVKRHRIRVIAPGRTYR-VDSDATHSPMFHQCEGLWIGQNISFKDLKVVFTDFCRTFFEDDLVLRFRPSFFPFTEPSAEIDIQFQSGPLAG-------KWLEVAGSGQTHPNVVRNMGLDPEQYIGFAFGMGLDRFTMLRYGVNDLRLFFDGDVRFLSQFR.. 350
111 2.000e-54UniRef50_A0A2V5IZA6 Phenylalanine--tRNA ligase subunit alpha (Fragment) n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5IZA6_9BACT  ali  52  1..................................................................................................GTPHERGALHPLTQMLDRSIAVFRRMGFALAEGPDIETEWHCFDALNTPSDHPARNEQDTFYLPDGRLLRTHTSTVQIRTMES--ASPPIRVIAPGAAYRRDEVDATHSAQFHQIEGLYVDEKVSVADLKGTLEFFLRELFGADTAVRFRPHYFPFTEPSFEIDVKSSALKG.......................................................................... 170
112 3.000e-54UniRef50_A0A1I5WN64 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Cytophagales TaxID=768507 RepID=A0A1I5WN64_9BACT  ali  40  2MQESIASLAAEITTA--DLSNAAHLDAFRISYLGRKGRLADLFDQLKTVPAEEKRAVGQQLNALXXXXXXXXXXXXXXXXXXXXXAPAN-PDFDYTLPTVPNTLGTRHPLSLVREEMMRVFARIGFAIAEGPEIEDDWHNFTALNFPENHPARDMQDTFFVAPTQPHLLRTHTSTVQVRVMETEPLPIRKVMPGRVFRNEAISARAHMMFHQVEGIFIDEGVSFADLKQTVYYFVQELFGQDIDIRFRPSFFPFTEPSAEIDITCLICKGAGCNICKQSGWVEIGGCGMVDPAVLENAKIDSDKYSGYAWGMGIERIAMLKYQIKDLRLFTENDMRFLRQFEAL 349
113 3.000e-54UniRef50_A7NJ67 Phenylalanine--tRNA ligase alpha subunit n=70 Tax=root TaxID=1 RepID=SYFA_ROSCS  ali  44  3LIDQLNQLEQEALAALDHAADLTALAEWKSAYLGKQGALSRLSRGLGALPAEERPAAGARFNAAXXXXXXXXXXXXXXXXXXXXXHAFEADQVDVTLPGRAPAVGRLHPTTQMLRTIYTILGEMGFQVWESPEVETDEFNFQLLNMPPDHPARDMWDTFYVEEPTLLLRTHTSPGQIYAMRANAPNPVRAILPGKCYRYEQVTARHEMQFFQVEGIAIGERISFADLKGTLVAFAERLYGKGVKTRFRPSYFPFTEPSVEFDIECFLCGGAGCRVCKHSGWLEILGAGMIHPTVLRNGGYDPEKVSGFAFGMGPERMAMLRYGIDDIRWFFSGDERFLQQF... 347
114 3.000e-54UniRef50_A7HPL0 Phenylalanine--tRNA ligase alpha subunit n=77 Tax=Bacteria TaxID=2 RepID=A7HPL0_PARL1  ali  43  1MTDDLEKLEAEFARAIADAVDSDTLEAVRVAALGKKGRVSDLMKGLGSMSPDERKEMGPKLNGLKDRLTEALGQRKQALHEQALEARLAGEKIDVTLPVRELEAGRIHPLSQVWDEVVAIFADMGFAVEQGPDIETDHYNFGALNFPEGHPAREMHDTFYFEDGSRMLLRTHTSPVQVRTMEAGKPPFRFICPGRTYRNDS-DQTHTPQFHQIEGLVVDETTHMGHLKWTLEEFLRAFFEDGVELRMRPSFFPFTEPSMEVDVRCARL-GNEIRIGEGDDWLEILGCGMVHPNVLRAAGIDPEKYQGFAFGMGIDRIAMLKYGIPDLRAFFEADLRWLRHY... 345
115 3.000e-54UniRef50_UPI000D6CE0FA phenylalanine--tRNA ligase subunit alpha n=1 Tax=Oceanotoga teriensis TaxID=515440 RepID=UPI000D6CE0FA  ali  41  1MQMDLDQIMMNLKNKIDSVKNLEDFKVLKSEFLGKKGQVTQLMKNISKIDKEKKKEYGQKVNQLKSEIEDVLNSFMEELNEKKKKSEELKDWVDVTVRGAKNSYGKEHLINKTIRESFEIFTNLGFTVVEGNEIEEPWFNFDALNTPEWHPARDMQDTFYLN-LEKTLLRTHTSGVQIRTMTKMNPPIAVVSSGRVYRKDEIDATHSAMFYQLEGLFIDKKVTVGNLRKFLEIYTKKMFGDSLKVLLRPSYFPFVEPGFEVDVSCINCGGKGCSVCKNTGWIEVLGAGLVHPNVLKNVGFDPDEWQGLAFGVGVERIAMLKYGVSNMREFFKNDIRFVE..... 340
116 3.000e-54UniRef50_A0A2H0UGZ8 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=1 Tax=Candidatus Kaiserbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_44_  ali  57  28.......................................................................................................KGHKHPLSKIITEVNSIFSELGFVFAEGPEMEETHYNFDLLNVPKDHPSRDMQDTFYIKPDHVLRTHTSPVQVRYMESHKP--PIRIIVPGKVFRNEATDATHEAQFYQLEGLMIDKDVSLAHLKGTLEFFFSKFFGGNTEVRLRPSFFPFVEPGVEVDM................................................................................. 187
117 4.000e-54UniRef50_A4G615 Phenylalanine--tRNA ligase alpha subunit n=210 Tax=Bacteria TaxID=2 RepID=SYFA_HERAR  ali  43  4....LDQLVIQAQTDFAAADDAAALENAKAKYLGKTGQITEQMKSLGKLAPDERKTQGAVINSAKEKIEAALTARRDALSNAQMESRLNAEAIDITLPGRGRGTGGIHPVMRTWQRVEEIFGSIGFDVADGPEIENDWTNFTALNSPENHPARSMQDTFYIEGNDPLLLRTHTSPMQVRYARMNKPPIRVIAPGRTYR-VDSDATHSPMFHQVEGLWIDENISFADLKGVYLNFVKAFFEDDLQVRFRPSYFPFTEPSAEIDI-------AFGSGPLKGRWLEVSGAGQVHPNVMRNMGFDPEQFIGFAFGSGLERLTMLRYGINDLRLFYEGDLRFLKQF... 337
118 5.000e-54UniRef50_A9GN91 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Bacteria TaxID=2 RepID=SYFA_SORC5  ali  42  10....IDEVDRTVDVQFAAAGDLDELNRLYASLLGRRGSLNALMKQLPGAAPEERKALGQRLNAVKGRVERAREEATARIKRAARDRELSAPPLDITLPGRWRAPGRPHPIMRTLDEIVDIFVGLGFDVAEGPQIELARYNFDLLGFPADHPAMDMHDTFYMDPGQNVLLRTHTSPVQVREMLSHPPPVMIVAPGVVYRRDD-DASHSPMFVQIEGLVVDRDVSLADLKGLLEVYSRRMFGEATRTRFRPSYFPFTEPSAELDVSCCFGENRACPQCKGTGWLEVLGCGMVHPTVLRNVGIDPEEYTGLAFGIGVDRTANMKFAVDDIRAFYENDVRFL...... 346
119 6.000e-54UniRef50_V8TSI2 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Chlamydia TaxID=810 RepID=V8TSI2_9CHLA  ali  42  3IEEEIELAQQQFYAEMNQVGSSKELSDLKVRYFGKKGVFRHFSEKIKLSPIESRAKLGASINSFKNCIESLLEEKSLSILAAEEISEFQKEKIDISLPGEPQWTGGKHVIKKILDDIVDIFVHSGFCVREAPNIESEENNFSLLNFDQDHPARQMHDTFYLDPNTILRTHTSNVQAREIKKHAP--PIKVVAPGLCFRNEDISARSHVMFHQVEAFYIDRCVTFPDLTKLLSEFYHTFFERTIELRFRHSYFPFVEPGIEVDVSCECNHK-GCLLCKQTGWLEVAGAGMIHPQVLLNGGVDPEIYSGYALGMGIERLAMLKHGISDIRLFCENDLRFLQQFS.. 341
120 6.000e-54UniRef50_A0A1Q7R862 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Armatimonadetes bacterium 13_1_40CM_3_65_7 TaxID=1805024 RepID=A0A1Q7R862_9BACT  ali  43  5..KDLDKIAQEAERAILDAVSLEALEEVRRTYLGRRGIVAQLFDQVPSLPAAQRPQAGRRLNEIRDRLQDALTRRGEE-LQREQGLRLADAAIDVTLPGRRIALGRRHVLTRTLEEIERIFFGMGFEIVDGTEVETDEFNFERLNMGRDHPARDAQDSFYLTDDLLLR--THTTVVDARVMVGRTPPMRILTTGRCYRRDAPDATHMPVFHQADGFMVGERITMADLKGVLATFVRQMFGVEAVYRFVPSYFPFTEPSAELAVWF------------NGRWLELAGSGMFHPRVLELAGIDPVRYTAFAFGLGVDRPAMVRYGIPDIRLFWENDLRMLQQF... 328
121 7.000e-54UniRef50_A0A2D5WA20 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5WA20_9BACT  ali  40  6......ELRDEALARLAACTELAELRSVEKDYLGPEGAIGALLASIPSLPKEERPKVGAAANRLKKELEAGLDKARGELETARVAAERAGGDFDPSLPPRRAARGSLHPLTKVRREVERIFSSMGYDIADGPEVELDYYNFQALNIPVDHPSREMQDTFYCDEEHHLVMRTQTSPVQIRVMEQRQPPFRLIAPGRVFRNEEQDATHNHTFHQVEGLVVGEGIQVGHLTGTLKGFLAELFQRQVQVRLRPGYFPFVEPGFELDVACPFCDEKGCRVCKGVGWVEFCGCGLVHPEVLAAGDVDLDKLTGFAFGFGLDRLVMLRYGLDDIRNLMGGDLRFLEQF... 347
122 7.000e-54UniRef50_A0A1H9KLP9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Lachnospiraceae TaxID=186928 RepID=A0A1H9KLP9_9FIRM  ali  51  1MKEMLEKIKEQAEKQIAAATSPEALDEIKVSVLGKKGELTQILKGMKDVAPEDRPKVGQMVNSVRDVLEEALAEQKKALKSKVIEKKMETEWLDVTRPGTRTQRGHKHPNQIALEDLEKVFIGMGYEVVEGPEIEYDRMNFKLLNIPEDHPAKDEQDTFYIEDDIVLRTQTSSVQARVMGFPERSLPIKLISPGRVFRSDEVDATHSPSFHQVEGLVIGENVTMADLKGTLDQFAKEFFGPDTKTKLRPHHFPFTEPSAEVDVTCFKCHGTGCTSCKSSGWIEILGCGMVHPDVLEMCGPDAPVYTGFAFGIGLERVALLKYEIADMRLLYENDIRFLEQF... 391
123 9.000e-54UniRef50_A0A1G2BBS4 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=root TaxID=1 RepID=A0A1G2BBS4_9BACT  ali  38  1MKEQLLKIQQEFQQDLLKINSEADFSNLRIKYLGRKGKLNDVLRNLKNLPKEQKRELGPLANSAXXXXXXXXXXXXXXXXXXXXXQIFKED---LSLPGIKPTSGHLHPLSLAANELMDIFSAMGFMIYEGPELENDFYNFESLNIPPSHPARDMQDTFFIKDHIKWVMRTHTSNMQVRIMEQFQPPLRCVVPGRVFRNEATDASHEHTFYQLEGFVVDKNITIGHAMWTLKEILRQVFKKDIRIRLRPGYFPFVEPGYELDCSCLICNGQGCPTCKRSGWVELVPCGMIHPNVFKAAGYPKGTYTGFAFGLGLSRLTMMKYGISNIRLFTENDLRFLKQF... 351
124 9.000e-54UniRef50_A0A1F8JJ05 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Chlamydiae bacterium RIFCSPHIGHO2_12_FULL_49_11 TaxID=1797603 RepID=A0A1F8JJ05_9  ali  41  5..ERVEKEKKTFVEQLKTASSTKEIEELRIRYLGKKGSLASFVAELRALTSDEKRDFGKAVNDLKIYILNKLDEKNEKLVMAERSEMIESEKIDVSLPGVSVPLGGLHPLTQMMDRVKSVLTLMGFTEFLSPELESEYYNYGGLNYPDDHPARDMQDTYYIDETTLLRSHNTAFQQRIMEKEKP--PIRSFCMGKCYRNETISSRSHVIFHQVDVLYIDKNVSLADMMATKTEYYKRILGSDIKLRFRPSYFPFVEPGVEVDIACLLCGGKGCRLCKHSGYLEVCGAGMVHPEVLRQGGLDPELVSGYAWGGGIERLLLMMRGIDDIRLFLQNDIRFLAEFK.. 342
125 1.000e-53UniRef50_O84843 Phenylalanine--tRNA ligase alpha subunit n=77 Tax=root TaxID=1 RepID=SYFA_CHLTR  ali  41  3IQEELEAVKQQFSCDVSLAHSSKDLFDVKVKYLGKKGIFRGFADQLRKYPIEQKATVGASINACKQYVEEVLLERGKAVLAKEEAEEFLKEKIDISLPGEEAALGGKHVIKKVLDDVVDIFVRFGFCVREAPNIESEKNNFSLLNFEEDHPARQMQDTFYLDPTTVLRTHTSNVQSRELARNKP--PVRIVAPGECFRNEDVSARSHVIFHQVEAFCVDKDISFSDLTSMLAGFYHIFFGRKVELRFRHSYFPFVEPGIEVDISCEC-HGAGCSLCKHAGWLEVAGAGMIHPNVLRKASIDPEEYSGYALGMGIERLAMLKYGISDIRLFSENDLRFLRQFS.. 342
126 1.000e-53UniRef50_A0A2M7RKM0 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Kerfeldbacteria TaxID=1817907 RepID=A0A2M7RKM0_9BACT  ali  40  1MKEQLEQLKNKVLEEIKLIQDPKLLGNLEKEYLGRKGKLTKVMRQIKDVSAELRPVMGKLVNEIKKDVSAAFQEAET---KLKTGSNDSSEFFDPTLPGIVPPAGHLHPITQMLERIWEVFRSMNYDLVLGPEIENDYYNFQALNVPPDHPARDMHDTFYLKGTKGLLRTHTSSISQVRTMEKRKPPIRIMATGKCYRRDD-DISHTPMFHQFDGIAIDHGITFADLKGTLHYAMRELLEEEVKVRFRISYFPFVEPGAEFDVTCTICGGRGCPTCKGTGWLEMGGCGMIHPNVMKAAKYDSKKWKGFAFGFGVERPAMIKHRISDIRALFENDLRFLKQF... 351
127 1.000e-53UniRef50_J9C7A2 Phenylalanyl-tRNA synthetase, alpha subunit (Fragment) n=1 Tax=gut metagenome TaxID=749906 RepID=J9C7A2_9ZZZZ  ali  56  57......................RVVDELRVRFLGKKGEVTGILKQMGKLSAEERPVIGALANQVREDIDAHIRTRMKELADEAMAKRLEEEVIDVTLPGTQPVQGGIHPFHLVLSELKDIFLGMGFDVVGGPEVELDHYNFEMLNMPKSHPARDTQDTFYITENILLRTQTSPCR......................................................................................................................................................................... 209
128 2.000e-53UniRef50_A0A2M7H4K7 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Kerfeldbacteria bacterium CG15_BIG_FIL_POST_REV_8_21_14_020_45_12 Tax  ali  39  1MKQSLSKIESAFLEEISQVSDADKIEEIRVSYLGRKGQLTVLLRGLKDLSIEEKKLIGPAANLLRQKIESTLTEALQ---KAGSSAVPEFDLSLPGKISQDKSLGHLHPITQINRELIRIFQSMGFQVLEGPELDNDYYNFEGLNFPFDHPARDIQDTFFIDTRNDWVMRTQTSNMQVRVLEQAEPPVRCIIPGRVFRNEAIDATHEHTFYQLEGFVVDENINIGQLVWTLKEIFRQIFKQEVKLRLRPGFFPFVEPGYEVDMFCVFCSDVSCKVCKGLGWVEMLGAGMIHPNVLAAAGYDAGRYTGFAFGIGTGRLAMLKYNIPDYRLYMQGDLRFLEQF... 352
129 2.000e-53UniRef50_Q04FD8 Phenylalanine--tRNA ligase alpha subunit n=257 Tax=Bacteria TaxID=2 RepID=SYFA_OENOB  ali  51  17..............EIDKSSSVDLIENIRVHLLGKKGDLTKILKGLKDLDPREKPVVGQMANKIRTQLETMISQKKHILEENKLDAQLASEKIDVTLPGETFQIGTKHVLQQIQDQIEDHFLSQGYQVMYGREIETDEYNFERMNLPKDHPARGMQDTFYLTPNVLLRTQTSAMQARMDKHDFSTGPLKMISPGKVYRRDNDDATHSHQFHQIEGLVVGKKITLADLKGTLQALTDELFGKGHAMRFRQSYFPFTEPSLEVDISWNTVDKNTAS--QDIEWIEVLGAGMVHPNVLKMANIDPEEYSGFAFGLGPDRFAMIKYGIDDIRNFYLDDLRFLKQFCQV 345
130 2.000e-53UniRef50_A0A1F7WHJ8 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=root TaxID=1 RepID=A0A1F7WHJ8_9BACT  ali  48  1MDEKLNEITAMFEEKLSKAATVSDIETLKVDFLGKKGHVTSLFKEMGKVTAEDRPAVGEKINRVKEKVESGIKEFEKKISDKAVYEKINASYCDVTLPGKFHEIGHRHPISSTIAEIVEIFGRLGFSVSEGPDIETDYINFDALNMFDWHPARDMQDSFYAGPNAVLRTHTSGVQIRTMLKSEP--PIKIVAPGRVYRLDEVDASHSPVFHQVEGLLVDKNTNFAAFKGIIASFCREFFGADRKVVFRPSYFPFTEPSAEVDVECISCKGRGCAICKNSGFLEVMGAGMVHPNVLKNGNIDPEIYRGFAFGMGVERIAMLRYAIRDIRDFYMNDLRVLAQFR.. 368
131 2.000e-53UniRef50_A0A1H3VSJ1 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A1H3VSJ1_9BACT  ali  43  1MDELLKQIQQTAAIEAASPSGREQVEAFRIQYLGTKGIVKSLMGSMKDIQPDQRKAAGQALNEFKKLAEAKLESLQDANESAGEDD----QKFDLSLPGDFVGVGTRHPLSIVRGRIVSIFKKLGFAIAEGPDIEDDWHNFGAMNLPEDHPARDMQDTFYISQNPSWLLRTHTSSVQARVMESQKPPIRVICPGRVYRNETISARAHCFFHQVEGLYIAENVSFADLKQTLYFFVQEMFGKEVKVRFRPSYFPFTEPSAEMDISCLICEGKGCNVCKHTGWVEILGSGMVHPNVLENFGIDSNKYTGFAFGMGVERITQLKYRVNDLRLYSQNDIRFLQQFTG. 340
132 2.000e-53UniRef50_V6DKL7 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=V6DKL7_9DELT  ali  38  6..KLIIETKENFLKELNSISNLKDLESLRVKYLGRQGILNDFIERLKDFDAENKRLYGPLFNELKKDIHLRIDNKKLLIEEEIKSLNAYKENFDVTAYKPFTYKGSLHPYTHLIEQVEDIFISMGYEIIQGPEVETEYHNFDVLNIPSNHPAREMQDTFWLD-LPDKLMRTHTSTVQVHAMKNRKPPIAVGSLGRCYRNEATDASHDFMFMQVEILFIDKNVTISNLVATAKTFLQLLFGKDLDIRLRPSYFPFVEPGVEVDISCIF-CTSGCSVCKTTGWIELGGAGLMHPNVLTSCNIDPEEYSGFAFGFGLTRLAMLRYGISDIRLLHSNKIDFLKQF... 344
133 2.000e-53UniRef50_A0A1Y0GZ68 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Armatimonadetes TaxID=67819 RepID=A0A1Y0GZ68_9BACT  ali  40  2..EQVTAVQTEAITAINAAKSTDDLRAVELEFLGKSGKLSGLMKGIGALPNDQKPLFGAAVNQAKSQVEALLNQRIQDLKGGELSKQFEAERIDITLPGRPPRYGREHVLQLTTNKIKRTLGSMGFVYQESPELEQFKYNFDALNYPPDHPAMDEQDTFYVEDDLVLRTQCTALQGRVFETQKP--PLRVFTVGRTFRNEAVDRTHNHTFHQVDCFMIDRGISMAHLKGTLGEFARAMFGQEVNVRFRPDFFPFVEPGVDYAIS--------TPKLFNGKWVELGGAGLIHPNILERYGIDTREFSGFAFGLGVERIPMMAYGIDDLRHFFDNDFRFLSQF... 330
134 2.000e-53UniRef50_A0A1F2R0Q7 Phenylalanine--tRNA ligase alpha subunit n=18 Tax=Bacteria TaxID=2 RepID=A0A1F2R0Q7_9BACT  ali  48  26..................ARDVAALQSLRDRFLGRRGAVTLLLKSVGRLGADERRAAGQELNALKDEIERGLAEASLREGDRTVSARLAAERADLTLPGRLPPRGRRHPLTVVREELEDAFVAMGYEVYEGREVEDDYHCFEALNMPPDHPARDMQDTFYLEGGQRLRTHTSSAQIRYMIENAHPPSVRIICPGKVYRRDD-DITHSPVFQQIEGLVVGSGITLGHLKGTIEAFLHALFGARYPVRFRPSFFPYTEPSVEADLGCVVCAGKGCRVCKGTGWLEILGSGMVHPAVLEAVNYDAEEVTGFAFGLGIERVAMVRHGIDDIRLFYGGDLRFLEQFRE. 358
135 3.000e-53UniRef50_A0A2D5NGT4 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5NGT4_9BACT  ali  47  26...........................LESRLFGPKGEVVELVRSVTSLPKEERPAFGKAANAIKQLVEAALRQRREGFEAEELDRELVAADFDPTEPGPRARRGALHPITIVQNELVDLFTSMGFRWEDGPEIESEYFNFDALNIPGDHPARESQDTFWLDDGNLLRTHTSPVQVRTLQRLVKEPPLKVIVPGRCFRSETVDKTHEHSFYQMEGLVVDHGVSTANLIHTMKTCLRVILERDVEVRLRPGFFPFVEPGFELDVNCPFCREGGCSVCKQTGWIEILPCGMVHPNVLREGGLDPEEFTGFAFGMGLQRVVMLRYGIDDIRHFMGGDLRFLSQFPEV 355
136 6.000e-53UniRef50_E0S1Z3 Phenylalanine--tRNA ligase alpha subunit n=95 Tax=root TaxID=1 RepID=E0S1Z3_BUTPB  ali  48  6LRQKIEAIREEIKANSEKLDSSKLVYEMKKSFMDKTGKISALMKEMKNIAAEDRAEYGKNVNELKQWALEHFEELDRKMKEKELLLRYESEKQDVTMPAKIRYTGNLHPVTQMRETLIDIFAGMGFEIYEGTEIENDYYNFTALNTPKDHPARDMQDTFYLSPEFLLRTQTSSGQIHVMEKSKP--PIKILSPGKVFR-SDDDATHSPMFSQMEGLVVDKNITLCDLKGSLELFAQKIFGEGTTTRLRPSYFPFTEPSVEVDCSCFACGGKGCNLCKGTGWIEVLGAGVVNKKVLENCGIDSEEYSGFAFGIGIERATMLKYGINNIKLLYESDIDVLKQ.... 343
137 6.000e-53UniRef50_A0A257BBY3 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Armatimonadetes bacterium JP3_11 TaxID=2012635 RepID=A0A257BBY3_9BACT  ali  44  2..QSIQQLLAEAEQAIVQAVSTAELQAVETHYMGKKGVISQLLRQVGTLPPEERPTFGQQVNAAXXXXXXXXXXXXXXXXXXXXXKRIEAERLDITLPGTPLRPARLHPLTLTMRRVKAALIGLGFEFVEGYDLEQFRYNFGALNYPEDHPAMDEQNSFHIAPGYLMRTQTTAIQFEQLQRGERQLPLRIATIGRCYRYENVDATHSHTFHQVDAFMVDEGVSMAHLKGVLTQFAQLMFGAEVRVRFRPDFFPFVEPGVDFAISW------------KGGWLELGGAGLIHPNILERYGIDTERYSGFAFGLGIERIPMLQYGVDDLRLFLENDLRFLEQFPIL 334
138 6.000e-53UniRef50_A0A2M7UM31 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_43_11 TaxID=1974  ali  41  1MKAKIDHLKTEMLVALRSATTETEVRDVEVQYFGRKGSFNDIMKGLKDLSDEEKRTVGQLANQTKKELEQAMEDRFAALEMGRLGKIAEEEWMDVTVSGTKPQVGHRHLISQFIDDIEVIFGKMGFSVAEGREVESEHYNFNQLNIPPDHPARDMQDTFWIKNLTDHVLRTHTSPGQARYMEAHKPPIRIIVPGKTYRKDS-DATHSPMFHQLEGLMVDTDISMAHLKAVITHALQQIFDPSIQTRFRISYFPFVEPGMEMDCTCPICHGSGCRLCKQCGWLEIGGAGMVHPNVLRNVGYDPDKLTGFAFGMGLDRMVMIKYRVNHLRLFFENDLRFIRQF... 348
139 6.000e-53UniRef50_Q8A756 Phenylalanine--tRNA ligase alpha subunit n=2183 Tax=root TaxID=1 RepID=SYFA_BACTN  ali  42  1MIAKIEQLLKEVEAL--HASNAEELEALRIKYLSKKGAINDLMADFRNVAAEQKKEVGMRLNELKTKAQDKINALKEQFES----QDNSCDGLDLTRSAYPIELGTRHPITIVKNEVIDIFARLGFSIAEGPEIEDDWHVFSALNFAEDHPARDMQDTFFIEAHPDVVLRTHTSSVQTRVMETSKPPIRIICPGRVYRNEAISYRAHCFFHQVEALYVDKNVSFTDLKQVLLLFAKEMFGTDTKIRLRPSYFPFTEPSAEMDISCNICGGKGCPFCKHTGWVEILGCGMVDPNVLESNGIDSKVYSGYALGMGIERITNLKYQVKDLRMFSENDTRFLKEFE.. 336
140 7.000e-53UniRef50_F3AV62 Phenylalanine--tRNA ligase alpha subunit n=57 Tax=Bacteria TaxID=2 RepID=F3AV62_9FIRM  ali  32  1MKDKINSILSEAKGKISDAVSEGELQNVKSAYIGKQGSLSLLMKEIPTVDVALRPEMGKLLNQAKNEVKELIDEKRMELKLKASEVSPDFD---CSVPGILPTGGGLHPITQMCYDLNDTFRSMGFEVFEEDEITSEMYAFDKLNFPPNHPARESMDTYWLEGHDKLCLRPHLTGGSVRYMQTHKPPYRFVYPGRVYRNETTDAHHERAFFQYEALIVDKDITFTSGKVMIKSILSKVFGTDVPVRMRSGFFPFVEPGFEIDMQCQVCGGKGCSVCKHVGWIEVMPGGSPHPNVLRAAGLDPDEYTGFYVNIGLDRLVMMRYGVDDVRLFHSADLRFLKQFR.. 345
141 8.000e-53UniRef50_A0A2N2EUR3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2EUR3_9BACT  ali  42  3IDAEISRIRKNFFETIKDIKTAEQLTNVRVVYIGRKGKVSRLLREVHGLPADIKPRVGKELNLLKN-----EIEKNIMDISLRFTPGAKEEAIDETLPGRPFSVGGRHPLSIIRNKIVEIFFSMGFSLVEGPLMEDDWHNFTALNVPEFHPSRDMHDTLYLEGKDNILLRTHTSPVQVRVMKHNKPPLAVIVPGKCFRNDAIDASHFPVFHQVEGLWVDKDISLADLKGVLSAFVHRLF-GNVKVRFRPSYFPFTEPSVELDMGCPVCGGSGCSTCGHGGFMEIMGAGMVHPEVFRNSGYE-EKYQGFAFGMGIERIAMIYYGLADIRDFYNNDLRFLEQFK.. 337
142 9.000e-53UniRef50_A0A2E7KIM0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Gimesia sp. TaxID=2024833 RepID=A0A2E7KIM0_9PLAN  ali  44  1MADNNDALVETAVESMAAATTLAELDEVRVQYLGKKGKLRALQAELKSLSPEEKREFGKMLNSVKERIQGALNDRKEALEASE-KSGPDLEMVDVTLPGVRTLPGHRHPLIATMEEVKSILLGLGFRYDDYPEVESEFFNFDALNTPDWHPARDMHDSFYTTKGNVLRTHTSAFQTRAMKQFGPP-PLRAMTSGRCYRRDEIDASHFPIFHQLDVIAIDENISFADLKWVLYQVASSLFGDDVQLRFRPSYFPFTTPSAEVDVMF------------NGKWLEILGAGMIRPEVLEAGGVDPEKWQGFAFGLGLDRMAMIRHGITDIRYMYENEEAFLRQF... 327
143 1.000e-52UniRef50_A0A0G0E3T2 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0E3T2_9BACT  ali  39  1MKNEIDNIYNQAISVIEKITNGEALEALRVEYMGRKGKLTLLMKNIPDLSIAEKREIGPLINKVKNALTIAFDKKEK---TLGQITNSENSFFDITLPGEKFNIGTLHPITQVRLQVEKIFQKMGFEILNPNEIDDDYHVFTSLNLPPQHPARDMWDTFWTENDLIPITHTSSMQNRAMKEKTPPFGV--IVPGRCFRHEATDAHHEHTFYQVEGLYIGENINLSHLIGTILTFLQEYFQKELRYKIQPSYFPFVEPGLEFLVSCVMCDGKGCSTCGHSGWLELIPCGLTHPKVIEMAGLDPKKYSGFAWGMGLDRLVMLKYGIEDIRHFHAGDLRFLKQF... 343
144 1.000e-52UniRef50_A0A2H0W2R0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Buchananbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_42_9 TaxID=1  ali  45  25........................VEQLENKYLGRKGKLTQVMKGVKQLSPEQKPKVGKKVNEVKQILEAAVVKAKEQYGE----PTKAKSNIDYTLPGKKVEVGGLHPISIVQRQMEEIFSSMGFIIADGPELESDFYNFEALNIPKTHPSRDLQDTFYIDDHTVLRTHTTPNDVRLMRQYG--APLRAITPGRVYRYEATDASHDSHFYQIDGVMVGENITVGNLIAMVDTFLKAIFGQEFKTRVRPGYFPFTEPSLEVDLSCWVCAGKGCRTCGQTGWVEFMGSGLLHPHVLRAGKVDPEKYNAWAFGFGLSRLTMMKYGIDDVRLLMSSDLRFLKQF... 335
145 2.000e-52UniRef50_G2LI60 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Bacteria TaxID=2 RepID=G2LI60_CHLTF  ali  51  62..................................RQGVLALKLKELGALPADQRPVQGAALNRFXXXXXXXXXXXXXXXXXXXXXETIRREAVDVTLPGLVRRRGRAHPLTQIRERIEDIFVAMGYAVEDGPEVDTVFYNFDALNIPPDHPARDLTDTFYLDDELALRSQTSNVQIHAMQRRKP--PLRIIAPGRVFRRDEPDATHNPMFFQVEGLNVAPGITMGDLKGTLQVFLTRLFERPVTLRFRPSYFPFVEPGAETDFQCPFCGGSGCRICKHTGWIELGGSGMVHPNVLRACGIDPTEFSGFAFGFGIDRMAALLYGIDDIRLYFENDLRFLSQF... 366
146 2.000e-52UniRef50_A0A1G6YSX3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1G6YSX3_9BACT  ali  44  1MQDLIQKL-EAYKQEIFSGTGEQAAEAFRIQWLGTKGRVKEVMGEMKHVPVEQKKEAGQLLNEFKLFTEARYAQLKEXXXXXXXXXXXXVP--DLTLPGDAIPLGSRHPISLMRHKIISIFQRLGFAVAEGPEIEDDWHNFTALNMPEHHPARDMQDTFYVDAGENWLLRTHTSNTQIREMEKGKLPIRVICPGRVYRNETISARSHCFFHQVEGLYIDENVSFADLKQTLYFFVREMYGKDVRVRFRPSYFPFTEPSAEMDVSCFICGGKGCNICKKTGWVEILGCGMVHPNVLQNCGIDPEKYTGFAFGMGVERPAMLKYGINDIRLFSENDVRFLKQF... 344
147 2.000e-52UniRef50_A0A0G0LQX6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=root TaxID=1 RepID=A0A0G0LQX6_9BACT  ali  48  6...KLDKINKSFQKSLLNQTDP---EQMKVLFLGRKAELNEILKNIKTLPADERMSIGAKANLLKKEIETKIANFTSS--------KQEKSFYDLTLPAALNLTYSVHPLRQIQNEITKIFTDLGFEVASGPEIESDWYNFEALNIHANHPARDDQDSFYINREQLLRTQTSPVQIRVLEKSKP--PVRIICPGKTFRRDASDATHTSMFHQIEGLVVDEDVTFADLKGILIYAAKKLFGENVKTRFRISYFPFVEPGAEMDISCTVCKSKTCPVCKGTGWIEIVGCGSVHPNVIKNAGLNPKQYQGIAFGMALERPLMIKYQIKDIRLFFENDIRFLTQF... 332
148 2.000e-52UniRef50_A0A1H3CUH4 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Bacteria TaxID=2 RepID=A0A1H3CUH4_9BACT  ali  45  22....................TAEAVEAFRIKYLGTKGLVKEVMGEMKNVPNEQKKAFGLVLNEFKQFAETRYETLKSLGAQEDHAHGNQIDW---SLPGDPVAIGSRHPLSLVRNQIVSIFKRLGFAVAEGPEIEDDWHNFGAMNLPEDHPARDMQDTFYISRNPDWLLRTHTSSVQARVMEKQKPPIRVICPGRVYRNETVSARAHCFFHQVEGLYIDENVSFADLKQTLYFFVQEMFGKDVKVRFRPSYFPFTEPSAEMDISCLICGGDGCNICKHTGWVEILGSGMVHPKVLENFGIDPNKYTGFAFGMGVERITQLKYQVNDLRLYSQNDLRFLKQFTG. 341
149 2.000e-52UniRef50_A0A2W5Z063 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W5Z063_9CHLR  ali  42  18....LEEVRAAGLAALAQTDDPAAVGSLRSGLLGRSGRLTALLREIAHAQPSERPALGRLANEVRAELEATLDDRQRVVRREALQRQLAAEAIDMTAPGRPVAAGHLHPLMTAEREVREIFHGFGFEVIEGPEIETDEMNFERLNIPPDHPSRDLWDTLYVAEPGSVEARTHTSPVQIRAMKALKPPIRVVIPGRCFRYEAVDAGHNFEFFQVEGLVVDRETSLADLKGTLEAYARAMYGPETRTRFRPGYYPFTEPSVAFDVGCVVCAGEGCPACQRTGWMTILGAGMVHPVVLRNGGLDPELYQGYAFGMGLDRMTLLRYGIPDLRLLMGSDLRFLEQFSD. 368
150 3.000e-52UniRef50_A0A136LY25 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Dojkabacteria TaxID=74243 RepID=A0A136LY25_9BACT  ali  40  21..........KAKANIASTDSEEELDQERVRYTGRKSELTTILRGIKDLSDDGKKEVGARANEVKEKVLELVEKQSMVLRKKSVERASKEEELDVTLPGNKIPQGRRHIISQMQERTEEIFQRMGFDVVYPYEIDTDFNNFQAVNIPEGHPARDSWDTFWTEDGQIAITHTSAMQNRVLRSHEP--PIRVVVPGRTFRHEATDARHEHTFFQVEGVYVDKGVTFADMLGTLQTFFSEFFGQKIGIKFSPDFFPFVEPGGMISIDVSGLGDSFMEISKGTGWLEILGCGMIHPRVLEMGGIDPNVYSGFAWGFGLERVVMPKFAIEDIRLIYKGDLDFVRQF... 349
151 3.000e-52UniRef50_A7WNX9 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=157 Tax=Bacteria TaxID=2 RepID=A7WNX9_9LACO  ali  62  1............................................................................................................................................................DTFYISPEILMRTHTSPNQARAMEAHDSKGPLKMISPGRVYRRDTDDATHSHQFHQVEGLVIDKHVTMADLKGTLEMVAANLFGDEFDVRLRPSYFPFTEPSVEADITCFNCMGKGCAVCKNTGWIEVL........................................................... 130
152 4.000e-52UniRef50_A0A0G1MN92 Phenylalanine--tRNA ligase alpha subunit n=39 Tax=root TaxID=1 RepID=A0A0G1MN92_9BACT  ali  41  19MQEEIINTKNQAIAQIGSAESVKELEEVRTSYLGRNGRFTILVKKIKEVPAEKRREFGITLNESKNALENLLSDKKQELIKS---LTEKREWFDVSVPGVKPALGHLHPLTQVLTDVKKVFNYLGYQVADGPEIETDYYNFEALNIPKDHPARDTQMTFYTNTGNILRTQTSAMQGRVMEKMKP--PFRVLVPGRNFRYEQVDASHGFEFWQVEGFVVDENIHLTDLFGTIDHVLKELFGREVGLRFATTNFPFVEPGVDTYMRCTICGGKGCSFCKNSGWSEIMPAGMIHPNVLKTARIDTKKWNGFAFAIGLSRIVNLRYQINDLRTLTTPDLRILNQF... 354
153 4.000e-52UniRef50_A0A1D8AZL3 Phenylalanine--tRNA ligase alpha subunit n=32 Tax=root TaxID=1 RepID=A0A1D8AZL3_9BACT  ali  38  1MQDTLSAILAKAQPELATLQTRAEFEAAKARYVGPNGEFTALMKQMGAVPKEQRPAMGKLINEAKARLQAEL-DLTLERIAAAEITAQLGPAVDPSLPSPDAGPGTRHPLTQVREEMCRILRKAGFTIADGPEVETEYYCFDALCTPAEHPARAEQDTFYFPGNEKYLLRTHTSSVQIRTMLQGEPPIRIVSPGRVYRRDTSDATHSANFHQLECLYVDKNVTVRDLKALLDYIFASLLGKDTKTRFRPHYFGYTEPSFEVDLSAKHLPKV------NKDWIEIGGCGMVDPAVFEGVGYDPEVWTGYAFGMGLERLAMLVYGIDDIRYFYQNDVRFLKQF... 346
154 5.000e-52UniRef50_R7HKK5 Phenylalanine--tRNA ligase alpha subunit n=26 Tax=Bacteria TaxID=2 RepID=R7HKK5_9FIRM  ali  36  1MLERLEEIKKQGLEKINSAKSSKELEEIRRELLGKKSPLTEVLKTLGSLDVETKKQVGMKANEIKNHFDEKLNEKDKDLVDNARVTD---EEIDVTLPGKEINTGALHPITQMCYDLNDAFLSLGFEVYSENDISSEKFAFDNLNFPKDHPARQSMDTYWIEGEERLCLRPHLTGGSVRYLLEHGAPARFVYPGRVYRNETTDARHERAFFQYEALIVDKDLSFASGKVMIETILEKVFGQKVNVRMREGFFPFTEPGYEIDMECLVCGGKGCKVCNHNGWIEVMPGGVIHPNVLRSANLDPEVWTGFYINIGLDRLVMMRYGIDDVRLFHSGDLRFLREFK.. 346
155 5.000e-52UniRef50_D5U5C0 Phenylalanine--tRNA ligase alpha subunit n=16 Tax=Brachyspira TaxID=29521 RepID=D5U5C0_BRAM5  ali  43  22......................SEIDDIRIHYLGRKGKITELLKSLSSIEIEEKKEFGKKINEIKNYCENALSEKKNEISDREFLLSLEKNKIDITMPGRRPKAASVNLLTSVEEEIVSILTEIGFRVVEGNEIEDDFHNFEALNIPYYHPSRDSHDSFFISKENVLRTHTSGMQIRTMLETPP--PIAVVSPGKCARRDAIDSKHSPVFHQVEGIMVDSGISFNDLKGILELFCKRMFGDKTQIRLRPDYFPFVEPGADLSATCVICGGSGCKTCGGEGWLELMGAGMIHPNVFKHVGYDITKYTGFAFGMGIERVAMIKYGITDIRMFYENDIDFLKQW... 339
156 5.000e-52UniRef50_A0A2V8LPG2 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8LPG2_9BACT  ali  42  45....IRQLQLEGYSLTAAEDALNDLTTLRTRYTGKKSDWAAAKKLIRIADGLQRASAGQHLLFLEVSMTDRLENARLSLEKTIKVLRTARESIDVTIPGRRPQPGHLHPITLMRQRIEDIFVSLGYAVEDDREIETDFYNFDALNIPEGHPARDPQDTFYTTEGFALRSQTSTVQIHA--MQRRGAPVRMIAPGRVFRRDTPDPTHNPMFFQVEGLCVDRGITMAHLKGTLAEFVHRLFGPETKTRFRPSYFPFTEPSAEVDYSCFSCGGSGCRICKHSGWIELGGSGMVHPNVLRTANVDTSEFTGFAFGLGIDRTCARIYQLDDIRLLFENDVRFLAQFR.. 381
157 5.000e-52UniRef50_A0A2G6F6F5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium DOLZORAL124_38_8 TaxID=2044884 RepID=A0A2G6F6F5_9BACT  ali  37  6..QQINQLKDETQQKVQTLKTLDDLQAFQQTFTGKNSLLVQLSKGLKTLPPEEKKTVGQAVGALREFLNNLIEEKASVIKKQALEKQLEAEWIDVTKT-NPPKTGAIHPLNQVQRQVETIFSSMGFEIADGPHLETEWNNFDALDIPEHHPARDMQDTFWVNNHENRVLRTQTSDVQIRMMKEFGAPLRLISPGRVFRNEDVDATHDAVFYQVEGLLIDKDISLAHLKGTITTMLSKLFEKDIKIRLRPGYFPFVEPGFEVDMWFETEGKPG-------KWLEFMGAGMVHPNVLKNGGIDPNEYTGFAFGFGLTRLAMMKYGITDIRYLLSPKIDFLKQF... 341
158 6.000e-52UniRef50_Q4FQ65 Phenylalanine--tRNA ligase alpha subunit n=63 Tax=Bacteria TaxID=2 RepID=SYFA_PSYA2  ali  49  25.EAQLIEFTSAAEALILQVSDVRLLQDLRVQLTGKKSPLTGWSKQMGKLSNDDKKTYGGWLHEVRSRIQDALTAQQQQLEVVALNAKLASESIDITLPARGGQKGHLHPVTMITQRMQQYFIQAGFNVATGPEVESDYYNFEALNIPSHHPARAMHDTFYFDAHYLLRTHTSPVQIRTMEKNEP--PIRIICPGRVYRNDS-DQTHSPMFHQLEGLMVTESSTFAELKGLISEFLEAFFAKELTVRFRPSFFPFTEPSAEVDI-----------LDDNGKWLEVMGCGMVHPQVLTNCGIDAEKYTGFAFGMGIERFAMLYYGIDDLRLFFQNDVRFLKQF... 350
159 6.000e-52UniRef50_A0A1Y6CNM9 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y6CNM9_9PROT  ali  41  14..NQVESAFAEQKSALAANPSAKGVEELRVAFLGRKGQVTSIMEQMRNISKDDRPEAGKIXXXXXXXXXXXXXXXXXXXXXFLIQQKLDQAPIDISLPVQSSGKGSLHPVTLMRRVLLKEFRKLGFTVYDGPEVDLDLYNFSSLNFKDDHPARDMQDTFFVKDFDKTVLRTHTSNIQIHALMNQQPPLRVVSPGRTYR-CDSDLTHTPMFHQIECLVVDQNISMGDMKGVIDTFLKAIFGDDLETRLRPSYFPFVEPGGEVDLQCVSCRGKGCRICSQTGWLEIGGLGMIHPNVFEAVGVDSERYTGFAFGFGIDRIAMLRYGLQDLRQLFEGNQQFLGQF... 352
160 8.000e-52UniRef50_A5V922 Phenylalanine--tRNA ligase alpha subunit n=57 Tax=root TaxID=1 RepID=SYFA_SPHWW  ali  43  6.........QDALSEIASAATLADLEAIRVRTLGKSGTITALLKTLGAMTPDQRQAEGPKIHALREAVTAAIADRKASLEGAALEARLATETLDMSLPVSAGMQGSVHPVAQVMDELAEIFADLGFAVATGPEIEDDWHNFTALNIPETHPARAMHDTFYFPDREDGKKMTHTSPVQIRTMMTEKPPIRIIAPGRTYRSDS-DATHTPMFHQVEGLVIDRGIHMGHLKWTLETFVKAFFRDDIVLRLRPSFFPFTEPSAEVDVGFTWEKGRGDPAAGNGGWMEILGSGMVHPRVIANCGLDPDEWQGFAFGCGIDRLAMLKYGMDDLRAFFDGDLRWLRHY... 344
161 9.000e-52UniRef50_A0A0G1Y743 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G1Y743_9BACT  ali  38  2...NIVEAESKALEEIGQVSSLTELEETRLRHLGRNGVVNQLLSEIPELPRQEDRKSAGEIINSVKEKIEIALERKDQELKRKDLKEIDRSSFDTTSPGISPQIGSIHPLTEFREFVRDMFSKLGFEEVYAPHLEEDEYNFGLLNIPPDHPSRDLWDTLYLEDGRAMRTHTSNMQIREMRKRKP--PIRVMTFDRCFRYENVDPHHSHTFTQFEVLYVDKDVSMGQLRFLSDLFLKAVLGEKTRTRFRPKYYPFVEPGVGVDALCPFCEGKGCRICGMEGWFEIAGAGLVHPQVLRNGGIDPKIYSGLAWGFGPDRMLMIKQGIDDIRYFYEGDLRFLKQF... 337
162 9.000e-52UniRef50_B5Y859 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Coprothermobacter TaxID=68335 RepID=B5Y859_COPPD  ali  42  1MMKEVEEVEQVARDFESDLQELP-PDQLKIKYLSRKGLVSKLLEKIPTLPPEQRRDFGKYVNDLKRHIEEQIKQKEEQLLSIGSKHLAQEPLFDLTLEGKRPPLGNVHVLFKARDELLSIFKFMGFSFFDGPELETDFYNFEALNFPPYHPARDMQDTLVVGDR---VLRTHSSAMQVRAMEAWGVPIKVILPGRVYRREEVSARKYPVFYQFDCLAVGENIGVGHLKWTLETFLSAYFEKNVTVRFRPSYFPFVEPGNEVDVKCVFCDGQGCSVCGGTGWLEILGAGLVHPRVLEYAGVDPNRYSGFAFGVGVDRMAMLKYGINDIRLLYEGDVSFLR..... 337
163 9.000e-52UniRef50_A0A2D8U350 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2D8U350_9GAMM  ali  44  6LKTELEKVLDKALRSIKEIKNHEELEKARVQFLGKKSQLNSFMKSLSTLDGKNKADFGKIVNQAKNSLNLSLEEKKKSLKSKVDKKIDNFD---VTMPSRQISIGSLHPITKIMNYSIDIXQDLKFECVEGPEVEDDFHNFTALNIPESHPARAMHDTFYLEDGNLLRTHTSSVQIRA--MREKEIPIRIIAPGKVYRKDS-DITHTPMFHQIEGLYIDKDVSFSNLKSIINIFLKSFFEEELKIRFRPSYFPFTEPSAEVDIEYFNN-------KGEKSWLEILGCGMVHPNVLEMANINSSIYSGYAFGLGVERLAMLKLGISDLRLFYENDLRFLEQXKRV 337
164 1.000e-51UniRef50_A0A1Z8PI36 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Bacteria TaxID=2 RepID=A0A1Z8PI36_9BACT  ali  43  1MIEALADLESSALDSLSLIHDASALEAWRVEHLGSKGALKSVMGMMKDVPKEQKPLAGQRANEVKQRLEAAFQERKANLEQ----ASSPAALLDPTEPGLPPARGRRHPISTTVDAILDVFGRMGFEVAHGPEVEDEWHNFNALNIPADHPARDPVDNFYMQDDVTRLLRTQTSTVQIRTMEAHKPPLRIVAAGRVYRPDTHDATHYSMFHQVEGLCIDEGVSMVDLKTSLMQFARAMFGPEAEARMRPSFFPFTEPSAEVDMKIT--------VKGKTQWMEIGGCGMVDPAVLEAVGIDPERYTGFAFGLGVERIAMRRYGIADIRWMYENDARFLDQF... 332
165 1.000e-51UniRef50_A0A0A0EJ28 Phenylalanine--tRNA ligase alpha subunit n=33 Tax=Bacteria TaxID=2 RepID=A0A0A0EJ28_9RHOB  ali  42  2.....DDLKAKWLGAIGEAADEASLEDLRVQAVGKKGEISLKMRELGKMTPEERQVAGPALNALKDEINTALAAKKTALADAALDERLKTEWLDVTLPGRDRRTGTVHPVSQVWEEVTAIFADMGFAVAEGPQIETDWYNFDALNIPSHHPARAEMDTFYMDDRPPHVLRTHTSPVQIRSMEAQGAPIRTISPGRVYR-ADYDQTHTPMFHQVEGLAIDRDISMANLKWVLEEFFSAYFGTSVKTRFRASHFPFTEPSAEVDIQCSWEGGT-VKVGEGDDWLEVLGSGMVHPKVLSAAGVDPAEWQGFAFGMGIDRIAMLKYGIPDLRAFFDSDLRWLRHY... 340
166 1.000e-51UniRef50_A0A1G1PB34 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1PB34_9BACT  ali  44  1MNWNFQEIQERVEEETQGILSAQDLEAFRIKYLGRKGMIQEIFASLAGLPDEQKPLVGKGANELRSRITAVIEKKKTEIREKENQARH--PLMDITLPGVAPLAGHRHILTQTIDEICGVFERLGFTVQEGPEIETEFNNFTALNIAVDHPSRDAFDTFYLDKPRYLLLRSHTSPAQIRIMQKHKPPLAVVVPGRVYRPDAVDASHSFMFHQVEGLLVDRHVKFSDLKGLLTVFCKRLFGDKIKMRFRPHFFPFTEPSAEVDISCYICDSKGCSVCGRKGWLEIMGCGMVHPHVFEAAGYPQNRYTGLAFGLGVERIAMLKYGVQDIRIFFENDVRFLEQF... 366
167 1.000e-51UniRef50_A0A1J5H1U1 Phenylalanine--tRNA ligase alpha subunit n=19 Tax=root TaxID=1 RepID=A0A1J5H1U1_9BACT  ali  44  5...NLKNLKVEAKKGIEKADNLKDLDEIFRKYLGKKGKITLIFNSLKKLPLNKRKKLGREANLVKIGLEKLIREKTQKFKEEIRAESLGKEKIDITRPGKKVKIGHLHPLTLVQREVEEIFQSMGFSVITGPEVETEWYNFDALNIPKDHPARDMWDTFWLKVEADQRARTHTSPVQIRYMEKHQPPLRIIVPGRCFRHEATDASHEIQFYQLEGLVVDKNISAANFRAIIEEFLKRFLKTDIEIRLRPSFFPFTEPSFEIDVRR-----------KKGKWVEMMGAGMVHPNVFKAAGLIPNGWQGFAFGAGLDRLAMLKYKINDIRLFYSGDLRFLKQF... 360
168 2.000e-51UniRef50_A0A2M7FEP7 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Gracilibacteria bacterium CG17_big_fil_post_rev_8_21_14_2_50_48_13 Ta  ali  40  1MVSQILSLAAKAKADIESATTSEAIDDIIKGFLGKNGGLGEILKGIKDLPDDQKKLVGPEANKQKDALLSFAEQKKSALAEAALTAALETSTFDPTMPGKKNQLGGLSPFTRMADKAVRVFEKLGFAVWDGGDIVNDFENFGALNFPDDHPAREMHDTFYVEQGYLLRTHTSTLQ--YHILKTKDFPIRAIVPGKCFRNEATDARHEAIFTQLEGIVVDTNITVTHLIATLELFLKEIFEEDVKTRIRPGYFPFVEPGLELEIHCLVCHGSGCRLCKGLGWIEVMPCGMIHPNVLKNAGVDPEKYSGFAFGFGLSRLTQLKYAIADCRLMYADDPKFLGQFQ.. 344
169 2.000e-51UniRef50_A0A257B394 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Chloracidobacterium sp. CP2_5A TaxID=2012633 RepID=A0A257B394_9BACT  ali  51  58..................................KQGALALQLRQLGTLPPDARPARGAALNAFXXXXXXXXXXXXXXXXXXXXXEAIRREAVDVTLPGLARRRGRAHPLTQIRERIEDIFVAMGYAVEDGPEVDTVFYNFDALNIPPDHPAREMTDTFYINDELALRSQTSNVQIHAMQRRRP--PLRVIAPGRVFRRDEPDATHNPMFFQVEGLNVARGITMADLKGTLQAFLTRLFERPVTLRFRPSYFPFVEPGAETDFQCIFCSGTGCRVCKRTGWIELGGSGMVHPNVLRACRIDPAEFSGFAFGFGIDRMAALLYGIDDIRLYFENDLRFLSQF... 362
170 2.000e-51UniRef50_A0A1G1WX98 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Candidatus Woykebacteria TaxID=1817899 RepID=A0A1G1WX98_9BACT  ali  42  1MQSEIDKTSQKFESEIEKIHNLEDLENLRILYIGKKGILNSLFDKLKTLPNQEKVVLGPLLNTLKNTIESKLKAKLNSLSAISGN-----KKIDISAPGKNSQLGYLNPLTIVLEDMKDIFHHLGFTFVDGPEVESDVYNFQKLRLHKDHPARDAQQTYYLDEDILLRTHTSSMQIRYMENNAP--PIRIISPGRVFRRDQIDATHLPSFMQFEGLLVDKETTLGELIGTIKYFIRECFGRDIQVRVYGHHFPYTEPSIEVEMFH----------PKLNKWVEMGGAGIVHPEVLSGVGINPDEYHGWAFGFGWERLAMLKYGIDDIRLFYQGDKRFLEQF... 325
171 2.000e-51UniRef50_UPI00047AAE12 phenylalanine--tRNA ligase subunit alpha n=1 Tax=Acholeplasma modicum TaxID=2150 RepID=UPI00047AAE12  ali  47  1MSNNIEKLKEEIRLKVEEALTKEELEIIRNNYLSKKGEFAKLMASMKDLPNEEKPAFGKLVNEAKTLIELILLDKLSIIKDKLLEEKLNNEKIDITVKGDKFSLGTIHPLNQVIEDLEDFFIAMGYEVKEGPEVELDLYNFEMMNFSEGHPARDMQDTFYVEDKVLLRTHTSPVQA-RTMLESKNNPVKIICPGKTYRRDEDDLTHSHQFMQIEGLVIDKNISFANLKDTLLRMVRHLFGEKREIRVRPSYFPFVEPGVEV-------DVVVNNNDGTKRYIEVLGAGLIHPEVLRMGGYDPKEFSGFAFGIGVERIAMLKYNVEDIRNFYLNDLRFLQQFKG. 335
172 2.000e-51UniRef50_A0A0P6WX81 Phenylalanine--tRNA ligase alpha subunit n=60 Tax=Bacteria TaxID=2 RepID=A0A0P6WX81_9CHLR  ali  42  8..NELEELRKKGLESLQVVQDELGLQNWKVANLGRSAPMTQIFSQMKTVSAEVRPLVGERVNQVKKEFEAALEEHAAAIKQAMLNKSLTSDAVDISLPGRRPAHGRLHPQTKMLREIYRIFGDMGFQVYRARDVETDEYNFELLNIPAYHPARDMWDTFYTTKPGVILRTHTSPGQVHVMREYCPEPIRVILPGMCYRYEQISARSEIQFHQVEGIMVGKHVTMGDMKGTLTDFARRLFGANARTRLRPSYFPFTEPSGEMDVECFVCHGAGCQVCKNSGWLEILGCGMIHPTVLRNGGYDPSVYSGFAFGMGPERISMLRNQINDIRNFWANDVRFLEQFS.. 347
173 2.000e-51UniRef50_W6CHJ8 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=6 Tax=Lactobacillales TaxID=186826 RepID=W6CHJ8_9LACT  ali  61  3.......................................................................................................KGSRHILTQTQEEIEEIFLGMGYEIVDGYEVETDHYNFERMNLPKDHPARDMQDTFYITNEVLLRTHTSPMQARTMDSHDSKGGLRMIAPGRVYRRDTDDATHSHQFHQIEGLVVDKNITMADLKGTL................................................................................................................. 131
174 3.000e-51UniRef50_UPI00082D1970 phenylalanine--tRNA ligase subunit alpha n=2 Tax=Leptotrichiaceae TaxID=1129771 RepID=UPI00082D1970  ali  48  23......................EDFNEIKVKYFGKKGAFTTIMKELGNVVAEKRKEMGQVANIIKNELQVKFDERNSLIKEAIKKKKIETETIDITLPGKVIEKSSLHPLTKTLIDIKEIVSEMGFDIVDGPEVEEVQLNFDALNIPKTHLSREITDTFYITDDVVLRTQTSPVQIRYMKEHKP--PFKMISIGKVYRP-DYDVSHTPMFHQIEGLMVGEDVSFANFKAMLESIVQRIFGSDRNVRFRPHFFPFTEPSAEMDVECGVCKGKGCRLCKHTGWLEILGSGMVNIKVLEAGDIDGNKYQGFAFGMGVERITMLKYGIDDLRAFFENDIRFLEQF... 338
175 4.000e-51UniRef50_A0A1G1C1F0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Microgenomates group bacterium RBG_19FT_COMBO_39_10 TaxID=1817748 RepID=A0A1G1C1  ali  38  4..NKIQNLKNQAISAILEAESDQELEELRIAYLGRKGEITQLLKKIPSLSSSERKEIGRTANDAKRAIEQTLKDAKKAQTTKKVDVD--KEWLDVTAPGLKPNVGHLHPLSQILYETVDVFKQIGYQVAEGPEIEDDRHNFEILNFLKDHPARDTQMTLYLETPGEILLRTHTSAMQGRVMEKTKPPMRVIVPGKCYRYEQVDASHGFEFWQVEGFAVDKKITLTDLFGTIEYVLKKLMGEKAKIKFACTYFPFVEPGVDTYLECTLCQGKGCPFCKGLGWSEVLPAGMIHPNVLKACQIDPQKYTGFAFAIGLSRIVSLRYNIHDLRLLFTPDLRILNQF... 346
176 6.000e-51UniRef50_V5WNC2 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Bacteria TaxID=2 RepID=V5WNC2_9SPIO  ali  42  1MVEQLQQMLEDFKTGIEKVQSLPDMAQFKAEYLGKKGRLKGLMAGMRDLSPEERSSFGAKANEAKQFMEKLIQEQSTRIELEEINSRLDKEWQDISWTDRLKDKGQQHPLSSVMRGLEDIFLSMGFDILDGPHIEDEYHNFEALNIPANHPARDMQDTFWFQDKKHLLR-THTSNIQIRGMEQHKPPFKFVGPGKVFRSEALDASHEAAFHQLEGMMVGKDISVSHMIHFLRTLLSEIFQKEIKVRLRPGFFPFVEPGFELDYECLLCGGTGCSVCKQVGWVEALGCGMVHPNVLKAGNIDPREWNGFAFGLGVDRLTMMRYHIDDVRHIHSGDLLFSQQFK.. 345
177 7.000e-51UniRef50_Q2IJB2 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Bacteria TaxID=2 RepID=Q2IJB2_ANADE  ali  53  26......................KGLEELRVRFLGKKGELSQVLRGMGQLPAEERPRVGEVANRVRDEVEALLAGAARGVAARALEAELAGPPIDVTLPGRRLPRGHRHPVTRATEDISAIFARLGYEVASGPEIELDWYNFEALNIPPDHPARDMQDTFYVDESTVLLRTHTSPVQIRAMKRIGGPPIRIICPGRVYR-SDYDQTHSPMFHQIEGLCVDEGITFADLKGTLAAFARAYFGPGTRTRFRPSYFPFTEPSAEVDVSCSICGGTGCGTCKETGWLEVLGAGMVHPRVLENGGVDPRRFTGFAFGMGVERMAMLRYGIDDLRLYFENDLRFLEQF... 369
178 7.000e-51UniRef50_A7WP22 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=38 Tax=Terrabacteria group TaxID=1783272 RepID=A7WP22_LACFE  ali  60  1............................................................................................................................................................DTFYVTPSVLMXTQTSPMQARMLEQHDSKGPLKMISPGKVYRRDTDDATHSHQFHQVEGIVVGEHVTMADLKGTLEAVAQNLFGDQLKVRLRPSYFPFTEPSVEADITCFNCLGAGCSICKGTGWIEVL........................................................... 130
179 8.000e-51UniRef50_K2BY20 Uncharacterized protein n=2 Tax=groundwater metagenome TaxID=717931 RepID=K2BY20_9ZZZZ  ali  38  2...DLKQLLNKYQPLIAQATTAEALDQIDQQLFNKKGELGTALRSLKGIPATQRKQAGETANQVKATLQQALAEARHSLGTADIQFDRTLPPIV-------PTRGHWHPLHLVQNELVDIFRSMSFAVYEGNELETEDYCFEYLNIPASHPARDLQDTFYIDRKRRDVMRTHTSNMQVRVMKQLQPPLRVIVPGRVFRNEAIDASHEHTFYQMEGMVVDKNISIANLTYMLRQTMSSLLNADVNIRLRPGYFPYVEPGFEADCSCTNCAGKGCSMCKQTGWVEMLGCGMIHPNVFKAVGYAPGEYTGFAFGLGLNRLAMLKYGINDIRHFMAGDLRFLKQF... 338
180 1.000e-50UniRef50_A0A202DKP3 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium F11 TaxID=1932698 RepID=A0A202DKP3_9BACT  ali  42  2...DLKELEKEAFEALDQIKTLPDMESLYTRYLGRKGQLTKILRSLGSLPPEEKKAIGREANQLRTLLEEKISLKKKTLEDNVLDQRIKDQQIDLTLPGRAHPQGRSHPILQTIDEICDIFKSIGFQIVVGPDIETDFHNFTALNIPQNHPARDMHDTFYLNKNQPLLLRTHTSPVQIQLMKKVKPPVRIVAPGRVYRHEAIDATHAAIFHQIEGLVIDEKISFADLKGTLSYFVHQYFGKNKKVRFRPSYFPFVEPGAEMDMEWPLKKGSSAS-----NWMEILGAGMVHPQVLRNVGYDPKKYTGFAFGMGIERIVMARYQIPDIRYFLESDLRFLEQF... 343
181 1.000e-50UniRef50_A0A0B7HIL9 Phenylalanine--tRNA ligase alpha subunit n=64 Tax=cellular organisms TaxID=131567 RepID=A0A0B7HIL9_9FLAO  ali  44  1MIDKIKE--DIAQVEGFNATTKEEIEQFRIQYLGKKGILNDFFAAFKQVPNEEKKAFGQVXXXXXXXXXXXXXXXXXXXXXXXXXKGV---YGDLTRPATPISLGARHPISLVKKQIVEIFSNIGFNVSEGPEIEDDWHNFTALNLPEYHPARDMQDTFFIQTNPDILLRTHTSSVQVRYMENHQPPIRTISPGRVFRNEAISARSHCLFHQVEGLYIDKDVSFADLKQTLLYFTKEMFGKS-KIRLRPSYFPFTEPSAEVDIYWGLNNEIDYRITKGTGWLEIMGCGMVDPNVLKNCNINSEEYSGFAFGMGVERIAMLLYQIGDIRMFYENDVRFLEQFK.. 336
182 1.000e-50UniRef50_A0A2C8CYF6 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A2C8CYF6_9GAMM  ali  47  4....LAELIIQAKIAIAQCQDIQALESVRVKYLGKKGYFTKQMLALRDLAPDVRPAKGAVINQAKRDLQKLLAEREIKLKRADIETRLAEEMLDVSLPGRRMGNGGLHPVSRTIERIEHFFCNIGFSVITGPEIEDEYHNFDALNIPVHHPARDAHDTFWFDATRLLRTHTSGVQIRAMKKQRP--PIRILSTGRVYR-HDYDKFHTPMFHQMEGLIIDIDINFANLKSTLHDFLCNFFEEDLQVRFRPSYFPFTEPSAEIDVMG-----------KNGHWLEVLGCGMVHPNVLRNGKINPEIYSGFAFGMGMERLTMQRYDITDLRAFFENDLRFLKQFK.. 327
183 1.000e-50UniRef50_C5CUU6 Phenylalanine--tRNA ligase alpha subunit n=45 Tax=Bacteria TaxID=2 RepID=SYFA_VARPS  ali  40  2..NELDSLVATARAAFAEAKTPAELENAKAQFLGKSGRITELMKGMAALSVDEKKSRGAAINVAKQAIEAALTERRQQLADEELSLQLRAEALDVSLPGRRRIPGGLHPVSRTLERIEEIFSSMGFDVADGPEIESDWHSFTSLNNPPNHPARSMQDTFYVDIPYNLRPHTSPMQVRYAHQHIKKYAIRVIAPGRTYR-VDSDATHSPMFHQCEGLWLGENVSFKDLKVVFTDFCRTFFEDDLVLRFRPSFFPFTEPSAEIDIQFASGPLAG-------RWLEVAGSGQVHPNVVRNMGLDPERYIGFAFGMGPDRLTMLRYGVNDLRLFFDGDLRFLSQFQ.. 358
184 2.000e-50UniRef50_A0A0S4M6U0 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=bacterium 2013Arg42i TaxID=1561003 RepID=A0A0S4M6U0_9BACT  ali  41  1MHEDLSLLEERALSEIEAADTVAALDRVKAVYIGKGGLVTGPLGSIKDLPPSERRDVARSLNVLRTKLEDAVRQRRSFIDDELVKKQLLSDSVDCTLPARGHCEGGYHPLSLVMRRLRSFWHSAGFSQVYGPEVEDDWHNFTALNTPDTHPARSMQDTFYLHDGLLLRTHTSPIQIRHLSVNTP--PVRVIGMGRVYR-VDHDTTHSPMFHQIEGICVDESTNFSQLKCLLKLFVCQFFDDKIKVRFRPSFFPFTEPSAEIDVFFQTPQMT------EPKWLEIGGCGLINTNVLSMCNIDCDKYRGFAFGLGIERLAMLFYGIADLRVFYQNDLRFLSQF... 333
185 2.000e-50UniRef50_A0A0G0QJK2 Phenylalanine--tRNA ligase alpha subunit n=29 Tax=root TaxID=1 RepID=A0A0G0QJK2_9BACT  ali  39  1MREEIQNLKNEALAQIMEAKDSNELEGLRIAYLGRNGKLTKLIKEIKGLSDSEKKEVGRLINESKNAIFETITSKKNQLKVVKR------EWFDPTIPGKKYKIGKLHPTTQVINEMYEIFKHLGFSIIEGPEIESDVYNFEKLNLPKDHPARSLQDALYIEEPDVVLRTHTSSVESRALETLKP-PFRVVVAGKCYRYENVNATNNAMFYQFQGFAVQKGISMADLKGALYSFVRSFFGEKREIRFRCKYYPEVEPGAGLDLDCLFCNKKGCSVCKGRGWIEMLGSGMIHPNILRSFGYDPKKISGYAFGMGLDRIVMDRFKISDIRSLYNGDIKY....... 330
186 2.000e-50UniRef50_A0A1W9WCR9 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Anaerolineaceae bacterium 4572_78 TaxID=1972460 RepID=A0A1W9WCR9_9CHLR  ali  44  1MRQELETLGQTAQTTLIEITDSEMLNKWHVKYIGRKGAITTMLRRVGELSKEERPAFGKRANELKKELEHAYQSREYEIKASEMKQAFAVGSIDVTLPGRPIERGRLHPSTQTLRLIYQIWADMGFQIYRSREVELDEYNFQMLNMPPHHPARDMQDTFYTTKENVLLRTHTSPGQIRAMHEYHPEPIRIILPGMVFRYEQITPSKEIQFHQVEGLAVGRNITMTDLKGTLNSFAQRIFGKGRPTRFRASHFPFTEPSAEMDVQCILCHGKGCRVCKHTGWMEILGCGMVHPTVLRYGGYDPSEFTGFAFGMGPERIVMLRHGIEDIRYFWGNDLKNL...... 338
187 3.000e-50UniRef50_A0A0U3NQP7 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Mycoplasma sp. (ex Biomphalaria glabrata) TaxID=1749074 RepID=A0A0U3NQP7_9MOLU :  ali  45  1MLEQFNKHAEDILNKIKVANTIDDLQQIFNKYFGVNSELKQYTTKLKELNPEEKKILGQAINSLTKESESLIKERQKFLEEQKFLLSLEKEKIDITLEAKKMNHGSIHPINLVLYKIHDIFKQLGYTVIDGKEVETDLFNFEKLNIPKGHPAREMQDSFFIDEENLLRTHCTNATAHVLTEAKKNMPVRVVSTGNVYRKDDDDATHSHQFTQIDVVNLGQGITLANLKWTLEFFAKEMFGEKTQIRMRPSFFPFTEPSMEVDVTCVHCKGRGCAICKKTGWIEILGAGMLHPNVLELCGHDSKVIQGFAFGIGAERIAMLKYHVSDIRYFYNNDIRFLKQFKK. 349
188 4.000e-50UniRef50_A0A221SYF9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Deinococcus ficus TaxID=317577 RepID=A0A221SYF9_9DEIO  ali  41  1.......MQQEAIQEITQAPTLEALQQVKTKYVGKSGLVTKELGALGKLPPEERKARGAEINAVRQAIDAALQEREGILKRAALDEKLASEAIDVTLPGLPLPAGGLHPITRVYDDLIGIYQRMGYEVVEGPEVEGEHHNFEALNIPWYHPARDLQDTFWLEDGRLLRTHTSNMQI--RYMVEHDPPLKMVSRGKVYRYEATDATHESMFHQLEGLVVGEGISMADLKGTIAEMARGLYGPTAQVRFQPSYYPFVEPGADFAVYWNNPR-------GESKWLELGGCGMVHPNVFEAAGRDYEGMTGFAFGLGPERIAMLKYKIPDIRYFYANDPRVIGQFRG. 336
189 4.000e-50UniRef50_A0A1G1JTC9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1JTC9_9BACT  ali  47  1MIEALKEIETRAKEEALVVRDAKAFEALKNKYLGRKGLFAFLTARISEVAPEERRAVGQEMNRVKQALEEIFSEYGKSLGASGAVYTKEIDT---TMPGTYPAAGSLHPLTLVVQEVTSIFERLGFRAVDWFEAEDERHNFDALNIPTDHPARDSFDNFYLDDPNLLRSQTSTVQIRFMDWTKRRPPFKIIAPGKVYRPDATDATHSFMFHQIEGLYVDEDVSFAHLKGVLERFAKEFFGPETMTQFRPHFFPFTEPSAEMDVQW-----------ESRGWLEILGAGMVHPRVLRAVNIDPQRYSGFAFGMGVERMAMLKYGVKDIRQFFENDIRFLRQF... 335
190 5.000e-50UniRef50_A0A0K1PAG9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A0K1PAG9_9DELT  ali  50  8.QAEIDAARAAALRAIDEAGDEQALEAARVEHLGKSGRISLLRRNIGQLPPEQKKPFGEAVNAAIESVEGALTHRSEALAAAKLEAELSGSPLDVTLPGRPVRQGRRHPLSQTMEDLVSILGRMGFSVASGPEVELDYYNFEALNFPKNHPARDMQDTFFVDDPGELLLRTHTSPVQVRTMLEKQPPIRIIAPGRVYR-CDSDQTHSPMFHQIEGLYVARGVTFAELKGTLDELVRTFFGREVRTRFRPSFFPFTEPSAEVDISCVICGGTGCRVCKATGWLEVLGAGMVHPKVFESVGYDPRTVSGFAFGMGVERIAMLRYGIDDLRLLFENDVRFLAQF... 391
191 5.000e-50UniRef50_A7WNW1 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=21 Tax=Lactobacillales TaxID=186826 RepID=A7WNW1_LACSN  ali  59  1............................................................................................................................................................DTFYITKEILMRTHTSPMQARSLEKHDSKGPLKMISPGVVFRRDTDDPTHSHQFHQIEGIMIDKHITMADLKGTLETMTHKLFGDKFKVRLRPSYFPFTEPSVEADITCMNCGGKGCDVCKGSGWIEVL........................................................... 130
192 6.000e-50UniRef50_UPI00083F8648 phenylalanine--tRNA ligase subunit alpha n=1 Tax=Rhodohalobacter halophilus TaxID=1812810 RepID=UPI00083F8648  ali  39  1MIDNIEKIKKEIQD--FNISNEDDLEAFRLEFLSRNGKIQSMFALMGKVPKEQKAEVGKAMNGVKVLAQQKFDDAQLELKKATRKEFGALD--DITLPVEPTYAGSFHPLTQALDEMKQIFLRLGFNIADGPELENDFHNFTALNFPPDHPARDMQDTFFVRNEQDLVLRTHTSPVQIRLMKNQQPPLRSIMPGRVYRNEAVTAKSYFQFNQVEGLYVDKNVNMGELIETLVMFAKLMYGSDVKYRVRPSYFPFTEPSIEMDVWW--------ENEKGGQWLEILGAGMVDPNVFESVNVDPEIYTGFAFGMGVDRIAMLRYGIDDIRLLYENDIRFLEQFK.. 335
193 6.000e-50UniRef50_A0A1F8AR20 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=root TaxID=1 RepID=A0A1F8AR20_9BACT  ali  39  1MREEIINLKNLAIGRITDTDDLAELEAVKIDYLGRKGKINALLSNLKKADPGERKDLGQLINETKQTIVATLERKLQDSL------PKSSENFDPTIPGIKPKIGHLHPTTIVIKEMFDIFGHLGFSIMEGPEIETDDYNFGKLNLPHDHPARSLQDVLYIDEPEILLRSHTSSVESRALDNLKQ-PFRIVVAGKCYRYESVNASNNAMFYQFQGVALQAGISMADLKGTLYYFAKSFFGRERKIRFRCKYYPEVEPGGGLDIDCIFCKQTGCAVCKGRGWLEMLGCGMIHPNILSNFSLDPKKISGFAFGMGLDRIVMDRFGIKDIRSLYNGDIKY....... 330
194 8.000e-50UniRef50_A0A2W4MHH6 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2W4MHH6_9ACTN  ali  45  7....LEEALASAAPKVGEAATVEDIDRIESALLGKESAVGQVRRAMAAIAPEDRPRVGARLNEVTTEIQRLIEARRAELQAAEDARRLAEDAIDVTLESVRMPAGSRHLIQQVIDEVVDIFVGLGYRVAEGPEAELAWYNFDALNTPKTHPSRLESDTMYLDWGNPEDERTQTSPVQARYMESHQPPVYIVAPGRTYRTDTVDATHLPVFHQIEGLAVDEGLTLGDLRGTLAHFAREFFGSGTQVRLRPSFFPFTEPSAELDVSCFACDEPGCRVCGGAGWLEMLGCGMVDPNVLSAAGYDPEVLSGFAFGVGVERLAMVRHGLDSIKNFIDNDIRFLRQF... 348
195 8.000e-50UniRef50_A0A2D8GFU5 Phenylalanine--tRNA ligase alpha subunit n=35 Tax=root TaxID=1 RepID=A0A2D8GFU5_9ACTN  ali  43  10...DLDAIVADAAERLADARDLDALAALDAEFLGKKSAVTAAKKQLGGLDPDDRKAAGQAINAARTSLEAAIAAARERLAAGERAAQYEAERLDLSEKLGEIRRGSLHLNTQARDRLEDVFVGMGFTIAEGPEVETAWYNFEALNIPEWHPARGSFDTIFVNEEVMLRSHTSPVQIRTMENQEP--PIYIVAPGRTFRTDTADATHLPAFNQIEGLVVDRGITLGDLSGTMDEFVRAFFGGEVKTRLRPSYFPFTEPSAEFDISR-----------PDGSWLELGGCGMVHPNVLRNCGIDPEEWQGFAFGFGIDRLAVMRYELDDIRELVNNDVRFLRQF... 338
196 1.000e-49UniRef50_Q8UIN5 Phenylalanine--tRNA ligase alpha subunit n=4856 Tax=root TaxID=1 RepID=SYFA_AGRFC  ali  42  3...ELDTLKSQLMSEIAAAADEPAIEAVRVSALGKKGSVSELLKTLGSMTPEERQTRGAAINQLKTEITDLIGERKNALKDAAIAARLKAETVDVSLPVRQTERGRIHPISQIVDEITAIFADMGFSIAEGPDIETDYYNFTALNFPEGHPAREMHDTFFFEKGERKVLRTHTSPVQIRTMESQKPPIRIVIPGKTYR-QDSDATHSPMFHQVEGLVIDKKAHVGNLRWVLEEFCKTFFEDSVVMRFRPSFFPFTEPSFEVDI-QCDRSGPIVKFGEGKDWMEILGCGMVHPNVLRAGGLDPDEYQGFAWGMGLDRIAMLKYGMPDLRDFFNADVRWMNHY... 344
197 1.000e-49UniRef50_A0A2E4HWL3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E4HWL3_9BACT  ali  48  2.....ERLRTDFAREAGGVRSLAELEELRSCYVGRKGRLTAIFDTMGSLPGEIRGRVGRAANDARQEITRQLEEIKASLNK---DVGNEVPPLDVTLPGRSNKAGSLHPITLALQEIVDVFTRMGYTVLGGPEVEHDYYNFEALNIPRDHPARDSQDTLYLDSDWLLRTHTSPVQIRTMEEQEP--PLAIIVPGRVYRRDTPDATHTPSFVQCEGLLVDRDITMADLRGTLDHFAKALLGPQTQTRLRPGYFPFTEPSAEMDANA------------GNGWIEMLGCGMVHPAVFEKIGYDPDEWQGFAFGMGVDRIAAMRYGITDIRTLYENDARFLRQFTG. 323
198 1.000e-49UniRef50_A0A2E1QNP6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E1QNP6_9GAMM  ali  46  2...DLAKLKQELKKDFNLSKSSEDLQKLKVKYLGKKGKITXLSKTLGKLDQKDRPIVGKKINQIKXLFQDLVKSSSKRIEDFELDNEISKEXVDVSLPVGKIFAGGLHPITKTIDKICSYFSAKGYLIEEGPEIESEYYNFDALNIPENHPARDMHDTFYVDSGKLLRTHTSPVQIRSIEKYN--VPLKIICPGKVYRSDS-DPTHTPMFHQIEGLLIDENVNFGNLKKELIDFLNYFFAKKLDVRFRPSYFPFTXPSAEVDIMD------------KNGWLEIMGCGMVHPDVLEMAGIDSKKYSGFAFGLGIERMAKLDYSIKDMRVLFENDLK........ 319
199 1.000e-49UniRef50_A6G4W0 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Bacteria TaxID=2 RepID=A6G4W0_9DELT  ali  41  10.EDLLREQQQAFEAALPEVEDDEGLYALQVRFLGKKGSITKLRKLMGKVPPDQRRALGQAFNAVKQTVEGGIEARKLELVELARAREL-ARRVDLSFQPQRRRAGSGHPVLSTRRQLEQVFRRLGFDVLDGPHVEVEDYNFDRLNFEPDHPARDMQDTFFIDSSPSFVLRTHTSPVQVRTMLSHPPPIKIVAPGTVFRNDD-DPTHSPMFNQIEGLYVDRGVTMADLKATLYAFVGAFFGEGLEVRFRPSFFPFVEPGAEFDMQCPFCRDEGCGLCKQTGWIEIGGSGMVHPAVFEACGIDSSVYTGWAFGFGIERMAMLRYAVPNLKHFFEGDQRVLEQF... 364
200 1.000e-49UniRef50_A0A2E0SC12 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Planctomycetes TaxID=203682 RepID=A0A2E0SC12_9PLAN  ali  44  8..DQLEQLVSEAESTFNSAANTDALEEARVEFLGKNGKLKSVQKLMGTVEKEDKPVAGKTFNQTKGRIESAF-ESASERIQGGSGDSERDTQFDPSLPGTGFKIGRAHPITQTIEELKDIMGRLGFSTADGPEIEDDWHNFVALNIPDDHPARDPLENFYLKTPVNLLLRSQTSTVQIRVMEKTKPPIRIISLGRVYRPDTADATHYPMFHQIEGLMIDTKVTMADLKSVLRLFATSYLGDDVTIRFRPSFFPFTEPSVEADYYW------------NGQWIEFGGAGMVDPNVLKAVGYDPEEVTGFAFGLGVERLCMRRHGITDIREFYKNDVRFLAQF... 343
201 1.000e-49UniRef50_A0A2H0Z9U9 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2H0Z9U9_9BACT  ali  40  10........LSRIEKEFFSVPGGEDPGRLEQKYLGRKGELALLLRELSSFSIEDKKRLGQTGNALKNKLQENLDSRKTSRGAAASEARPA---LDLALSGYPYPRGSVHPVTFTANKIIDSLGKLGFSLEDGPLAEMDYYNFEALNFPPHHPARDMQDTFYLNKNMDYLLRTHTSPVQIRTMKSRKPPVRAISFGKTFRSEAVDASHSFVFHQMEGFYADKNVSMADLKWTLETFIKDLFGSGAKIRFSPSYFPFVEPGAQVEVSCVFCGRNGCPVCKGSGWLEMLGAGMIHSEVFKACGYDPEKVSGFAFGAGIERFAMLLFGIRDMRMLYENDLRILKQ.... 356
202 2.000e-49UniRef50_A0A2A5EDA8 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A5EDA8_9BACT  ali  42  1MKEQIESIIQESQK--FAITTKEQMEDFRLKFLVKKGLVNQLFQEFKNLDGEEKKKWGKDLNIVKNKVEAIFKNAESKLIGSEDTSDGKSE-----LPGYYSEMGSRHPISAVVEEMTQIFERLGFSVETGPEIEDDWHNFSALNFPANHPARDMQDTFFVGEDIALRTHTSSVQVRL--MEEGNLPIRSIMPGRVYRNEAISARSNCFFHQVEGLYIDKEVSFSDLKQTLYNFVQEFFGANTKVRFRASYFPFTEPSAEMDIYLGTESESDYRLTKGTGWLEILGCGMVDPNVLENCKIDTKEYSGFAFGLGVDRIAMLKYGVKDLRTFFNSDKRFLDQFVNL 335
203 2.000e-49UniRef50_A0A2A5YBU8 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Actinomarinales bacterium MED-G02 TaxID=1986262 RepID=A0A2A5YBU8_9ACT  ali  39  5...NLDKIYASFLLSLDDIKDISELPQIEKNYLGKGSVLSEERAKLANLSNEDKKKYGSLLKQFADNVSIKLENFKTDFEKSFFIEKEKAENPDITVDWFSKKGSRKHVLTTVMEEVVEIFASLGYTVAHGPEAETSWHNFDALNTPDWHPARYESDTLYLDKDLNNLLRTQTSTVQVRHMQENDPPVYIVAPGRVYRSDQLDATHSPVFHQIEGLAVDDGITFSDLKGTLEYFVKAFFGENVQTKFIPHFFPFTEPSAEVLVSW-----------KDGEWLEILGCGMVDPNVFQNV-KYPETTQGFAFGVGVERLAMLRYGIDHIKNFYENDLRFLEQF... 330
204 2.000e-49UniRef50_A0A2H0PIN9 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_45_16 TaxID=1973974  ali  43  5...........AKEKIHSAKSSDEVEQLRVEFLGKKGKVSALLSILRDATPEDRKKIGATGNKVKINLETGISXXXXXXXXXXXXXXXXXXXXXSSLPGLTNAFGRPHPVRQIMREACQILERAGLKSVYGPEVEYEDYCFDRLNFKPGHAARDMQATFFVKNAQALRTHTSPVQVRVLLDLAKKEFIRMFAPGRVYR-VDDDATHSPMFHQIEGLVVDKTSGMGDLKAHLDYFFRQFFSQSTKVRFRPSYFPFTEPSAEVDISCVFCDGKGCRVCKSSGWLEVAGAGLVHPEVFKACGWDPEAVGGWAFGMGIERLAMLKLRVPDLRSFFENRLSFLR..... 338
205 2.000e-49UniRef50_A0A1V5T3G1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Atribacteria bacterium ADurb.Bin276 TaxID=1852833 RepID=A0A1V5T3G1_9B  ali  48  23......................DDLNRIKGKYIGRKGQLNELFKEITQLSSDEKKDWGKKINHLKGLIDNQLQEKLKELTQTLKTSI----KVDISLPGKKPWVGSFHPIQLTLHQILTIFQSLGFRIESGPEIESEYYNFEALNFPPDHPARDAQDSFFLDKEYLLRTHTSPAQIRIMQKIQP--PFKVVVPGKCFRRDAMDASHSPMFHQVEGLVVAETISMGDLKGTIEVFAQRFFGNDRQLRFRPSFFPFTEPSAEVDISCGLCQGKGCRSCGQSGWLEIMGAGLVHPKVFEAAGYNPNQVRGFAFGMGIDRAALLKFGIPDIRWLFENDMSLIEQFHAI 338
206 2.000e-49UniRef50_A5GMH3 Phenylalanine--tRNA ligase alpha subunit n=42 Tax=cellular organisms TaxID=131567 RepID=A5GMH3_SYNPW  ali  51  35.........................EQLRVGLLGKKGRLSGVLGAMGKLPGNERPLVGQRANVLKTQVQSLLGERLLAVKQAAMEARIAAETLDVTAPPLGVPMGHRHPLISTTEEIVDLFCGLGYQVEEGPEVETDHHNFTALNIPPDHPARDMQDTFYLKDNLLLRTHTSPVQIRHLETNPP--PVRIVAPGRVYRRDAVDATHSPVFHQVEVLAIDEGLDFSHLRGTVMAFL-KAFFGDLPVRFRASYFPFTEPSAEVDVQW------------RGRWLEVMGCGMVDPAVLEGLGLDPERWSGFAAGLGVERFCMVRHGIDDIRRLYTSDLRFLEQF... 335
207 2.000e-49UniRef50_A0A1V5R752 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Acidobacteria TaxID=57723 RepID=A0A1V5R752_9BACT  ali  39  9...EIQEAHAAFPVALAACDELDALNRLKGAYTGREGSAARLMDLLKTAPKEQKRDLGAVINGLKQAWEEGLKSRQAELEAARKQVAGLAAHWDAELPRPLPARGALHPLTRVMDRLVDVFRPLGYHVEEGPEVETEAHNFDGLNIPEDHPARGSADTFYLNAHPGLRTHTSPVQVRALKRLAPEITIRFLAPGRVYRKDEIDPTHSPMFHQVEGMLVGHDIGLHHLKGTLAYAMKALFGPGAEVRFRPSYFPFVEPGCEMDVRCPLCGGAGCRVCKGSGWVEILGAGLVHPNVLAFAGIDPAEWSGFAFGMGVERMAMMLSQTPDLRLFFENDQRFLAAMGGL 356
208 3.000e-49UniRef50_A0A1Z8QVV1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Bacteroidetes bacterium TMED39 TaxID=1986664 RepID=A0A1Z8QVV1_9BACT  ali  40  1MIDQLKNIEEELNQA--EIKTSEELAIFYKYFLSKKGKIALLLYDFKSLPAENKRTVGKPLNLLKRXAEELYDAAXEMLEGQSQEXXRNFL-----LDPQKIEIGARHPISVVKNRIEQIFRYMGFGISEGPEIEDDWHNFEALNFPPDHPARDMQDTFYLEKGYALRTHTSSVQVRVMETTKP--PIKTISPGRVYRXEAVSARSNSFFHQVEGLHIDEGISFADLKQTLYSFVSSFFGRDLEVRFRASYFPFTEPSAEMDIFLGTETEEDKRLTKGTGWLEILGCGMVDEQVLKNCGIDPNKYSGYAFGMGIDRIAMSLFDIKDIRDLFNNDTRMLNQF... 332
209 3.000e-49UniRef50_Q5SGX2 Phenylalanine--tRNA ligase alpha subunit n=38 Tax=Thermaceae TaxID=188786 RepID=SYFA_THET8  ali  38  1.......MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQEXXXXXXXXXXXXXXXXXXXXXAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLEVEGRLLLRTHTSPMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYFPFVEPGAQFAVWW----------PEGGKWLELGGAGMVHPKVFERLGLPPAYVTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKFLEQFKGV 349
210 3.000e-49UniRef50_A5GUT5 Phenylalanine--tRNA ligase alpha subunit n=41 Tax=cellular organisms TaxID=131567 RepID=A5GUT5_SYNR3  ali  48  28..................APDAAALEQLRIDLLGKKGKLSGVLGAMGKLPGDQRPVVGQRANVLKTQVQSLLQERQSALKEAALEARIASETIDVTLPPVYTPAGHRHPLLSTTDAIVDIFCGLGYRVVEGPDIESDYYNFSALNIPEEHPARDMQDTFYLPGDRLLRTHTSPVQIRHLESNPP--PVRVIAPGRVYRRDAVDATHSPVFHQVEVLAIDEGLDFSHLRGTVSHFL-KAFFGDLPVRFRASYFPFTEPSAEVDVQW------------RGRWLEVMGCGMVDPAVLEGMGLDPERWSGFAAGLGVERFCMVRHGIDDIRRLFTSDLRFLEQF... 335
211 3.000e-49UniRef50_A0A0G1FNR7 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=Candidatus Dependentiae TaxID=95901 RepID=A0A0G1FNR7_9BACT  ali  37  10.QTRLQETLTNAFERLARIKNQTELEALRAEFIGRQGVLARLMDELKTLSLEEKRVQGPALNELKKTLTEAFTAKEVELLQQLLEQKAAASSFDVTAYRPGSLQGSLHPASHIIEEVENILISMGYEIIDGPEIEREEINFEALNIPKNHPARDLQDTFWL-TIPHLLPRTHTSSVQIRGMQQRQPPLALATTGRCYRQEATDASHDFVFMQCEILLVDKKISLANLFATAKLFLQGLFQEKLELRIRPSYFPFVEPGLEMDMSCPF-CSTGCSVCKKSRWIEIGGAGLIHPHVLKASGINPEEYSGFAFGFGLTRLIMLKYGIDDIRHLHSSKVDFLKQF... 349
212 3.000e-49UniRef50_Q9RRX8 Phenylalanine--tRNA ligase alpha subunit n=54 Tax=root TaxID=1 RepID=SYFA_DEIRA  ali  44  1.......MQDTAIQEIQGAETLEALQAVKTKYVGKSGLVTKELGSLGKLPPEERKACGAEINVVRAAIQAALDEKESALKRAALDAKLASEAIDVTLPGLPLPAGGLHPISRVLDDLIGIYRQMGYAVIEGPEVEEEHYNFEALNVPWYHPARDLQDTFWLEDGRLLRTHTSPMQIRYMVDHEP--PFKIVVRGKVYRYEATDATHEAMFHQLEGLVVGDGISMSDLKGTIAEMARGLYGASAKARFQPSYYPFVEPGADFAVYWENPR-------GESKWLELGGCGMVHPNVFEAAGKDYEGKTGFAFGLGLERIAMLKYGIPDIRYFYANDPRVIGQFRG. 336
213 4.000e-49UniRef50_A0A2V7Z1E6 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7Z1E6_9BACT  ali  40  11..DPIAQLLVSFREESARVSSRAEFEALKGRYLGRKGLVPALFLGVRELPPEERAGYGARANAAKREIEEGIARLGETLARAESERRERTAAVDVTLPGRRTRAGSLHPVTLVRRRIEEIFLRMGYSIADGPEIESDFHNFEALNFPPEHPARDAQDTLFLDRKSPLLLRTHTSPVQIREMRKRGAPLKIIAPGRVYRNESVDATHQPVFHQVEALVVDKEISMADLKGTVEAFFGALFGAGTRVRIIPTFFPFVEPGADVQMGCLFCNGAGCRTCKGSGWMEIAGAGEVHPAVLRACGIDPEEWSGFAFGLGLDRVAMMLYEFPDLRLLFEGDERFLSQ.... 352
214 4.000e-49UniRef50_A0A255QM09 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Bacteria TaxID=2 RepID=A0A255QM09_9PLAN  ali  41  10....LDSLQSEALGTLEGVADAETFEAARVKYVGKKGALKDIQKQMGVVAPEDRKSAGMKLNEVKRAIEDAVEQAQK--RLKGGDDQSGDPTFDPTLPGIRPSIGHVHPITQTINHLMEIMGRMGFEAAEGPEVEDPHHNFVALNIPEDHPARDPLDNFYLNVEGTRLLRSQTSTVQIRVMENKQPPIRVISLGRVYRPDAPDATHFPMFHQMEGLYVDTNVTMANLKTVLRIFATNYLGGDVEIRFRPSFFPFTEPSVEVDFYW------------DGKWIEFGGAGMVDPNVFRAVGYDPEKVSGFAFGLGVERLCMRRHDIKDIRDLYSGDMRFLSQF... 343
215 4.000e-49UniRef50_A0A1G2QQN1 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2QQN1_9BACT  ali  39  3.EADLKTLKNQAETDISAAKDIKELEAVFRRY---QKEINLLFKRFSKLPENQRGKWGRAVNLLKSFLETTVSRKKEFLQKAESQIAIN-DFFDPDKPGKMPEIGHLHPLTQTKREIMAIFASMGFDVALGPEIEDEWHNFDALNIPKDHPARDAWNTIWLKENKKLLLRTHTSPVQARYLMTHQPPFRIIAPGKVFRYEATDASHEAQFYQLEGLMVDRKVSAANFKAIIGEFLKRFFDKSLKFRLRPDFFPFTEPSFDVAMTCLACSPKGCPVCKRTGWLEVAGAGLVHPNVFTACGLNPEIWKGWAFGFGWDRLAMMKYKIDDIRLFNSGDLRFLEQF... 345
216 4.000e-49UniRef50_D9PMA2 Phenylalanyl-tRNA synthetase, alpha subunit n=1 Tax=sediment metagenome TaxID=749907 RepID=D9PMA2_9ZZZZ  ali  51  187..........................................MKGLGALPAEERKAAGARINQLKDQVETLLRARRDAIQAAELARQLAAESLDVTLPGRGDAVAALHPVTRTMARIEALFASIGFAVADGPEIETDFYNFTALNIPENHPARAMHDTFYLEGGNLLRTHTSPVQVHYMQKQQP--PLRIIAPGRVYR-CDSDVTHTPMFHQVEGLWVDESASFADLKGVLADFMARFFERDLPVRFRPSFFPFTEPSAEMDIGCVICEGAGCRVCSHTGWLEVLGCGMVHPNVFGHVGIDAERYQGFAFGLGVERLAMLRYGVDDLRLFFENDLRFLRQF... 483
217 4.000e-49UniRef50_A0A0M2LRS0 Phenylalanine--tRNA ligase alpha subunit n=25 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M2LRS0_9SPHN  ali  44  3...EIDDLKTHLLTAIDAAAGLEALETVRVDALGKQGRVTALLKSMGGLSPEERQVKGPAIHGLREAVTNAIANRKATLEAAALEAKLAAERIDMTLPVDAPLAGTIHPVSQVMDELAEIFADLGFAVATGPEMETDWHNFTALNIPETHPARAMHDTFYLDRERPRLLRTHTSPVQIRTMLANKPPIRIIAPGRTYRSDS-DATHTPMFHQVEGLVIDKGITMGHLKWTLETFLKAFFRDDIVLRLRPSYFPFTEPSAEVDVGYTLQKGKRVGDVPNGGWMEVLGSGMVHPKVIAACGLDPDEWQGFAFGCGIDRLAMLKYGMDDLRAFFDGDIRWLKHY... 351
218 5.000e-49UniRef50_B9J7G4 Phenylalanine--tRNA ligase alpha subunit n=198 Tax=cellular organisms TaxID=131567 RepID=SYFA_AGRRK  ali  43  3...ELVTLETQLMAEVAAATDEQSIEAVRVAALGKKGSVSELLKTLGSMSPEERQTRGAAINALKNSVTDAINARKGALKDAAIDAKLKAETVDVSLPVRPAERGRIHPISQIVDEITAIFGDMGFSIAEGPDVETDYYNFTALNFPEGHPAREMHDTFFFEKGERKVLRTHTSPVQIRTMEAQKPPIRIIIPGKTYR-QDSDATHSPMFHQVEGLVIDKTANVANIRWVLEEFCKTFFEDNVTMRFRPSFFPFTEPSFEVDI-QCDRSGPIVKFGEGTDWMEILGCGMVHPNVLRHGGLDPDEYQGFAWGMGLDRIAMLKYGMPDLRDFFNADVRWMNHY... 344
219 5.000e-49UniRef50_A0A2G6EAC6 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A2G6EAC6_9BACT  ali  44  12...........FHEELSKVKDKLTLENLRIKYLARNGLYAKLFDEFKALPKNEKPKYGQLLNSEKSYAQKFFDELKSKIENISNEVD---DYIDLTLPGRNIEIGTTHVLTQTLKEIKEIFKSLGFSIYTGPEIESDENNFEMLNFPADHPARDMQDTYFLSDSFLLRTHTSPVQVRLMKNNKPPY--RAIMPGRVYRNEAISAKSYCLFHQVEGLVIDTDITFAELKGTLVYFAKQLFGEDVKYRFRSSFFPFTEPSAEVDIWWQ-------PKGKEGKWLEILGCGMVDPNVLDNLNVDSEKYIGYAFGMGVERMAMLKYGIDDIRLFFDNDNRFLNQFK.. 330
220 5.000e-49UniRef50_A0A2N2F5S0 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A2N2F5S0_9BACT  ali  37  4IENLVKSLKQESDAALAAAKTEQELEAVRVDFLGRQGRIAGLMESLKTASLDEKRILGPALNELKQHITQRHAEKKEALEKASIQQQLLKKQYFVTASLANQTPAHLHVYTHLIQELENIFISMGYKVADGPEVETEYHNFEALNIPKDHPARDMQDTFWL-TLPNMLLRTHTSNVQVRQMEQFGPPLAIFATGRTYRHEAVDAKHDLMFSQGEVLLVDKNVSMAQLLATAQTFLQAIFNKDLKMRVRTGYFPFVEPGIEIDASCPF-CTKGCSVCKQTTWIELLGAGLVHPNVLKCGGIDTEKYSGFAMGFGLERIAMIRYGINDIRLFHSSKIPFLDQF... 344
221 5.000e-49UniRef50_A0A1B3WDI9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Dialister TaxID=39948 RepID=A0A1B3WDI9_9FIRM  ali  53  70MTSDLKHMKEEASLKIQAALNEKELHEVRVAFLGKKGRLTGILRMMKNLSDEVRPQMGAMXXXXXXXXXXXXXXXXXXXXXKILMEKIESEKIDITLPARHDRRGHIHPLNKALRTIVKSFTRMGYSVEEGPEIESDYYNFYCLNLPKDHPARDMQDSFYITPDILLRTQTSPVQARIMQRNEPNTPIRMIAPGKVFRWDN-DATHSPVFHQVEGLVVDKGIKFSALKGTLEVFLKDLFGSDTRIRFRASYFPFTEPSAEVDISFSSRIDEQS---DDPNWLEILGCGMVHPNVFELNNYDPNKVSGFAFGMGIERIAMLLYGIDDLRLFYENNMKFLKQF... 406
222 9.000e-49UniRef50_A0A1L6MZM2 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Pajaroellobacter abortibovis TaxID=1882918 RepID=A0A1L6MZM2_9DELT  ali  44  1.......MRDRCLSQFRQAETEQALRQEYAKILGRKGNLTELLKTIRNAVPEERKSIGEAINALRKEVESHFQACLQSIVLHQREVQLRTPLVDLSLPPRIPPCGHKHPLNLVSEEIVDIFRCLGFAVCDGPEVEHADNNFKKLGFPDDHPAIDMQDSFWTTQGFLLRTHTTNVQARVMSTQKPPMA--FIAPGAVYRRDD-DPTHSPMFHQIDGFLVDRRVSFAEMKGVLTEFIRGFYGPSTPMRFRTSYFPFVKPGAEVDIGCIFCKRRECSVCKQTGWIEVLGCGMIHPTVFEHCGLDPEAWTGFAFGMGIERLAMIRYAIPSIRLFYENDPRFLSQF... 338
223 1.000e-48UniRef50_E6PEI6 Phenylalanyl-tRNA synthetase (Alpha subunit) n=2 Tax=mine drainage metagenome TaxID=410659 RepID=E6PEI6_9ZZZZ  ali  43  4LQPQLDDLAQRLRAGAHAVTDIAALEELRVRFLGRSGEVTLVRRGIGALPAAERPDAGKLINDAVAQMEALLDEAKARIARGALDEVLE-RRIDVTFPAPEAALGSIHPVRRIIEEISEAFKELGFATVLGAEVEPSYYTFDALNIPADHPAREGFDSFFITPELLLRPHTSPMQIRTMQAHRP--PVAILAPGRCYRRDAVDARHLFQFHQVEGLLVAEGIDFGHLKGALAYLSRTLFGPEQRVRFRPSFFPFTEPSAEVDTTCPKCKGNGCSMCGGSGWIEIGGAGMVHPNVLREVGYDPAVVSGWAFGVGVERIALARYEIDDIRRLIESDTDFLRQ.... 342
224 1.000e-48UniRef50_A0A1G0LC19 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A1G0LC19_9BACT  ali  45  21.............RAIRSAGGRDDLQRLKTEYLGRKGRVTAILRELPGLEPEDRRLVGQQANAAKAAIERVLEEADAALAERARGAAGA----DLTMPSRAVWRGAKHPVTLVVDRVTAIFAELGFTRYVGPEAETERNNFTALNFPPDHPALDMHDTLYLGEGVVLRTHTSPLQIRVMEAYPP--PIRVLMPGMCYRRDPFDAAHAPVFFQVEGLAVDEGITFVDLKATLTHFARRFFAPGVMVRFRPSFFPFTEPSAEMDVQCQVCGGPGCPTCKYTGWSEIMGCGMVDPAVFEAVGVDPERYTGWAFGMGPGRMAQQIYGIPDIRAEYEADMRLHDQ.... 342
225 1.000e-48UniRef50_A0A1Y3XN81 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Bacteria TaxID=2 RepID=A0A1Y3XN81_9ACTN  ali  46  3LIEELDALEARAKDMIAAADDAAALEAARVALLGKKGEITQVMHMMGKVAPEERPVLGKRANELRRMAESLIEHAQGDLKRQAMQQLMATEAVDVTLPGARPTIGHAHPINQIKEEIEDVFCGIGYTVEAGPEVETSWYNFTALNAPMDHPSRSARDTFYVVDNAPGLLRTQTSGTQIHIMEHQKPPIYAIVPGTVYRPDTADACHLPQFNQVEGLVVDEGITFGDLKGTLDYFAKAMFGPERKTRYRPHFFPFTEPSCELDVSCHVCGGKGCSFCKHSGWIEILGCGMIDPNVLVNCGVDPERYTGFAFGIGVERVAALRYDLPDLRTLMTGDMRFLNQF... 358
226 1.000e-48UniRef50_D8IIE3 Phenylalanine--tRNA ligase alpha subunit n=25 Tax=root TaxID=1 RepID=D8IIE3_LACFC  ali  61  1...................................................................................MDAKLAAEAIDVTLPGTPVAQGQPHVLQQIIDQLEDLFIGMGYEVAVGDEVEQEVYNFEKLNLPKDHPARDMQDTFYVTPSVLMRTQTSPMQARMEQHDFSKGPLKMISPGKVYRRDTDDATHSHQFHQVEGIVVGEHVTMADLKGTLEVVAQNLFGDQLKVRLRPSYFPFTEPSVEADITCFNCLGAGCSICKGTGWIEVLGAGMVHPNVLKMSGVDPEVYGGFAFGLGPDRFAMLKYGVEDIRDFYQNDVRFLTQF... 259
227 1.000e-48UniRef50_B3DYQ7 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Verrucomicrobia TaxID=74201 RepID=B3DYQ7_METI4  ali  39  4.......LEKSFLEEIKAVSKKEEIEAIRIKYFGRKGLVPSLLEKIGQMPREQRPEWGKKLNELKSRLLEALQEREKEISAXXXXXXXXXXXXDPTLPGRPIQSGTLHPISIALKKIFEIFKRIGFTLEEGPEIESEYNNFDALNIPLGHPARNEQDTFYLKEKVLLKDNPQTSPVQVRVMKNKKPPIRIIAPGRCYRRDEIDATHSIVFYQLEGLVVDKGISLADLKGTLEYFFRELLGSQLQFRFRPHYFPFTEPSFEVDGAVHSLEG------KAVKWLELCGCGMVHPKVFLNVGIDPEIYSGFAFGFGIERYLMVAHKVPDLRLFTENDIRFLKH.... 342
228 1.000e-48UniRef50_A0A1G2ATD5 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Kerfeldbacteria TaxID=1817907 RepID=A0A1G2ATD5_9BACT  ali  39  8.KQTLENLQAAFIQTLDAAQTPEAITQIRNDFLGRKGKLTKILRQLKTLPEAERKAIGMQANAMKKTFEDALQEKLDQLGKKTVQKV----WIDVTAPGKKPNIGRLHPISSMIQHIRRIFEQLNFDITNGPEIEDDYYNFSALNFQKEHPARDMHETFFLPRKHVLRTHTTATDIHYLETRKP--PIRMVTIGKTYRRDA-DLTHTPMFHQFDGLMIDEHISMAHLKGLLHIVMERLLEARLEVRFRISYFPFVEPGAEFDVTCTLCRGEGCVTCKGTGWLEMGGCGMLHPNVLKNAKIDSEKYQALAFGFGIERPLMIKHKVSDLRIFFENDIRFLKQF... 341
229 1.000e-48UniRef50_W1VQR4 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=1 Tax=Streptococcus parasanguinis DORA_23_24 TaxID=1403947 RepID=W1VQR4_STRPA :  ali  53  5..................AENEKELQELRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDILTAAFEESAKLLEEKKVEAQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNFERMNLPKDHPARDMQDTFYITEEI................................................................................................................................................................................... 151
230 2.000e-48UniRef50_S0F3V4 Uncharacterized protein n=1 Tax=Chondrus crispus TaxID=2769 RepID=S0F3V4_CHOCR  ali  44  150.KNSIEVQLQDAITALREAEEITAVEKLRVKYLGKKGTLTVIMKMVGKLVKEERPLLGAAVNIAKEKVSSLVAERKEAIEEENIRKKEESEWVDVTMPGIRPDPGRIHPITSTMKIATNIFVDIGYDLIDDPKYETDYYCFTALNCPPDHPAREMQDTFYLTADKKNLLRTQTSSVQIRYMEENKPPFKIIAPGRVYRRDTSDATHSSTFHQIEILAVDKMLNFGGLKATVTHFLKKMLGEEIQTRFRGSYFPFTEPSVEVDVFF------------RGRWLEVLGCGMVDPAVLENVGLDPEEWSGFAAGFGVERFAMVMHEIPDIRELYRNDTRFLTQF... 485
231 2.000e-48UniRef50_M4V8I4 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Proteobacteria TaxID=1224 RepID=M4V8I4_9PROT  ali  46  3.QTQLTQIKENALKAFSSAQNSQELYGFKVQYLGKSGSLTESMKLMATLPKEEKPLFGKMVNEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDLSFSTAAKEQGKEHPIHKVTNEIFSIMARLGYSLRTGPLIEKDYYNFEALNIPPNHPARDMQDTFFVDESHVLRTHTSPIQIHSLENEKPPLRIIGTGP---VFRCDSDISHLPNFHQIEGMCVDEKVSMSDLKGTISFFVREFFGPGLKTRFRPSFFPFTEPSAEVDCSCPICKGKGCSMCKQTGWIEIGGSGLINPKVFAHANVEYPKWQGFAFGFGVERMAIIKYGVDDIRHFPSNDVRFLKQF... 339
232 2.000e-48UniRef50_M5TDG7 Phenylalanine--tRNA ligase alpha subunit n=17 Tax=Bacteria TaxID=2 RepID=M5TDG7_9PLAN  ali  41  9...RLDQLQSDAESAFSGASNAESLEEARVVFLGKNGQFKDVQKMLGGIEPTDKRAAGMRLNEVKNAINDAFSAAKEALEGGGDSQVD--PTFDPSLPGARPALGHIHPITQTIDHLTEIMGRMGFEVAEGPEVEDPWHNFVALNIPEDHPARDPLDNFYLAGEGESLLRSQTSTVQIRVMKSRQPPIRIISLGRVYRPDAPDATHFPMFHQMEGLLVDRNVTMANLKTVLRVFANNYLGDDVEIRFRPSFFPFTEPSVEVDFLW------------NGTWIEFGGAGMIDPNVFEAVGYDPEKVSGFAFGLGVERLCMRRHGITDIRDLYSGDLRFLEQF... 346
233 2.000e-48UniRef50_A0A142HLK8 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A142HLK8_9BACT  ali  38  2MQESISGL--AAEVAAADVSSAAALDQFRLLYLGRKGRLADLFDQLKTVPADERRAIGQQLNGLXXXXXXXXXXXXXXXXXXXXXQPANAT-FDYTLPPVPHALGTRHPLSLVREQMLRIFSRIGFAVAEGPEIEDDWHNFTALNFPENHPARDMQDTFFVSTHSPMLLRTHTSTVQVRVMENEPLPIRRVMPGRVYRNEAISARAHMLFHQVEGLYIDEGVSFADLKQTIYYFVRELFGEDINIRFRPSYFPFTEPSAEIDITCLICKGAGCNICKGTGWVEIGGSGMVDPAVLENCGIDSEKYSGYAWGMGIERIAMLKYQVKDLRLFTENDVRFLRQFEAL 371
234 2.000e-48UniRef50_A0A0G0J6S0 Phenylalanine--tRNA ligase alpha subunit n=34 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0J6S0_9BACT  ali  42  6LQQKLENIKKLFNQKIRDVKNLEVLENLRVQFLGRKSELVEFLKGIKNLTEEEKRKFGPVXXXXXXXXXXXXXXXXXXXXXREVGKLMEKDRIDISAPAKKISQGHLHPLTLIQRKIEDIFQSIGFEVVEGPEIETEYYNFNALNIPADHPAREMQDTFWLQTPNKLLMRTQTSSVQIRYAENHQPPIRIISPGRVFRFEATDQTHDIQFHQIEGLMIDKNISLANLKGVLEILFKKLYGKGVEVRFRPSYFPFVEPGVEVDM------------KFRGKWMEIAGAGMVHPKVLNTMKIDSRIWQGFAFGMGLERLAIIKYGIDDVRLFSSGDLRFLKQF... 340
235 3.000e-48UniRef50_A0A2E8GMG4 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A2E8GMG4_9DELT  ali  50  24.......................ALPEWYRRYLGRKGELTQQLKQMGALSPEERPKMGKVVNKVKQTLEDAFHARQQSLQTEQLNRELAGDDLDVTLPGRPVHTGHLHLTTQTLRKIYRIFGEMGFQVYEAPDVETDEYNFQLLNIPEYHPARDMWDTFWVNDQVLLRTHTSPGQIRAMREYHPD-PIRVILPGKCYRYEQITPRSEHQFFQVEGLAVGKNIRLTDLIGVMSEFARKMYGQEREVRIRGSYFPFTEPSIEIDMSCSCE-KVGCRLCKQTGWLEIAGAGMVHPVVLRNGGYEPEEWTGFALGMGVERPALLKHGIQDIRYFYGNDLRFLQQF... 339
236 3.000e-48UniRef50_A0A2T2QWM5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Saccharibacteria bacterium QS_5_54_17 TaxID=1919228 RepID=A0A2T2QWM5_  ali  47  6........VTNAIKKIEAAETEEELEELRVAYLGRKGELTQELRSIGQLPESERSQRGKTLNQYKKRLEHALQQQREQIRARRLETQ-SQQAVDLTRPGIGPRRGRLHPVETLQYEVIGLMQQIGFQVIEGPEVETDWYNFQALNMGPDHPARDTADTFYLEDGSIPRTHTSPVQI--RYMEENKPPVRIISPGKVYRNEDEDATHLWSFRQVEGLVVDEGIRFSDLKGTLECMLKGIFGEDTQLRLRPDYFPYTEPSAEVDASCMMCSEDDCQVCEGTGWVELGGSGMVHPRVLGNVGIDPEAYSGFAFGFGLERLAAVKYQVPDMRHLWRPDLRFLEQF... 341
237 3.000e-48UniRef50_Q7UP75 Phenylalanine--tRNA ligase alpha subunit n=21 Tax=Planctomycetes TaxID=203682 RepID=SYFA_RHOBA  ali  41  9...RLDQLQSDADSAFTSASDAAALEEARVTFLGKKGQLKDIQKMLGGIEKADKPAAGAKLNAVKSAINAAFED--AQQNLSGGDDSGADPTFDPTLPGTRPSLGHIHPITQTISHLTEIMGRMGFEVAEGPEVEDPWHNFVALNIPEDHPARDPLDNFYLADEGSQLLRSQTSTVQIRVMKQVEPPIRIISLGRVYRPDAPDATHFPMFHQMEGLLVDTNVTMANLKTVLRVFANNYLGEDVEIRFRPSFFPFTEPSVEVDFLW------------NGTWIEFGGAGMIDPNVFAAVGYDPEKVSGFAFGLGVERLCMRRHGITDIRDLYSGDLRFLKQF... 347
238 3.000e-48UniRef50_S7U3C1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Geobacillus sp. WSUCF1 TaxID=886559 RepID=S7U3C1_9BACI  ali  64  25VKERLYELKQEALRRIDEAKDVKALNDVRVAYLGKKGPITEVLRGMGALPPEERPKLGALANEVXXXXXXXXXXXXXXXXXXXXXRKLAAEAIDVTLPGRPVSLGNPHPLTRVIEEIEDLFIGMGYTVAEGPEVETDYYNFEALNLPK.................................................................................................................................................................................................... 172
239 4.000e-48UniRef50_UPI000D3771CF phenylalanine--tRNA ligase subunit alpha n=2 Tax=Candidatus Similichlamydia epinepheli TaxID=1903953 RepID=UPI000D3771CF  ali  40  18........RSAFDEQISLVTSSEDEKEIRIRFLGRKSPLATLIRGIGQLESSDRLQAGKALNEHKSLVEEQIAAAEVRFEDKKLKERVSAERVDVTLPGRTKWVGSVHPLLETVFRALEILSSMGFSVRFGEEIGTEETMFDFLNFPKNHPARLEQDTYYLPGGSILRSQTSSAQVSLMRNQHP--PIRFVVPGKCFRNEEISSRSLNIFHQIEGLYVDRDVRLGDLLSTLEVFYASFLGQSTKLRFRSSYFPFVEPGIEVDISCFLCRGQGCFTCKRSGWLEVAGAGMVHPNVLRNGRVDPDLYSGFAWGFGLERLVLLLYGIPDIRLLVENHPSFLRQF... 352
240 5.000e-48UniRef50_A0A2H0WC25 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Bdellovibrio sp. CG10_big_fil_rev_8_21_14_0_10_47_8 TaxID=1975526 RepID=A0A2H0WC  ali  45  8.QTKLEELRQSALAKMQGAASSKDLYEVKVEFLGKNGFLTEIMKEMASLPKEEKPLFGKLVNEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXMDLTPAVGGGNQGSEHPVAKVTDEIVRIMSRLGYSLRQGPWIEKDFYNFEALNIPANHPARDMQDTFFIDPTHVLRTHTSPIQIHSMESERP--PLRILGTGAVFR-CDSDISHLPHFHQIEGMCVDRHVSMADLKGTVSFFVREFFGAGLKTRFRPSFFPFTEPSAEIDCTCPICKGKGCSLCKSSGWIEIGGCGLINPKVFGFTGVQYPEWQGFAFGFGIERMAIIKYGVEDIRLFVENNLKFNQQFE.. 346
241 5.000e-48UniRef50_A0A2M7XKA1 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=candidate division SR1 TaxID=221235 RepID=A0A2M7XKA1_9BACT  ali  39  31.........KIALKELEKLNNAPQTTERFQKYLGKSGALNEEFKTMGALSFEEKKKMGSVLSEAKTTLTDAYESKERKLSMEGINQKLNEDLIDISLDGKPLDQGSYSVLALVRREIEEVYKGMGFIIDYGHEIVTKYENFESVNIPLTHPATEMHDTIYLKDTDPLILRTHNSAHQVEDIMKYGVPLKLGSPGRVYRFENMDASHDTMFRYAEGLVIDKNVSIANFKDTMKKILSGILGKATEIRMRPSYFPFVEPGFEIDAQCTICGGKGCSLCKQSGWIELVGAGMVHPNVITNAGLDPKEWSGFARGIGVSRLAALRYGIKDIRYFTNGDLRFAKSFS.. 367
242 5.000e-48UniRef50_A0A0F6YIW7 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Myxococcales TaxID=29 RepID=A0A0F6YIW7_9DELT  ali  43  9.EEGLARVAAGFETTFAQCPDESSLRAAAAKLIGGSGEVTQLLKLMPQLPGDRRKELGQRANALKNAVQSAFDARLEGLARAARQAELDAPPIDPSLPGRGLARGALHPITRTIDALLDVFASIGFEVTDAPEIELADFNFTRLGFPPDHPATDMQDSFFVAEDQVLLRTHTSNAQVHEMSRRRTIPIACISAGKVFRRDD-DATHSPMFHQIEGFWVDRGISFAHLKGVLTTFVKRMFGEQVPVRFRPSYFPFVEPGGELDVGCTICRPYDCRVCKSTGWLEVLGCGMIHPVVFEHCGWDPKEVTGFAFGMGIDRIAMLRHNVGDIRLLYENDIRFLSQ.... 371
243 7.000e-48UniRef50_A0A0G1M992 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=1 Tax=Candidatus Giovannonibacteria bacterium GW2011_GWA2_45_21 TaxID=16186  ali  54  8........................................................................................................GHWHPISRAILDIREIFVELDFEVASGPELEDEWHNFDALNVPKDHPSRDMQDTFWLNERLLLRTHTSPVQIRYMEQKIKEGPYRIIVPGKVFRNEATDATHEAQFFQCEGLYVDRAVSLAQLKWTLLYFFKKYLGQDAAIRLRPSFFPF.......................................................................................... 173
244 8.000e-48UniRef50_A0A2E6W9G1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E6W9G1_9GAMM  ali  42  4.....ESIIEQCRQEAENVANQHDLDQLKAKYLGGKSAIRESLKDLASLDPQARNQASATVNAIKKQLGVIIHERKTVLVEEQTARALAEQGLDTALSTDVWRQGALHPLTKTFNQLKRLMYSMGFDVAFGPEAETFYYNFTALNTPRHHPAVTLQDTIYIDDDQLLRSHTSSVQIRMLEKVKP--PVRIFSPGRVFRADTPDATHSPCFMQCEGLVVDQTATLSDLIATLRYLLEGFFGQSLDLRFRPSYFPFTQPSFE------------CDILFKGRWLEVLGCGMVHPDVLDNVGIDSSVYQGYAFGLGIDRLTMLRYHIEDIRQLYDGDLSFLAQ.... 324
245 8.000e-48UniRef50_A0A0G0ZYI9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0ZYI9_9BACT  ali  39  1MRDQLEGILRELYEVRDRIKNADELETFRVKFLGRKGILREFAQSFKDATEEEKRTIGNHFNKVKQEVEDTLADLTEKFKKRERV------RFDFTYPGKTPLVGYRHLMSLELERVKDIFASLGFSSYGGYEIVTEYENFDSLNIPKNHPARDMWDTLWIDEKTKYLFRTHTSAYQVKLLKEQGVPLRAIIPGKVFRHEATDRTHDFEFHQIEGLVIDEGANIAELKYVLESFYRAYFGKDLKIRLRPGYFPFVEPGLEVDLGCIFCKGKGCLTCKKTGFIEVAGAGMVHPSVLQESGIDPDSHYGYAFGLGLGRAVMLKYGISDIRLLHSADFRFIEQFR.. 347
246 8.000e-48UniRef50_A0A2D9FU63 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A2D9FU63_9BACT  ali  39  1MLDDIKVLEQEIQQ--FEIKDEDQLEAFRLEFLSRNGKVQSMFKNMGKVPKEDRAKVGKAMNQVKVLAESKFEDAKLALDQDQSKDLSAKDDITLTSPSWPL--GSLHPLTQTLEEMKSIFYRLGFTIADGPEIEDDFHNFTALNFPPNHPARDEQDTFFIPDMQDLVLRTHTSPVQIRLMENTEPPIRAIMPGRVYRNEAVSPKSYFLFHQVEALYIDKNVSVADLKETLITFAKLMFGTGVKYRLRPGFFPFTEPSLEMDVWW--------GSEQDGKWLEILGSGMVDPNVLKHAGVDPEKYTGFAWGMGVERIAILRHGIDDIRTFYENDVRFLEQF... 334
247 9.000e-48UniRef50_A0A2E1JZ31 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E1JZ31_9GAMM  ali  42  6.....ESIIQQCRQDADAVSSTHDLDQIKSKYLGSKSAIRESLKHLATLDSARRKDASILVNSIKKSLGEIIFSRRAALLQEQTDRALADQGVDTTKDAAHWHIGALHPLTLTLNALKRSLQHMGFTIAFGPEAETFYYNFTALNTPRYHPAVTAQDTLYIDDDQLLRSHTSCVQIRMLEQQQP--PLRIFSPGRVFRADTPDATHSPCFMQCEGLVIDHQANLSDLVSTLRCLLENFFGRSLKMRFRPSYFPFTEPSLECDIWF------------KDKWLEVLGCGMVHPNVLENLGIDTHKYQGYAFGLGIDRLTMLRYQIDDIRALYEGDQAFLQQ.... 326
248 1.000e-47UniRef50_H9UCV2 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Bacteria TaxID=2 RepID=H9UCV2_FERPD  ali  51  30......................KQLNDLRVKYLGKSGIVTSLMKKLKDLPPEERPNFGKVXXXXXXXXXXXXXXXXXXXXXSEKQLLYKKLWVDPTMPGARRARGHLHIITKVQKELEDIFISMGFSVVEGPEIEQPWFNFDALNTPEWHPARDAHDSFYINDEYMLRTHTSPVQIRT--MLSRKPPLAIVAPGRVYRR-DYDATHLPMFTQMEGLYVDHDVTVKHLKYFLEEFARRLLGENTKVRLRPSYFPFTEPSFEVDIYF------------NNRWFEVLGAGMVHPNVFKNVGYDPEEWRGLAFGLGIERIAMVKYGVKDIRDLVRNDIRFLENW... 333
249 1.000e-47UniRef50_A0A1V5ZVR5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Parcubacteria group bacterium ADurb.Bin159 TaxID=1852937 RepID=A0A1V5ZVR5_9BACT  ali  38  2...DILNIKKQIEEDISRVRTLNDLENISKKYLGRKGEITRFFDEIKNFSSKQRAEKGREGNELKNWLITQIESKRQIFEKGGEESKYKKD-IDITQPGEKIERGNLSLITQMKNEIEMFFLSMGFDIAEGPNVETEFYNFDALNIPEYHPARDIQDTFWLKEKEKLLLRTHTSPVQIRYMREHKPPLKMITIGNTFRHEAIDASHEAQFCQMEGLAVDKNISLANLKDVVENFLRHFFGKKMAIQWRPGYFPFVEPGVEVDMECLMCRGKGCPVCKNSGWLEVMGAGMVHPYVLKKGGIDPHKWQGFAFGIGIDRLVMLRHCITDIRVFRGG........... 334
250 1.000e-47UniRef50_A0A2A2YAU6 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2A2YAU6_9BACT  ali  45  1MKEDIIRVQNDTLLAISAAEDARALDEARVASLGKKGALTALSMGMKDVPQEQKGEVGALXXXXXXXXXXXXXXXXXXXXXAADRAALAG--IDPTLPARFLPTGGLHPLTLLRERAVGILRRMGFALADGPEIEDEFHCFDALNTPADHPARNVKDTFYFDSGKLLRTHTSSVQV--RMMEKNVAPLRIIAPGTAYRRDEIDSTHLSAFHQLEGLYVDRDVSLPDLKGTLEAFLRELFGSQTEVRFRPHFFPFTEPSFEIDVKLEVKGQA-------PRWIEVAGCGMVDPAVFEAVCFDPNEVTGFAFGMGLERLAMIQWGIRDIRLLIENDVRFLRQF... 337
251 2.000e-47UniRef50_A0A0G1D9M0 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1D9M0_9BACT  ali  42  1MKDAFLSLQKEATDTFKNIKETDAREAWRSLYVGRKGKVALLMKQLAGLSVEEKKEIGPIANAIKQELMQLFKT---------HDARGANARIDMSLPGRIPERGHEHPLYQVMDQVISVFLGMGFDVVEGPEIELGYYNFSALNIPKDHPARDMWDTFYVKEEESVVLRTHTSPVQIRAMEHRTPPVRLIVPGRVFRHEATDATHGSNFFQLEGLVIDKGIRVTDLMGCLSAAMKGLYGKDTTIRLRPSYFPFVEPGFEVDISCMMCRDGGCSVCKRTGWVEMLGAGMVHPVVLKNMKVDSRKYSGFAFGMGIDRMMMLAYGIPDIRLGYSGDVEFVRQF... 350
252 2.000e-47UniRef50_A0A2E9GX47 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9GX47_9DELT  ali  44  8....LEEILARARGEIGEAATPQALTEVRARYLGRKGSISSELRALGKLDPAQRKVRGQAVNAAKQRVEELVAARRSELEGGERARELADNQVDITLPGATPPAGHLHPLTHVTRDMVNFFASMGFSVEDGPEVETDWHNFEALNIPPEHPARDEQDTFYLEGGNLLRTQTSNVQIRAMTGRTP--PLRFIAPGRVYRHDTSLK-HSPMFHQIEGFLVDERVTFGDLKGVLFAFARHLFGADSALRFRANHFPFTEPSAEMDVRW------------RGEWLEWGGCGMIHPHVLERCGIDPEAWQGFAFGMGIDRTALLRWGFPALRPLFEGDVRVLEQ.... 328
253 2.000e-47UniRef50_A0A1F4NPJ0 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=candidate division Kazan-3B-28 TaxID=1798534 RepID=A0A1F4NPJ0_9BACT  ali  40  1MEDKLKQLWLQAQSEIASA-NPANYEILRTKYLGRKSELNHLLGQIADLPIEQKAVAGQLGNQIKQQLAERLNQLA------ERQPKAEVELFDPTIPGLHPPLGRLHPLTQTTNELVKLFRGLGFSVADGPEVETEENNFNLLNIPDNHPARDAWDTFWLKESVGSKFNTHTSPVQIRYMKEHRPPIRIIAPGRTFRYEAEDATHSSVFYQLEGLLIDRGITVAHLKAVIDTIVKDILGSEVKTRLRPSFFPFTEPSFEVDIWFKGH------------WLELMGCGMVHPTVLKNGDIDPTEFSGFAFGLGIDRITMLKHGIDDIRLFLSGNLDFLEEF... 335
254 3.000e-47UniRef50_A0A1W2CHM4 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1W2CHM4_9RHIZ  ali  45  23.......................ALEEIRIAELGKKGRISDLLKGLGKMSPDERREAGPRLNGLRDAVQTAISARREALANAAIEARLKAETVDVTLPVRPASRGRIHPISQVIDEITAIFADMGFSIAEGPDIETDYYNFTALNFPEGHPAREMHDTFFLAKGERKVLRTHTSPVQIRTMESQTPPIRIVIPGKTYR-QDSDATHSPMFHQVEGLVVDKTANIAHMKWVLSEFCRAFFEDSVTMRFRPSFFPFTEPSMEVDIQCDRSKPGEVRFGEGTDWMEILGCGMVHPNVLRAGGLDPDVYQGFAWGMGIDRIAMLKYGMPDLRAFFDADIRWVEHY... 345
255 3.000e-47UniRef50_Q492V1 Phenylalanine--tRNA ligase alpha subunit n=178 Tax=root TaxID=1 RepID=SYFA_BLOPB  ali  44  4..DPVKKLVILAKSNIMQSNNMDALEAIRIKFLGKKGYLNQHIKNLNDTSLDIKPKLGAAINQAKEDIYTLLIERKNILQSKNIKNTLITDTLDVTLPGRLSDIGTHHPITSTIKRMKIFFNTLGFSVIHGPEIEDDYFNFDALNIPKYHPSRDEHDTFWFDEKRLLRTHTSGVQIRA--MINKTPPIRIISFGRVYRK-DYDQHHTPMFHQMEGLIVDSNVNFSYLKKILYDFLYNFFETDIILRFRPSYFPFTEPSAEIDVMKKQETG---------NWLELLGCGMVHPKILHHVDIDTEKFSGFAFGIGIERLTMLQYNIDDIRVFFKNDLQFLDQFK.. 331
256 4.000e-47UniRef50_A0A1L4D4S6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Silvanigrella aquatica TaxID=1915309 RepID=A0A1L4D4S6_9PROT  ali  40  17.................DIFTHDLIEEIRVRFSGKNSPLQEWLKSLRNIPAEERKNAGALINELKNEIESCLKHFIESWRNEAEIKKLSQENEDISLPLPNINIGSRHPVMTVMRDLLEPFQRMGFSIVDGPEIDNDFYNFDTLNVLKDHPAREMQDTFFLASEWVLRTHTSNVQSHA--MMERKLPLKIVCPGCVYRN-EYDMTHLPSFRQIECLIVDKGIHLGHLRHTINEMLNAAFGRPVKLRFRSSYFPFTEPSAEVDVECQQCFGKGCRSCKHTGWSEIGGCGLVNRKVLESCGIDSNVYSGIALGFGIDRMAKDRFAIADLRSMLDGDVSFLKSF... 337
257 4.000e-47UniRef50_A0A2M7B9G3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Candidatus Tagabacteria TaxID=1817918 RepID=A0A2M7B9G3_9BACT  ali  38  8..DIFQSIRKDAFGALEEASDFETVHKIEAEYIGKSGRLTKILKSLKEMSLAERKEMGSTANALKKEIEEKIKLKKEEFGERGGSNHRDADWIDITAPGKKISRGHIHPISRVLKEVTSIFESMGFEVVEGPEVETEHYNFDALNIPKEHPARDLWDTFWIKPKNGLLLRTHTSPNQIRYMEKHQPPLRIIVPGQVFRYEASDSSHGIQFYQLEGLMVDKTTSVANFKALIEQFFKKLFKENIQMRIRPGYFPFVEPGFEVDIKDRS-----------DKWLEVIGAGMIHPQILKNVKLDPSQWQGFAFGMGLDRITMMKYKIDDIRLFHSGDLRFIRQF... 336
258 4.000e-47UniRef50_B9KD77 Phenylalanine--tRNA ligase alpha subunit n=161 Tax=root TaxID=1 RepID=SYFA_CAMLR  ali  45  2.........QDLISQISSASTLAELENIKVSVLGKKGILTLEFAKLKDLQGEEKKEFANGLNKTRDEFXXXXXXXXXXXXXXXXXXXXXQDVQDFSFFDETSNAGALHPIMQTMDKIIEYFTALNFSIEKGPLIEDDFHNFEALNLPQNHPARDMQDTFYFEDKTLLRSQTSPVQIRTMLSQKP--PIRMIAPGAVFRRD-FDITHTPMFHQVEGLVVEEGDKIFANLKDMLENFLKYMFGDVKVRFRPSFFPFTEPSAEVDISCVFCKGCGCRVCKHTGWLEVLGCGVVDPNVYKFVGY--KNVSGYAFGLGVERFAMLLHKIPDLRSMFEGDLRLLEQFR.. 330
259 5.000e-47UniRef50_A0A1F6QCQ8 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1F6QCQ8_9BACT  ali  42  23..................ISNLHSLESFRIKYLGEKSFLIREQNNLKILSKDERPVYGKLLNDLKNFIQSIYDKKKLFIEERELEDKLSEQKFDITLPGAPHEAGHEHPLSIVTNEIVEIFNGMGFTVVQGPEVETEFYNFTALNTPFDHPARDEQDTFYTNIAPHVLLRSHTSTIQIRAMEKMKPPLRVLAHGRVYRNEEINARKMPFFHQLEILAVEKDLTFGNMKWVLNEFLKNFFGKEIKTRFRPDFFPFTEPSAELDAQCPFCGGAGCGTCGNKGWLELLGCGMVDPNVLKAVDINPDEWIGFAAGLGLERFTMLKYKIPDIRYFFTGDLRFLKQF... 345
260 5.000e-47UniRef50_A0A2E5NS77 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Bacteria TaxID=2 RepID=A0A2E5NS77_9ACTN  ali  43  3..........DATNAVAAVGDLDGLQRIEGELLGKSSVVNEARRSLGELEQEAXXXXXXXXXXXXXXXXXXXXXRRVVLEAAERAAVLEAERLDLTEFDRGQRLGHRHVVTQTWERLEDIFVGMGFTVAEGPEIEDEWHNFGALNFPPDHPARDMYDTLYVDEPGSTLLRTHTSPVQIRVMESGEPPIYSIMPGRVFRSDTADATHMPVFHQIEGLVVDRRITFGDMAGTMDAFTKAYFGRDFASRLRPSYFPFTEPSAEFDI-----------LRDDGSWLELAGCGMVHPNVLEAGGLDPEIWSGFAFGFGLDRLALMRHGIDDLRELFRNDHRFLSQF... 324
261 6.000e-47UniRef50_A0A0G1DA26 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1DA26_9BACT  ali  41  13...EIENIKNELASDLKKSSSLEGIDMLKTKYLGKQGKINILFKTL---PIKTDPKLGKKINDLKDLIQTKLSEQLTTILT-----SDNKMSFDVSIPGTPMPRGSLHLISQAIEEIENIFVSLGFVRRRYPEVDTDWYYAEGLNIPKGHPARDDQETFYLDDNIVLTAHTSNGQLH-EMELKKTPPIKMINIGKTYRRQ-IDTTHTPMFHQFEGLVIDKDINITHLLGVTEYFAKSYFGQDRHTRLRPHHFQFTEPSFEIDITCGVCSGSGCKVCK-SGWLELGGAGMVHPNVIKNGGFNPEECSGFAFGWGVERVLMMKTGIPDIRLIYSDDIRFLNQF... 345
262 7.000e-47UniRef50_A0A2E5DID6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5DID6_9CHLR  ali  38  11.KKYLEKLQTEATNSINGLASEEEIESWRIDYLGRKGKISNFFQTFNKLNAEEKNELGSLANKLKNTLEHLFEEKSKSIKNNNNQNSNFFDY---SLPSVSLGSGSIHPTNQMMEEICSAFSKLGFNIFEGPEIESEAYAFDKLNIPTDHPARDIWDTIYVNDIHSLVLRPHTSPMQIRIMENNKPPIRVVIPGKCYRYEATDNTHEWHFHQIEGLVIDKNINFANMKSTLFEFARIIFGEDTKARFRCDFFPFVEPGAEMSV-----------NFKQNEWLELMGAGMVHPKVLTNVGIDPNEYSGFAFGLGIERAAMIKYGIENIRDFYANDYNFLKQFK.. 340
263 7.000e-47UniRef50_A0A249KTB1 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=root TaxID=1 RepID=A0A249KTB1_9ACTN  ali  42  3.QEDVSQWVKDAQAAFSAATDLDSLKAARLAHAGDKAPISLASRGLGSLSPDEKASFGKIIGDAKAAIAQALATATEKLEAERDKKVLLEEVVDITLPVNRRHRGGLHPISIIKNEVSDFFIEHGYAVAEGPELESGWLNFDALNIPADHPARTMQDTFFVEPVESMVLRTHTSPVQIRTMLTQTPPIYVICPGRTFRADELDATHSPVFHQVEGLVVDKGITMAHLKGTLDNFARHMFGPDVTTRLRPSFFPFTEPSAEVDIFF------------NNRWIEWGGCGMVNPKVLQSCGIDTDVYSGFAFGMGLERTLMVRHGITDMHDIVEGDLRFTRQF... 331
264 8.000e-47UniRef50_A0A2M7V9C2 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M7V9C2_9BACT  ali  33  1MKEKLHQLKKEFQKSINEINDTLKLDEVYQRFFGRKGEMSAIMKSLKDLSGVARKEFGKLSNEVKNELEDIYANKKASLENKAWDDIALSESIDVTQPKPKKRRGHLHPITQALWQLEEVAKKMGFIIEDGPEVESDYYIFEALNIPEHHPARDAQDTFYIKGHPHWTMRSHVSGMQVRQMREHGVPLRAAHIGRVFRNEALDATHGHTFYQFDCIVVDKNLTIGDLVGVIKTLLEGLYNREVELRLRPGHFPFVEPGFEME----MKVATGLGKERKEKWTEVVACGLVHPNVIKAGGLDPHEHDGFAFSLGLDRLVMAKYGVEDIRHIHSGDLRFLEQF... 339
265 9.000e-47UniRef50_Q4ULS5 Phenylalanine--tRNA ligase alpha subunit n=87 Tax=root TaxID=1 RepID=SYFA_RICFE  ali  43  2..ENIETILRLAEEKILLVQNLKELQEYKVEFLGKNGIVTGELKKLGSLNEQERKEFGLKXXXXXXXXXXXXXXXXXXXXXQELNLKLAADKIDLTIPARRYKQGSIHPITQCSEELIQVFSQFGFTIENGPNIENDFHNFTSLNFEDDHPARQMHDTFYLENNKPLLLRTHTSTVQIRAMKNGKPPFRFIAPGRTYRSDS-DMTHTPMFHQIEGLVIDKNINMGHLKYVITEFIKSFFENNIELRFRPSFFPFTEPSAEVDIRMN----------KNDKWLEVLGCGMVHPNVLKNVGIDSSEYQGFAFGLGVERFAMLKYNIKDLRQFFEGDMRWLKHY... 333
266 1.000e-46UniRef50_A0A2D9WKB0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D9WKB0_9CHLR  ali  38  9...ELKTTTDQARLRLSSLANIDDLEVWRLEILGRQGLLTNLMKGIGNLPKEIRKEFGQIANQERADLENAYENRVLELKNVPADTAG----IDVSLPGHLPIRGALHPITQVRRQILDVFTRLGFTTIEGPEVEADSYNFGKLRIPPDHPARDMWDTFWLDGSHILLRTHTSPMQIRYMESHPEPPIRIAVPGRCYRYEATDATHEWMLEQVELLAIDRGITLANLKGTLQEWARQMFGADRKIMMRHSYFPFVEPGVEVDCFDCDGSDKACGICRGSGWLELLGAGMVHPEIIAEAGYDPDVYSGFAAGMGVERVAMVLQGVTDIRHYHDNRYPFLSQF... 348
267 1.000e-46UniRef50_Q7VR67 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Enterobacterales TaxID=91347 RepID=SYFA_BLOFL  ali  39  3.KKLLINLVKQAKLSLEQSNTIQDVESIRIQFLGKHGYINQQLKKINSLNWDNKSKIGTVINQVKSDIHQLFLERKKLITLKAIEKSLNTEKLDITLPGRLSETGTIHPITNTINRIRLFFNHLGFKEIYGPEIENSYFNFDSLNIPNNHPSRDQHDTFWFDTNKLLRTHTSGIQIRAMKHIP--MPIQIISIGKVYRK-DYNKEHTPMFHQIEGMMISSNINLTNLKKILYDFLYNFFGKNVILRFRASYFPFTEPSAEIDILNLNINN----KKQPKKWIELLGCGMIHPTVLNNGGIDSKKFSGFAFGIGIERLTMLLYHMTDIRVFFENDLQFLDQF... 335
268 2.000e-46UniRef50_A0A2D6ZYP5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2D6ZYP5_9RICK  ali  48  8LKTKLSQLEQLALKEIKNSKSSYELDQVKSQFIGKKSDLAAILKDVSFLSKDDKPLIGKLANQIKSSLNDTISKQKDHIQHLELEEKLLNQQDDVSLPALKSHEGYYHPITLTIDHLTKLFGRLGFSVKKGPDIETDFYNFEALNIAEHHPARDMHDTFYLKSGAVLRTHTSPVQIRTMLDQKP--PIKIIAPGKVYR-CDADTSHSPVFHQIEGLYVDEGVRFSDLKGILEFFLRELFGQDKNIRFRSSYFPFTEPSVEVDVE--------YTVNGKTKWMEIMGAGMVNREVFRHVNYNPDQLSGFAFGIGIERVAMIKYEIDDIRLFYENDQRFIKQFK.. 338
269 2.000e-46UniRef50_L7YEI9 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Flavobacteriales TaxID=200644 RepID=L7YEI9_9FLAO  ali  38  1MDQKVDQIKKEI--NCFQAKNSEALEAFRIKFLGKKGILTVLFKKLKKLPIQERKIFGKIINDLK-----KEVQKKIQIDHSKNFIKDDDKNFDPTIPGKSIEVGSIHPISIIINRIIDVFRKIGFSYVEGPEIEDDWHNFTALNIPIDHPSRDMQDTFFLCKNPDIVLRTHTSSVQIRYMKKNSPPSRVLSVGKVYRNETISSRSYFMFHQAEGFYIDKKVSFSDLKQTIHYLINSLF-GEVKIRFRPSYFPFTEPSAEVDIYNN-----------HTGWLEIMGCGMIDPQVLKNVNIDSEIYSGFAFGIGIERLALLIYQIDDIRVYFDNDIRFLRQFQ.. 324
270 2.000e-46UniRef50_A0A1H1HMU4 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=Actinobacteria TaxID=201174 RepID=A0A1H1HMU4_9ACTN  ali  42  15..EEVARMRDEALAAIKAAADLDELKKVRLAHAGDRSPIALANREIGALPPQARAEAGRRVGSARKAINEALAARQAELEAERDERVLAEETVDVTLPWDRTPRGARHPLTTLQERIVDAFVAMGYEVAEGPELEGEWFNFDALNIAPDHPARSEHDTFFVESADSMVLRTQTSPVQVRALLSRKLPVYVVSPGKVFRTDEPDATHSPVFHQVEGLAVDEGLTMAHLKGTLDRFAEVMFGEGIGTRFRPNYFPFTEPSAEVDLRCFVCRGASCRTCKSEGWIEWGGCGMVNPRVLVACGVDPKRYSGFAFGMGIERTLMFRYNIGDLRDMVEGDVRFTLPF... 361
271 2.000e-46UniRef50_F0R405 Phenylalanine--tRNA ligase alpha subunit n=35 Tax=Bacteria TaxID=2 RepID=F0R405_BACSH  ali  42  26...........................LRIKYLSKKGIINALMADFRNVPAEQKKQVGMKLNELKTRTQERIAALKETFENQDADMSG----IDLTRTAYPIGLGTRHPLNIVRNQIIDIFSRLGFTIADGPEVEDDLHVFTKMNFAPDHPARDMQDTFFVETNPDDVTRTHTSSVQARTMEVTQPPIRVICPGRVYRNEAISYRAHCFFHQVEGLYVDKNVSFTDLKQVLLQFAQEMFGPETKIRLRPSYFPFTEPSAEMDISCHICGGEGCPFCKYTGWVEILGCGMVDPAVLDACGIDSKVYSGYAFGMGVERIANLKYKVKDLRMFSENDTRFLEEFE.. 341
272 2.000e-46UniRef50_A0A0G1XSV1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Parcubacteria group bacterium GW2011_GWA2_53_21 TaxID=1618858 RepID=A0A0G1XSV1_9  ali  38  1MQDAFQQLAQGLIVALKTVSSESELEAVRVEFLGRKGKLAEAMAGLKDLGAEARRETGKAANEAKMAMERLFASAEDRVKSARLGRLAEAEWVDLSLPGTSPREGHLHIVSQTIIEVEQIFNRIGFTRHHVPEIDWDYYAFEALNMPQDHPARDNWETYFMDEKGKMVATPHPSNDQVRLMEKLEPPFKALYIGKAYRRQS-DVSHVPIHHQFETECISHDATFSELKGVIEFFVHEYFGRERKVRLRPHHFRFTEPSFEIDISCAICGGAACRLCKE-GWLELAGAGLTHPNVIRAGGLDPNEWRGFAFAFGVERVLMMREGIPDMRDLYKNDLRFLEQF... 345
273 3.000e-46UniRef50_A0A1H6MC55 Phenylalanine--tRNA ligase alpha subunit n=175 Tax=Bacteria TaxID=2 RepID=A0A1H6MC55_9BACT  ali  46  55MKDQIARIQAEAMSRIAEIADMKGLEDARVAILGKKGTLTQAQQGMKDVPKEDKPAVGQMXXXXXXXXXXXXXXXXXXXXXAADKAAVAG--IDLTLPARSLPAGGLHPLTLVRDEAVRVLRRMGFALAEGPEIEDEFHCFDALNTPTDHPARNEKDTFYFDSGKLLRTHTSTVQVRAMEKQAP--PVRIISPGSAYRRDEIDATHLSAFNQIEGLYVDKDVTVGDLKGTLEYFLKALFGSETDVRFRPHFFPFTEPSFEIDVKLTVAGQA-------PRWIEIAGCGMIDPAVLEAVDSDYAGLSGFAFGIGLERLAMIRWGIRDIRLLIENDVRFLAQFQ.. 390
274 3.000e-46UniRef50_A0A2M7W149 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Dojkabacteria bacterium CG_4_10_14_0_2_um_filter_Dojkabacteria_WS6_41  ali  35  6IESELAELIKQVSTKLAKVATVEDVYAIRSEFTGNGSVLQQLLQSIKDVAVEDRPFVGAKINEAKKSIEANLQKALDFLASKESLIEDERRDIDVTAPFHINNPGSIHPIQYEINRMLDIFKTMGFVSFEGRELENDYYVFDSLNMPPEHPARQNWDSFRTEDNLIPTPHTSNMQV-RIMRQLKTAPLRAVMYGRVARNEAVDAVHGHTFYQIEGLYIDKGVSISNMIGTINAFVEAFFEKKVIGKVQPGYFPFVEPGIEYMGQCPFCEGVGCGSCKHAGWLELVGAGMIHPNVLREGGFDPAVYTGFAWGLGLDRMVMQRNGIKDIRSLFASDIRFLQ..... 351
275 4.000e-46UniRef50_A0A2M6WZ18 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Andersenbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_54_11 TaxID=  ali  37  7...ELNRGETAARRSLNAVADASGLEAWRAAYIGRKGSIPRLLRMVKDLPLAERKNAGRRGNEIRQALERSFREKEAQINVDG---KKAFSPQS-APAHRQTPPGHLHPLTHTLRQIQYIFTKLGFRLIEGPSVEEARYNFDSLNISLEHPARAETDTYYLKDHPGLVLRTHPLQVRSMLENKFRPPVRLMYWGPTFRAEKEDATHGALFQQYEFLVIDETVNLADLKAITTAFYSQFFGTEAVIRLRPSYFPFVEPGLEVDMQDT--------VTGRGDWLEMAGAGMIHPHVLEAMNVDSSRYQGIALGGGLDRLAMLKYGIPDIRLFYSGNLEFLRQF... 334
276 4.000e-46UniRef50_A0A1Q6YHQ5 Phenylalanine--tRNA ligase alpha subunit n=21 Tax=Bacteria TaxID=2 RepID=A0A1Q6YHQ5_9BACT  ali  42  6......EVRARFDSQASRPLDLPNWEILRQSWIGRKGALTLITENWLNASPDLKRSVGQELNKLKAHLEATLEERKLDIESLVDQGASIRERVDLSLPGVIRPIGSHHLIRQVFQEIEDIFFSIGFSVVEGPEIETPYYNFEALNIPEFHPVRDDMDTFYLEAPTPLLLRTHTSPMQIRTMEKQKPPVRVIVPGKVYRRDNPDATHSFAFHQIEGLAVDTDITFCDFTGTIEYFVKQFFGPSVKTRFRPSYFPFTEPSVEFDVSCPFCGGTGCSKCKGAAWIELFGAGMVDPAVYGFVNYDAKKVSGFAFGIGIDRLAMLKYGIDDIQVFFQNDVRFLRQF... 353
277 4.000e-46UniRef50_A0A1W6BH74 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Bacteria TaxID=2 RepID=A0A1W6BH74_9PROT  ali  42  3...DIKKIKDEYLNKLDKDQNIESINQIKTELFGKNGIVSNEFKKLGSVSQEERKKFASDLNFIXXXXXXXXXXXXXXXXXXXXXLKLENEKVDVTLPERDFKQGKIHPVSQVIDEISSIFSEIGFSVEEGPDVENEYNNFTALNTPDNHPARDMHDTFYLDEKKELLLRTHTSPVQVRTMLKGKPPFKIIAPGRTYRSDS-DQTHAPMFHQVEGLHIDKDINMGHLKGCLNYFIKEFFEDKLKMRFRPSHFPFTEPSAEVDIGYEIKDGKIIIGEGD-KWLEILGCGMVHPNVLKNVNVDPSKFQGYAFGIGIDRLGMLKYGINDLRAFFETDYRWLSHF... 339
278 4.000e-46UniRef50_A0A1F2V1K6 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2V1K6_9BACT :  ali  44  4.....DRARALFRAELAEVRTDAELQALRTRWVGRKGSVAAFMDALATAAPEIKKSLGRGANELKKEVEAAIAERGAALAATKRPANA----VDITLPGRAPVLGHRHPLSLIRDEVIEIFTRLGYQVLEGPEVEDDYHNFEALNMPEEHPARDMQDTLYLQTPLMPLLRTHTSAMQIRHMEKHAPPVRLVAIGPVYRRDNLDLTHTPMFHQVEGLVVGKGVTLADLKGTLSAMAEALFPSTRFIRFRPSFFPYTEPSAEVDIRCFKCKGQGCPLCKRTGWIEILGSGMVHPAVFEAVGYNSEEVTGFAFGMGVERVAQLKWGVDDIRLFYENDLRFLEQF... 368
279 4.000e-46UniRef50_UPI000690F012 hypothetical protein n=1 Tax=Streptosporangium amethystogenes TaxID=2002 RepID=UPI000690F012  ali  41  17.......................................................................................................RGARHPVTVMAEQMTDVFLDLGYRVVEGPEVEAEWFAFDALDMDDDHPGRAPDRVFHLEDPLVLRTRTSPAQVRAM--LGRTPPLRLVCAGRAFRPDAADTIHSPVFNQVEGLAVDLGLTMVDLKKTLDHFAAAVFGRGAVTRLRTHRSAYTDPSAKVYLECAVCHGVREDVSGEVSAVEWGWCGTVRPRVLTTCGVDPHRYGAFAFGVGVERTLMLRHGLKDIRDIVGGDIRF....... 267
280 5.000e-46UniRef50_A0A1F4VG27 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1F4VG27_9BACT  ali  42  5......DIKEKAFVEIKKIESTSQLEEARIRYLGRDGLVNQLFAEIPELPREEDRKKAGIYXXXXXXXXXXXXXXXXXXXXXLSAKELEKVPFDITASGIQITGGSIHPLTQLRQFVLDTFSDLGFEEVSAPHIETDDYNFGLLNVSADHPARDLWDTLYLEDGRLLRTHTSNMQVREMKKQAGKPPIRVMTFDRCFRYENLDPQHSHTFTQFEILYVDHHVSMANLRFLSDYFLKRFFGEKTKTRFRPKYYPFVEPGVGVDAL------------GPNGWIEIAGAGLVHPQVLRNGGIDPNQYSGLAWGFGPDRMLMAKLGIDDIRSFYEGDLRFLKQF... 333
281 5.000e-46UniRef50_A0A1W9JZX3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1W9JZX3_9PROT  ali  42  1MTTELDQMQTDMLAAIDAASGLDALDAVRVQALGKTGVITTLLKSLGAMTPEERQAKGPAIHGLREAITAGIATRKAALERADLDARLARETIDMTLPAEPALVGSIHPVSQVMDELAEIFADLGFAVATGPEIEDDWHNFTALNIPETHPARAMHDTFYCEGPSTARDRTHTSPVQIRTMMTQQPPIRIIAPGRTYRSDS-DATHTPMFHQVEGLVIDKGITLGHLKWTLETFLKAFFRDDVVLRLRPSYFPFTEPSAEVDVGFTVQNGKRVGDTENGGWMEVLGSGMVHPKVIAACGLDPDEWQGFAFGCGIDRLAMLKYGMDDLRPFFDGDLRWMKHY... 369
282 7.000e-46UniRef50_A0A2V8WN06 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8WN06_9BACT  ali  45  52............................KNAWLGRKGVLTLITENLKSAPPALKPIVGQSLNQLKRHIEESLETFRVAAEKGSEEVASNRDRVDLSLPGVLRPVGSHHLIRQVFQEIEDIFFSIGFSVVEGPEIETPYYNFEALNIPEFHPVRDDMDTFYLEAPTPLLLRTHTSPMQIRTMEKQKPPVRVIVPGKVYRRDNPDATHSFAFHQIEGLAVDTDITFCDFTGTIEYFVQQFFGPGVKTRFRPSYFPFTEPSVEFDVSCPFCGGTGCSKCKGAAWIELFGAGMVDPAVYGFVNYDAKKVSGFAFGIGIDRLAMLKYGIDDIQIFFQNDVRFLRQF... 377
283 8.000e-46UniRef50_A0A2E4QBV4 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E4QBV4_9GAMM  ali  39  2....IVDQVNDTVSRIAGLTSIDELEQLRIHWLGKKGQLTQALKSLASLPIEEKKEQGNRLNQYKQLLIEAIEHKRQELDQRQLDAILHQQKVDVTRPPRHALTGSQHPIHHVSERLIKWFSEHGFEYVLGPEVETEYYNFTALNFPDDHPSRQMHDTFYVEGDRLLRTHTSSVQIRCMHNRQPPFSLITAG---KTFRVDSDRTHLPMFHQLEGMLVSESTSYSQLKGLLSGFLKYLFGSDVEVRFRPSYFPFTEPSAEVDIKSH-----------DGQWLEVLGCGMIHPNVLTEANIDPVKFRGFAFGAGLDRLAMLLHGVSDIRSFVSGDIGFLEQFK.. 325
284 9.000e-46UniRef50_A0A2E5P151 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=root TaxID=1 RepID=A0A2E5P151_9ACTN  ali  42  1MISDLDQHLAEAATAIATAGDLDAMRTVNSELLGKQSVVTEARKTLGGLDEDERKAVGQRLNEVRAEIEALVAARRSALEGEARAEQLEEERLDLTELDRGRRLGHRHVVTQTWERLEDLFVGMGYTVSEGPEIEDEWHNFGALNFPPDHPARDMYDTLYVDEPGSTLLRTHTSPVQIRVMEAGEPPIYSIMPGRVFRSDTADATHMPVFHQIEGLVVDRGITFGDLAGTLEAFTRAYFGGDFTSRLRPSYFPFTEPSAEFDIRR-----------PDGTWLELAGCGMVHPNVLAACDLDPEEWSGFAFGFGLDRLALMRHGIDDLRELFRNDHRFLSQF... 332
285 9.000e-46UniRef50_A0A0G0TBE5 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Candidatus Woesebacteria TaxID=1752722 RepID=A0A0G0TBE5_9BACT  ali  38  1MQEEIMSAKNQAIAQISGAHDNEELEQIRIDLFGRNGKITNILRGVKNVPQDQRQQIGILINETKKTLENMLLDQKNSFKENVR------EWFDPTIPVPLVKIGNLHPTSVVISEMVEIFKHMGFSITEGPEIETDHYNFELLNLPKDHPARSLQDVLYIEEPETLLRSHTSSVETRSIENLKP-PFRVVVAGKCYRFENVNASNNAMFYQFQGFALQKGLSLSDLKGTLFHFAKSYFGKDRKIRFRCKYYPEVEPGVGLDLNCQFCNGKGCAVCKGRGWIEMLGAGMIHPNILKNFGYKPKEITGFAFGMGLDRIVMDRFKIKDIRSLYNGDIKY....... 330
286 1.000e-45UniRef50_A0A1W9P0T5 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1W9P0T5_9BACT  ali  38  3.KQTINELNKRASRELEKLLDLDKLREWKRQYLGKKGLITQLIKQLPGITDNKRPEIGRQINQIKNDLKKAYDRKMSNLQNQPPKTHRQEPWFDLTAPGEKTNLGHLHPITQMRQYAEDIFTRMGFEIFEAREVDDDYHNFESLNMPPQHPARDIWDTFWTN--QGLVLITHTSSMQNRILSTKEPPLRAVIVGRCFRNEATDARHEHTLHQIEGLLVDRGITLRHLIGVFKAFLDEFYQRDVSIKIQPSYFPFVEPGIEFLIDCTICRGKGCSTCGGSGWIELAGAGMIHPKVLKEAGIDPQKYSGFAWGFGLDRLVMMKYGIEDIRHFHSGDLRFIRQF... 348
287 1.000e-45UniRef50_R6ZH22 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Terrabacteria group TaxID=1783272 RepID=R6ZH22_9CLOT  ali  52  28.........................NDLKVEYLSKKGPISELSSLMKEIPNEEKKEFGSLLNDLKTFVNNSXXXXXXXXXXXXXXXXXXXXXIDITLSGTSIPSGSPSIIEKIVEETEEFFIGMGYDVLEGPEIELDKYNFEMLNLPKDHPARDAQDTYYLEENILLRSQTSPVQVRTMLKGEGKTPIRMICPGKTYRREDINATHEQEFTQIEGLVIDKNISLSDLKGTFDAFIKNMFGEGVEARFRPSYYPFTEPSVEMDMSCIYCDGSGCSMCKPKGWITICGGGMVHPNVLKACGYDPNEWQGFAFGMAAERISMLKYGITDMRVCHENDLRETRNF... 344
288 1.000e-45UniRef50_G0ABD1 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=root TaxID=1 RepID=G0ABD1_COLFT  ali  47  7.........................................................AQSSTNAKEQIEAALNARRDALANAQMQERLNAEAIDVTLPGRGRGVGGIHPVMRSWQRIEEIFRSIGFDVADGPEIETDWTNFTALNSPENHPARSMQDTFYIDKQLLLRTHTSPMQVRYAR--MNKPPIKVIAPGRTYRV-DSDATHSPMFHQVEGLWIAEDISFADLKGV.................................................................................................................. 182
289 2.000e-45UniRef50_A0A2E4SXP7 Phenylalanine--tRNA ligase alpha subunit n=22 Tax=Bacteria TaxID=2 RepID=A0A2E4SXP7_9ACTN  ali  43  31..........................ALDAELLGKASVVTEARRGLGALDAEQRKDAGRRLNEVRAALEHLLAERRSTLEAGVRAATLEAERLDLTELDTGRRLGHRHVVTQTWERLEDIFVGMGFTVAEGPEIEDEWHNFGALNXPPDHPARDMYDTLYVDEPGSTLLRTHTSPVQIRVMESIEPPIYSIMPGRVFRSDTADATHMPVFHQIEGLVVDRGITFGDMAGTMDAFTKAYFGREFTSRLRPSYFPFTEPSAEFDI-----------LRDDGSWLELAGCGMVHPNVLQAGGLDPEIWSGFAFGFGLDRLALMRHGIDDLRELFRNDHRFLSQF... 336
290 2.000e-45UniRef50_A0A2A4WU43 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Dependentiae bacterium TaxID=2030827 RepID=A0A2A4WU43_9BACT  ali  38  9....IKQIIDTFNTELASITSFKELDLLTARFTGKKGSVTILFQSIKTVSIEEKKVFAPQLNNLKIIISEAXTKKTELLHEIENAAAVEEQSFDVTYKPLDGHDGHIHLYTNLIEEIENIFISMGYDIWDGPYAETEYYNFTALNIPEDHPARDMYDTLWLNKK-NWLLRTHTSTVQVRTMEKQKPPLAGIVPGTVFRHEAVDASHDIQFMQCEGLFVDKNITIAHLFGVAKTFLQKLFNKELDIRIRPGYFPFVEPGVEIDMRCPF-CTAGCSTCKQSRWIEVFPGGMVHPEVLKKAGIDSEVYSGFAFGFGLTRLAMIKYGIPDIRLIQGGKVSFLKQF... 346
291 2.000e-45UniRef50_A0A1Z9FHH1 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=Bacteria TaxID=2 RepID=A0A1Z9FHH1_9RICK  ali  41  1MTDIIKKAKEKIDRNLKNVKNLQELELIKVNYTGKKGVFTSLLRSLSSLDNQKKAIAGKSLNLFKSDIEHKINSKKEDLKKLKLNESLIKDKIDITLPARPIRQGGIHPISKTIDEIVSIMGSLGFNVEEGPHIEDDYYNFTALNIPEEHPARQEHDTFYLNKHKKKLLRTHTSPVQIRTMKEKVPPIKIIVPGSTYR-CDDDATHSPMFHQIEGLVVDENISMANLKWVIKKLLSSFFNKSLPMRFRPSYFPFTEPSAEVDIGCSIDNGKLVIGEGK-DWLEVLGCGIINPHVFENCTIDTKKYSGFAFGLGVERFAMLKYGITDLRMFYENDHRWLK..... 342
292 2.000e-45UniRef50_A0A2E6M3F8 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E6M3F8_9GAMM  ali  37  12..KEVAEQQSAFTQTLEQTEDLKALEALRVSTLGRKGWVKKAFDLVKKVPGEQRKAVAQHLNEMKSSVEAALDQAEVRIATQAIEKQVESEWIDWTMPSTMDTQGALHPLTIIERNCIKVLQQLGFEVVEGPEVETPFHNFDALNIPEHHPARDMQDTFWLQDNFLLRSHTSTVQIRAAKAEGRDLPLKIVAPGRVYRNETVDATHLACFHQFEGLWVDHDVTFSELKAVLEFTVREIFGDAWELRFKPKFYPYTEPSIGIDIRLKDQDGQGAG-----KWLTILGAGMVHEHVFENTGFDPKTTKGFAFGLGVSRIVAMAYGVESMRSLYESDLR........ 343
293 3.000e-45UniRef50_G8LS20 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=Bacteria TaxID=2 RepID=G8LS20_9FLAO  ali  37  1MDKKMDEIKEEIK--IFKAQKYEDLEKFRIKFLGKKGILTILFKELKTIPIYKRKLYGTIINDLKKKVQK----KIQINNSKNFIKKENTLNFDSTVPGKSIDIGSIHPISILKNRIINIFRKIGFSYVEGPEIENDWHNFTALNFPIDHPSRDMQDTFFLHRNPDILLRTHTSSVQIRYMKKHCPPFRILSIGKVYRNETISSRSHFMFHQAECFSIDRKVSFSDLKKTIQYLIKSLF-GEVKIRFRPSYFPFTEPSAEVDIYFKNKNNRG--------WLEIMGCGMIDPKVLKNVNIDSEIYSGFAFGVGIERIAILIYKINDIRLFFDNDIRFLRQFK.. 328
294 3.000e-45UniRef50_A0A2G6PMH5 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Candidatus Gracilibacteria TaxID=1046947 RepID=A0A2G6PMH5_9BACT  ali  41  39MKKNLIKIEKDFLEKLKSINNEIELKELENKYIGKNGELKKILKGIKDLSVEEKKLIGLEANKIKNKIEEKIKEKIIYLEKLKYKILEEKEKIDVTLEFPIKNKGHKHPISITSEILEDIFISLGFKIEDGPQIETEEINFDKLNIPAEHPARDVWDTFWISDNINKKRNTHTSPVQVRTMLKGDLPIKIIVPGRVFRYEQEDARHTSNFYQLEGLMVGKGVTFGDLKWTLETVMKKLLGEKTILRFRPSIFPFTEPSAEIDISCCKQKNKECKMCSGTGWVELLGAGMVHPKVLKYCGIDPKIYSGFAFGMGIDRIAAQRFGVKSSRMFYQSKLKLNNQF... 389
295 4.000e-45UniRef50_A0A0G1QP43 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=root TaxID=1 RepID=A0A0G1QP43_9BACT  ali  35  253..NEITKLESQFSSDLDIVIAQTELDSLYLKYLGKKGLTTELLKGLQNLALQDKKIYGPLLNELKKSQESQIEAKKSKISHQPST-------LDLTIPGIVQSTGRLHPTTIIIRELNEFFRYHGFSIAEGPEIEDVEYNFRRLNLPDGHPATDLQDSLFIEEPNLLLR-THTSSIQTRVLSSFKPPLRVVVPGKCYRNETANSTNGAFFYQYQGFVVDKGINIQNLKDMLTQVHQFLFGKDVILRFRYKYYPEVSPGMGVDMQCIFCHGEGCSVCKYRGWIETLGSGITHYNCYKQCGIDPEIYTGYSFGLGLDRLVMSKFGIKDIRKLYGGEIVYL...... 580
296 4.000e-45UniRef50_C7M0T2 Phenylalanine--tRNA ligase alpha subunit n=15 Tax=Actinobacteria TaxID=201174 RepID=C7M0T2_ACIFD  ali  42  25........VQGALERLATVADRDELAAIREAALGPQSPLAVLSRSIRNLDPEERPVLGRVVAEARASLTSAIEAAEARLDAAELLERAERERSDPSVGLLVEPPGARHLVARARMALEDVFWRLGFEVASGPEVEDEWFNFEALNVPEHHPARAAQDSFYLDVDPPLLLRTHTSPAQIRLMQRGTLPIYAVVPGRVYRRDTPDARHTPAFHQIEALVVDEGITFSHLKGTIEAFTTAYFGPGIHSRLRPAYFPFTEPSAEFEVTCTICGGAGCRTCSGTGWIELGGAGMVHARVLEAGGLDPGRVSGFAFGFGIDRLVQMRYGLADMRVLPENDLRLL...... 359
297 4.000e-45UniRef50_F3GF95 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Bacteria TaxID=2 RepID=F3GF95_PSESJ  ali  59  1..............................................................................................MTLPGRGQTSGGLHPITRTLERIEQFFTHIGYGIAEGPEVEDDYHNFEALNIPGHHPARSMHDTFYFNANMLLRTHTSPVQVRTMESQQP--PIRIVCPGRVYRSDS-DITHSPMFHQIEGLLVDRDINFADLKGTIEEFLRVFFEKELAVRFRPSYFPFTEPSAEVDMECVMCSGKGCRVCKQTGWLEVMGCGMVHPNVLRMSGIDPEEFQGFAFGMGVERLAMLRYGVNDLRLFFDNDLRFLAQFR.. 245
298 6.000e-45UniRef50_L7VN84 Phenylalanine--tRNA ligase alpha subunit n=24 Tax=unclassified Flavobacteriales TaxID=313602 RepID=L7VN84_9FLAO  ali  39  12MQEKIFREIEEIRKSIQKIKDIKEIEEFHVKYLGKKGKFSKLFKSFRKLLPYQKKQLGESXXXXXXXXXXXXXXXXXXXXXTFQEGILE----DFTKPGISCIIGRRHPISTMKHTIINLFEAIGFITVEGPEIEDDWHNFTALNFPDHHPSRDMQDTFFIEKNPDLLLRTHTSSVQIRYMENHRPPIRILSPGRVYRNEAITARSHCMFHQIEGLYVNKGVSFTNLKQTIHYFINELF-GSVRYRFRPSYFPFTEPSAEVDVYCGLESEIDRSITKGTGWLEVMGCGMVDPHVLQNVDIDPENFSGFAFGIGIERIALLLYKIEDIRFYFDNDIRFLKQF... 349
299 7.000e-45UniRef50_A0A258F9M6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Hydrogenophilales bacterium 32-62-9 TaxID=1970531 RepID=A0A258F9M6_9PROT  ali  45  5.....NEIVADALNAIQSCPDLPALEQVKAVYLGKSGQLTELLKSLGGMPADERKTAGARINEAKQAVEGALKTRRDVLQLAELDRQLAAETLDVSLPGRGLSHGGLHPVSRTLTRIQALFRSIGFEVATGPEIETDFYNFTALNIPEDHPARAMHDTFYLQSEGLLR--THTSPVQVRYMQTNQPPLRIIA-----------------------------------------------RDDLPVRFRPSFFPFTEPSAEMDIGCVMCGGEGCRVCSHTGWLEVLGCGMVHPNVFKHVEIDTERFIGFAFGLGVERLAMLRYGVDDLRLFFENDLRFLKKF... 291
300 7.000e-45UniRef50_A0A0R2WVS8 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=11 Tax=root TaxID=1 RepID=A0A0R2WVS8_9FLAO  ali  43  20.....................KEELETFRIKYLGNKGLLKGLFAEFKNVDADLRKDFGQALNTLXXXXXXXXXXXXXXXXXXXXXKSIYG---DLTRPAEPIELGSRHPISIVKNQIIEVFNRIGFTVSEGPEIEDDWHNFTALNLPEYHPARDMQDTFFFESDLLLRTHTSSVQVRYME--KNQPPIRTISPGRVFRNEDISARAHCIFHQVEGLYIDTNVSFADLKQTLLYFTKEMFGKSK-IRLRPSYF............................................................................................ 251
301 8.000e-45UniRef50_A0A2A4SSC1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Peregrinibacteria bacterium TaxID=2030811 RepID=A0A2A4SSC1_9BACT  ali  40  1MIEKIQELRMAAEAAMGKVNNEQGLRDFEIVYLGKKGELKDFAKNISKVDPSERKNFGQAVNALKRDIENSIELKAAEFEQKKMEALADNEWIDITAPAKDHMRGGRHPLSSFIDEVNELFTELGFSHADGAEIESEWYNFTALNLDADHPAREMQDTFFVEELKAMVLRTQTSSMQIHYMQKNKPPLRVFVAGKVFRKES-DATHAPVFHQVDCLLVDKNVSLRNLKGVLQEIFSKLLKPDVKIRFRLSYFPFTEPSLEVDIGFELKGNKDY-------WLEIGGAGMVHPQVLKNAGLDPAEYNGFAFGMGIERMLMIRNNIKDLRLFFDNDIRFLKQFS.. 349
302 8.000e-45UniRef50_E2CV93 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=4 Tax=Actinomycetaceae TaxID=2049 RepID=E2CV93_9ACTO  ali  52  6.......................................................................................LRTEAVDVTIPTSRMQAGARHPLDILIDEVCDFFTSMGWSIAEGPEVEHEWFDFDALNFDADHPARQMQDTFYVAANLVLRTHTSPVQARVM--LDQRPPIYVACPGKVFRSDELDATHTPVFHQVEGLAVDKGLTMAHLKGVLDHFAKAMFGPE...................................................................................................... 169
303 9.000e-45UniRef50_A0A1Z5K7B5 Phenylalanyl-tRNA synthetase alpha chain n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5K7B5_FISSO  ali  44  86..................VKTVADAEAIRREYLGKKGPINKAMGYMRLLSNEDKPKLGAVVNEIKEALETRVTESMKQLEIGMIEEKMKAEYIDVTMPGRYPDIGRRHPLSMTMEKAIDIFTSLGYDVEDSPEIETDYNCFEALNCPKDHPARDMQDTFYLTEDMEYLLRTHTSSVQIRQLKKRKPPLRIVAPGRVYRKDDIDATHSLMFHQVEILALEKRLNLGHLKGTVEHFLKEMLGPDIQVRFRGSYFPFTEPSMEVDVFF------------RGKWMEVLGCGMVDPNVLEMAGIDPNEYSGFAAGFGVERFCMVIHGVKDLREFTKNDKRFLEQFPH. 406
304 1.000e-44UniRef50_A0A2V9TWA2 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9TWA2_9BACT  ali  43  27LDKAAERLLAALKKESADIKAESDWKLFRDRWMARKGVLTLVNDWLKAAPKENKREIGQRVNQIKRQVEQTVDRTLSRIQSAASASRLSTESIDITLPGNRRPLGAEHPVIKTMNEIVSVFRNLGYSVEEGPIIETDYYNFEALNFPPNHPARDTQDTLFVANQDRLLLRTHTSPVQIRTMEKIKPPLRIVIPGKVHRNDPPDASHSPMFHQIEGLAVDTNITLGDLKGTLDHAMKALFGSSVKTSFRPSFFPFTEPSAEMLISCFICGGSGCRSCKQTGWIEILGCGMVDPNVFEFVGYDPRKVSGFAFGMGADRIAILKYGVDDIQLFFQGDVRFLEQF... 384
305 1.000e-44UniRef50_A0A0G0WHJ2 Phenylalanine--tRNA ligase alpha subunit n=25 Tax=root TaxID=1 RepID=A0A0G0WHJ2_9BACT  ali  36  1MENRLKIIYQDYLHKIQQTKDLKSLDEIFLALFGKNGEITLATKEFPKLSKEELKVVAPLLAKVKAELEEAVTKRREEIKEEGYQKLSE-EKLDLTPVELPREKGHLHVITTFEEETVGLFQKLGFQRYDAPQIDSDDFNFSLLNIPEDHPARDLWDTLYLDEPGKLLLRTHTSNSQVRIMREHQPPFRMMVLGRCFRYENLDARHEHTFEQFEIVYVDKGLSMANLQYLSEHLLKGIFGEEMKVRMTPGYYPFVEPGAGVDGLCIFCKGKGCKVCGGVGWLELAGAGMIHPTVLKNGGIDPKIYSGIAWGFGPFRMLMLKYGINDIRTFLSGNLKELLKYEG. 348
306 1.000e-44UniRef50_A0A1Q3MUV3 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Alphaproteobacteria bacterium 40-19 TaxID=1895705 RepID=A0A1Q3MUV3_9PROT  ali  39  4.QDDLISLVSNFLQQIASAPSLQDLEKLKAELFGKKGFISVALAGLSKLPMEEKKSLGAVYNDYKNQLFQAMACRKDVLEEQSWQEKLAQQSIDVTLPAPYAPWGQMHPLTVVLKRAVEILVGMGFCVHTGPDVETPFHNFDALNVPLTHPARAPGDTFYIKGN---LLRTHTSSVQIRVLQEKEPPLRVISFGSTYRRDECDATHTPMFHQMEMMVVEGGATMAHLKGCLFEFLSLFFQPDLEMRLRPSFFPFTEPSAEVDV------------KLNGKWLELLGCGMIHPRVFTQCGK--ENLSGYAFGMGLERLAMLKYELSDIRDFYNNDQRWLGYFSE. 329
307 1.000e-44UniRef50_A0A0G0MY70 Phenylalanine--tRNA ligase alpha subunit n=27 Tax=root TaxID=1 RepID=A0A0G0MY70_9BACT  ali  32  1MNQDLDQIKIQYQHKIENIESTQELEKIRIRLFGRNGLINDLFKNIKDIAPADRKQYGHNLNQLKSELESLFDQKSKSLSVNSTSIP---KINIYSPNNTLPKVGHLHPITQTERLLNEVFQKLGFSLYDGPEIENDEYCFQRLNVPLDHPAREMQDTIYIKEPEYLLR-TQGSSIEARLLSQEKPPFKAAFPGRVYRNEKVNKSNHFIFHHYQGVVVDKNITLKDLFGTINLLFKTLYGPNVVIRFRNKYYPEVEPGVGPDMQCFSCHGTGCSICKGAGWIEMGGAGIIHPHVLKMAGIDPKIWQGFAFGLGLDRWVMAKYNIKDIRTLLGGNL......... 331
308 1.000e-44UniRef50_A0A2H0R944 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=candidate division WWE3 TaxID=422282 RepID=A0A2H0R944_9BACT  ali  35  5...DIEQEVKDLDKKIKGIKTKEDLENIRIEYLGRNGKINKLGQEVKNIPDQQKSEFGKKLNEYKKTVTDKLY-------SIKISEKKEESYLNISAPVKTTPAGNFHPTTLTTQELNKFFNYYGFSVLEGPEIENDFYNFEMMGVPKNHPARELQDTLYIKEP-ELLLRTQTSNEEARILEKKELPIRVVIPGKVYRNETANKTNGAVFYQYQGVYVDVNVTMGNLKWIFEKALKFILGEDTTIRFRSKYYPEVEPGLSPDIQCKFCHGNGCEICKYRGWIEIAGGGMIHPTTLTKAGIDNKKYSGFAFGWGLDRVVMQKYNIPDQRLLYSGNI......... 328
309 2.000e-44UniRef50_A0A1G2F1G4 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Niyogibacteria bacterium RIFCSPLOWO2_12_FULL_41_13 TaxID=1801726 RepI  ali  37  3...DIRKLEKQTLEQIEKTSDENGLRIFEKQWLGPKGKIRELFRELKNFEPEERKKIGGEINLLKKELTAALEKKRTGAEKEKQGFVLEKEWLDATRPVKPAEIGHIHLLTSALKDIALIFKNLGFDSVSGPDIETEWNNFDALNIPAYHPARETADTFWLNKSQKLLLRTHTSPSQIRHLLSHKPPCRIVSPGKVYRFEAIDASHNIEFWQLEGLAVDKNINFANLLDILRTFLKEFFKEKLKIRIRPSYYPFVEPGIDIDLSFD-----------GKKWIEAAGAGMVHPNVLKNTKLNPEGWQGIAFGIGVDRLIMLKHKIPDIRLLHSADLRFLKQF... 335
310 2.000e-44UniRef50_B1VH38 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=Actinobacteria TaxID=201174 RepID=B1VH38_CORU7  ali  39  30...............FTSATNLEELAEARRAHLGDDAPIPAARRSLGSLPKDQRKDAGRIVNMARGRVEKLFAQVKAELEEKRNQEALRAERIDVTQPTTRGQVGAQHPITILNEQIADIFVGMGWEIADGPEVEAEYFNFDSLNFIPDHPARTLQDTFHIAPQSRQVLRTHTSPVQMRTMLSREVPVYIACPGRVFRTDELDATHTPVFHQVEGLAVDKGLTMAHLKGTLDHLAKSLFGPNTKTRIRPNYFPFTEPSAEVDVWFED-------KKGGAGWIEWGGCGMVNPNVLIAAGIDPEEYSGFAFGMGIERTLQFRNGLPDMRDMVEGDVRFTLPF... 349
311 2.000e-44UniRef50_E2CVB7 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=7 Tax=Actinomyces TaxID=1654 RepID=E2CVB7_9ACTO  ali  52  6.......................................................................................LRTEAVDVTIPTSRTQAGARHPLDVLIDEVCDFFTSMGWSIAEGPEVEHEWFDFDALNFDADHPARQMQDTFYIDGNLVLRTHTSPVQARVM--LEQQPPLYVACPGKVFRSDELDATHTPVFHQVEGLAVDKGLTMAHLKGVLDHFAKAMFGPE...................................................................................................... 169
312 3.000e-44UniRef50_A0A1M3IN92 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1M3IN92_9PROT  ali  39  4....VDSLKSVFADALKSAEDLSTLDELRLAYMGKKGLVKNLFENLKSTSSEIRGAKAKELNEFKEYVEAELMRAESDLKHRENNLRIQDEWQDISLPSSIQQQGSLHPLTRIERHCIEVLGMMGFKLAEGPEIEDAFHNFDALNISENHPARDMQDTFWLEKELLLRSHTSTIQIRTL-QEQKDLPIRIISPGRVYRNESVDATHLAYFHQFEGLWVDEGVKFSHLKGTVDFIIKNTFGDGWDIRYKPKFYPYTEPSVGVDVR---------EKGKNGKWITVLGAGMVHPNVFRMTGHDPKKVSGFAFGLGTSRMVSMAHGVTDMKSLYLGDLR........ 325
313 4.000e-44UniRef50_A0A2V6LVW9 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6LVW9_9BACT  ali  46  1MPHPLEQLRDNALREIGDAPDEKTLEAVRVRYLGKSGSISVWGEKMKTLSQEERPVVGKLLNETRNAVADAIEQHAEKLRSQKESEALAS--IDVSLPGTPSERGSLHPLTQILDRAIAIFRRMGFALADGPDIETEWHCFDALNTPPDHPARNEQDTFYLPDGRLLRTHTSTVQIRTMEAAPP--PIRVIAPGAAYRRDEIDATHSAQFHQIEGLYVDENVSIADLKGALEFFFRELLGPDTAVRFRPHYSGMVHPGVFEEVNKARGDDA----------------------------YNPKKWTGYAFGLGMDRLAMILFDIPDIRLFAQNDLRFLRQF... 309
314 4.000e-44UniRef50_Q30S84 Phenylalanine--tRNA ligase alpha subunit n=234 Tax=root TaxID=1 RepID=SYFA_SULDN  ali  43  6.............DLITEAQSVEKIEEIRISLFGKKGVLAAEFARMKEASDEEKSKIAQELNIHKTTLMNELVQRKITLQTQELQEHMKSEAIDVTMFSSSSESGALHPVMQTMDRIVEYFSSMNFTVKTGTMVEDDFNNFEALNLPKYHPARDMQDTFYFKDEMLLRTHTSPVQIRTMMSSKP--PIRMIAPGAVFRR-DYDITHTPMFHQVEGLLVDKEAVSFANLKFILEDFLKYMFGDVEVRFRPSFFPFTEPSAEVDISCVFCKGSGCRVCSKTGWLEVLGCGIVDPNVFEAV--KYQNVSGYAFGLGVERFAMLIHQIGDLRSLFEGDIKLLEQFR.. 330
315 5.000e-44UniRef50_B1VA93 Phenylalanine--tRNA ligase alpha subunit n=15 Tax=Candidatus Phytoplasma TaxID=33926 RepID=SYFA_PHYAS  ali  42  1MHNKINLLKEKFEHDLAKNKNLENLIYLEQKFLGKKSFLQELNQTLKNIPSEKKPAIGKLINEFKKTIILSLQKEKQYLKTQKMNLELMQESVDVNLPGFNFSTGSIHPLYQIIEQLEDLFLSLGYEIKDGNEIESDFYNFEMLNIGKNHPARAMQDSFYINPQKLLRTHTSNIQV-KEMLANEGKPLKIISSGKVFRKDNDDATHSHQFMQLEGLVIDQKINFLNLKETILTIIKELFGDSQEINIRPSYFPFTEPSIEVDLVIRKKDNS-------KEYLEILGAGLVHPQVLLNANYNPEKYQGFAFGIGIERIAMIKYQIENIRHFYQNDIRFLKQFSK. 336
316 5.000e-44UniRef50_Q7M8Y9 Phenylalanine--tRNA ligase alpha subunit n=110 Tax=root TaxID=1 RepID=SYFA_WOLSU  ali  48  2.........DSLINEIKSAQSSAELEELRIKALGKKGILTAQFALLKNLDXXXXXXXXXXXXXXXXXXXXXWTLKKEIIATEELHKKLLEEKVDMTLFAPSKGVGSAHPVMITMERIVDYFVSLNFAIKSGPLIEDDFHNFEALNLPKYHPARDMQDTFYFKDGMLLRTHTSPVQIRTMEKETP--PIRMICPGAVFRRD-YDLTHTPMFHQVEGLVVEEEGKVFANLKYILEDFLRFMFGEVQVRFRTSFFPFTEPSAEVDISCIFCHGEGCRVCSHTGWLEVLGCGLVDENVFKAVGY--KNVSGYAFGLGVERFAMLIHAVSDLRAFFESDLRVLEQFR.. 330
317 5.000e-44UniRef50_A1A1X6 Phenylalanine--tRNA ligase alpha subunit n=358 Tax=root TaxID=1 RepID=SYFA_BIFAA  ali  38  10..QAVTDAVAEGIAKIENASTMEELKAIKTQYAGAESAMTQASKAIGALPKDQKKDAGKLMGKLRADFGRAFGTKEKQVKAEEEARELAAETVDMTLPVNRKPLGARHPLPKLMEDVEDFFISMGWQISDGPEVETEWYDFDALNFGPDHPARQMQDTFYVKGNQNMVLRTQTSSDQVRGLITRGVPLYIACPGRVFRTDELDATHTPVFHQVEALAVDKHLTMADLKGVLDKLAVAMFGPEAKTRLRPSYFPFTEPSAELDLWFPD-------KKGGAGWLEWGGCGMVNPNVLKSAGLDPEVYTGFAFGVGVERTLLLRHDINDMHDLVEGDVRFSEQF... 351
318 5.000e-44UniRef50_A0A0H1SCW7 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Mycoplasmatales TaxID=2085 RepID=A0A0H1SCW7_9MOLU  ali  40  9.....KEISLLIERSLQEAADFSAIEIVKKKYLDKGGLISQLFQQVQEKDLAKRKKLGSLINNWXXXXXXXXXXXXXXXXXXXXXQVPKKEEVDIYLEGEKIPLANLHPLTQITQKIYDIFWRLGYQIVESPEIETEENNFTFLNMPPGHPARAMQDTFYLNHNLLLRTHTTTIQPWVMKNILNDTELKIVSIGKVYRRDEDDATHTHQFTQIDCFAVGKNFSFSHLKGTLESVVQELLGKEQTIRLRPSYFPFTEPSVEIDARCLLCQGKGCEICKKTGWVEIAGAGLIHPQVLKNGGFDSQKFTGFAFAFGLERLLMIKYGIEDIRHFYLNDIRFLRQFRGI 374
319 5.000e-44UniRef50_A0A2V8NI70 Phenylalanine--tRNA ligase subunit alpha (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8NI70_9BACT  ali  43  2.............................................IGRVEPSERAAFGQLVQQIEAEIVDRIDRTEAGLKLIVARMRTERERIDVTLPGHRPRRGHLHPITLLRQRIEDIFVSLGYAIEDDREIETDFYNFTALNIPENHPARDPLDTFYTVDGFALRSQTSTVQIHAMERR--TAPLRMIAPGRVFRRDTPDATHNPMFYQVEGLCVDRGITMA....................................................................................................................... 179
320 6.000e-44UniRef50_A0A1H4LB01 Phenylalanine--tRNA ligase alpha subunit n=26 Tax=Acidobacteria TaxID=57723 RepID=A0A1H4LB01_9BACT  ali  40  16LDQAFRALTDQVRSATSQLTTAEAQENFRLDWLGRKGRLKLLSETLKTAPPEAKKSLGMRFNTLKNEIEAALANEPASAKSSGG------PSLDLSLPGIRRSVGVEHPLTRTMREMTAVFAALGYSVGIGPEVESDFYNFEALNFPPNHPARDTQDTLVVAGQERLLMRTHTSPVQIRSMVANLPPLRIVIPGKVHRNDESDATHSPIFHQVEGLCVDTNITFSDLKGTLDYAMKAFFGSSVKTRFFPSFFPFTEPSADVQISCPFCGQKGCRKCKFSGWIELLGCGMVDPAVFAAVDYDTKKISGFAFGMGVERIAMMKYGVGDIGQFYSGDLRFLSQF... 369
321 7.000e-44UniRef50_Q8NQN7 Phenylalanine--tRNA ligase alpha subunit n=1406 Tax=root TaxID=1 RepID=SYFA_CORGL  ali  38  3.EASLNEAADAAIKAFDGAQNLDELAALRRDHLGDAAPIPQARRSLGTIPKDQRKDAGRFVNMALGRAEKHFAQVKVVLEEKRNAEVLELERVDVTVPTTREQVGALHPITILNEQIADIFVGMGWEIAEGPEVEAEYFNFDALNFLPDHPARTLQDTFHIAEGSRQVLRTHTSPVQVRTMLNREVPIYIACPGRVFRTDELDATHTPVFHQIEGLAVDKGLTMAHLRGTLDHLAKELFGPETKTRMRSNYFPFTEPSAEVDVWFPN-------KKGGAGWIEWGGCGMVNPNVLRAVGVDPEEYTGFAFGMGIERTLQFRNGLSDMRDMVEGDIRFTLPF... 336
322 7.000e-44UniRef50_A0A2H0RL91 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Patescibacteria group TaxID=1783273 RepID=A0A2H0RL91_9BACT  ali  39  1MEDQLSNLTAQFQQDLAAVLTSDNVETLRIQYLGRKSPFQDVMRSLKDASVDQRKELGQAANKAKQDIEAAIEAKETAIANQRFERLGTDERIDITLPGEKGPEGHLHMTTHAIRDIAKIFEHIGFTQVRHPEIDWEWYPFDVLRINADHPARDNWETFFLDTPADTKKGKMVLVPHVSNGQVREMPIRSMNIAKTYRRQS-DVSHVPMFHQFEGWIIDKGIRLTDLKGVMEYFVKEYFGEDREIRLRPHHFRFTEPSMELDISCGLCAGKGCSMCKE-GWVELGGAGMMHPDVLRAGGVDPEVYSGLAFGWGVERTLSMKAGIADLRTMYKNDVRFLEQF... 349
323 1.000e-43UniRef50_A0A2D7ZNP1 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Caulobacterales TaxID=204458 RepID=A0A2D7ZNP1_9CAUL  ali  43  3...DLNTLKTDLIAQVEAAPDAAALEAIRISALGKSGQISELLKSLGKMSPDERREQGPLINGLRDAVAGRIAERKAEMEAAELDRRLAAERVDLSLPAPPRRRGSVHPTMQVMDEMVSIFAEMGFSVAEGPDIETDFNNFTALNFPPKHPAREMHDTFFMADRKVLRTHTSPVQVRVMRQINQEPPIRVVVPGRTYR-CDSDATHTPMFHQMEGLVIDKAVHMGHLKWTLETFISRFFETEVVSRFRPHHFPFTEPSAEMDV-QCDRSGGDIKIGQGTDWLEVVGCGMVHPNVLRNCGLDPEVWQGFAFGFGVDRLGMLKYGMPDLRDMFAGDARWLGHY... 354
324 1.000e-43UniRef50_A0A2M7T215 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Alphaproteobacteria bacterium CG_4_10_14_0_8_um_filter_37_21 TaxID=1973897 RepID  ali  38  4........LDNWKMTIENLQSQDELDKAKILFLGKAGLLTQEMKTLGSLTVDQKKEKGKALNILRENINQAFLQKKEFFDDIILNEKINAEAVDVTLTTRPRAQGKLHLLSQVMEDIETYFGNLGFKLEMGPDVDDENNNFNALNIPQHHPARQSQDTFYLNSNNKNLLRTHTSNIQTHILKNQKPPMRVLALGRAYRSDDIDATHTPMFHQAEVFVIDKNITMGHLKATIIDFLRFFFDEDLAVRFRPSFFPFTEPSAEVDIKM-----------KGRDWMEILGCGLIHPNVLDNCSVDKTIYQGFAAGMGIERLTMLKYGIKDIRQLYENDQRFLN..... 327
325 1.000e-43UniRef50_A0A268TIF3 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Helicobacter TaxID=209 RepID=A0A268TIF3_9HELI  ali  44  2.........NTLIQKLQSVKNSQELEEIRLEALGKKGIITQKFSELKSLQGEEKRQFAQEINTIKQEFESLYYLKKTQLQTQELQDALQNEKIDVSLFASRSHRSLGHPINYTKDRIIDYFMHLGYELCMGPLIEDDFHNFSALNLPEYHPARDMQDTFYFNDGMLLRTHTSPVQIRTMQAQTP--PIKMICPGPTFRR-DYDLTHTPMFHQVEGLVVDNSQTSFANLKYTLQDFLRHIFGDVKVRFRSSFFPFTEPSAEVDISCVFCKGAGCRVCSNTGWLEILGCGVVDEYVFEAVGY--HNVSGYAFGMGIERLAMLTCGVNDLRSFFETDLRVLEQF... 329
326 2.000e-43UniRef50_A0A0G1UEF7 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1UEF7_9BACT  ali  41  257.KAKLQNLKNEALAMIMQTQDQAELENIRIQYLGKSGQLAQIAGQLKSLEPAERTEIGKLFNDVKSAIQASLDPKLKIENLKLIIEG------DPTLPGLKPRLGHLHPISQAIEEISIVFEKIGFIRVRYPETDWDWYTFESLNMTPDHPARDEWETFFVDAPPHPLTPHTSNGQVREMERVKKPPIRMINIAKCYRRQS-DVSHTVMFHQFEGLVIDTGITIAHLKGTIDYFVHQFFGPDRKSRLRPSHFQFTEPSFEVDVTCDICLGQGCRLCKE-GWLELGGAGMVHPSVLSAGKIDPQKYTGFAFGWGVERTYMMKSGIPDLRLLYSNDIRFLNQF... 596
327 2.000e-43UniRef50_Q2RYT4 Phenylalanine--tRNA ligase alpha subunit n=90 Tax=root TaxID=1 RepID=SYFA_SALRD  ali  44  1MPDEIDQLREQIEAESIESAEEAE--AFRIKYLGRNGAIPDLFDQIGDLPPEERPEFGRRLNALXXXXXXXXXXXXXXXXXXXXXGG---PDIDLTLPGRCGFKGSTHPLTQTLDEILRILRGLGFSTHEGPEVETDWHNFTALNFPPDHPARDMQDTFFLEDPPEGTEPTHTSPGQIRIMEAQTPPIRVAVPGRVYRNEAISYKSFCLFHQVELLYVDENVTMAQLKQVLYSLARALFGEDVTLRFRPSYFPFTEPSAEVDVWWDDEDSDD-----GGQWMEILGCGMVHPNVFESVDVDPERYTGYAVGMGVERMAMLRHGIDDIRIFYENDVRFLDQF... 336
328 2.000e-43UniRef50_R7P9T6 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Terrabacteria group TaxID=1783272 RepID=R7P9T6_9CLOT  ali  44  31..............................NYVGKKSRIAEILGSLKDMSVEDKRKYGSLINNTKKEMEEMTSARIISLESKSNIAFDDSLEFNV-------PVGSLHPVTIVAKEITDILKKMGFTVVSGPEMETEYYNFEALNVPKDHPARDMQDTYYLDNGTVLRTQTSDNQIHAMENYG--APLRICAPGRTFRNEDLDANHENTFFQIEGMVIDEDVSIENLMYIMQELLKSIFKDDLKVRLRPGFFPFTEPSYEMDMSCLICGGKGCPTCKNAGWIELIGCGMVHPNVLRAGGIDPDKYRGFAFGIGLTRLAMMKYKISDIRPLNSGDIRYLSNF... 333
329 2.000e-43UniRef50_A0A061JGE3 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Holospora TaxID=44747 RepID=A0A061JGE3_9PROT  ali  40  6........LEQYLGVINQVLTLEDLYALKQKYFGKQSELTQAIRQLSELCAEERKEKGEKIHHLKKMILEALGKKEEELKEYALNQKLLQERVDVTLPCAPVRKGFLHPISEVLWDAVEIFQQMGFSWVDGPEVETNFYNFDALNVTEGHPARAEQDTFYLP---YGVLRTQTSPVQIRSMEKMSPALKIISPGRVYR-SDHDQTHTPMFHQIEGLVVSKEANMAELKGVLQVFLERFFSKSVSLRFRPSFFPFTEPSCEVDI-GYRKEDENIILEGDSHWLEILGCGMVHQQILTRCNICPQTYQGYAFGMGVERLTMLRYGIQDIRELYKNHQTWLSN.... 332
330 2.000e-43UniRef50_A0A0G1QHY8 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G1QHY8_9BACT  ali  37  2...DFETLKNQAKKELAGLKTSGVLESWRVKYLGRNSELALFLRSLSKKSLEEKRQLGPKANQLRQFLEGAFQQKSLSLVD----SQSPATDFDLTLPGRVQEPGHLHPLTLANREILKIFSSMGFDIMTGPEIEGDYYNFSALNIPDWHPARETMDTMWLSEKDLPRRTHTSPIQVRYMQTHKPPFRMVVGEGRIFRNEATDARHEFQVNQLEGLMIGKDVSMATLHFVVREFFRKFFSKEIQMRLSPSFYPFVEPGADVSVSCCFGKNKDCRLCGGLGWLEVAGSGMVHPNVLRSVGIDPRKWQGFAFGFGIDRLSMIKFNIKEIRLFMSGDLKFIKQF... 359
331 2.000e-43UniRef50_A0A1W9SAW5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Rickettsiaceae bacterium 4572_127 TaxID=1971637 RepID=A0A1W9SAW5_9RICK  ali  37  2............LNKIKSCKTIEELEAVRISLLGKKGILTQKMKELGQLAPEERKSAGQKLNVEKQAVAIAIEDKKTELSLVEMNKKLATEKLDLTLPVNQPKRGTLHPMTHVMMEIATIFSNMGFEMAEGPDIDDTWHNFDALNIPEHHPARERNASFFLKSSENMLR-TETSTIQIRKMQKDGAPVKIFAPGRAYRY-DLDATHVPMFHQCEGLVIGKNITLANMGAMHDFLESFLGIKDIPMRCRQHFFPFVEPAFEVDVKYKEVDGRWIIGKDGDKWTEVFPAGMVHPNVLKNCGIDPNEYQGFAFGFGVERALMIKYGISDMRKLFEGDVRWLQHY... 330
332 2.000e-43UniRef50_A0A069JW96 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Bacteria TaxID=2 RepID=A0A069JW96_9ACTN  ali  38  1MKSELERMSRSAVSEISELSDAGKLEEYRVRWLGGKGLIRRARAAIKEHQGPERVEFAKGVNRVAEEITEVLARAADRIEDEATARRIAEDWIDPSLPATAPRRGALHPVRVVELRCVEIMGRLGFEQAEGPEVETSYYNFDALNIPRDHPARDMQDTFWVDEQRLLRTHTTSVQARLLAQ-AEGRPVKVVVAGRVYRNEAVDATHLAMFHQLDGFWVDQGLTFAHLKGVAVHLAREL-YGDRRVRFKPKSYPYTEPSVGIDVECGLCRGSGCAACHESGWVTIMGAGMIHRNVLKEFGYDPDRVSGFAFGWGLSRMTTQMYGLAKLRPVYRGDLRLLR..... 338
333 2.000e-43UniRef50_W8GMP7 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Hepatoplasma crinochetorum TaxID=295596 RepID=W8GMP7_9MOLU  ali  32  1MNNEIEKIFLLLKKELKEIENLESWKQIKAKYLTKSLFFNNLKNNLKNSKDSEEKIKIGKLIQFYLLNINQILNNKRKDLENSFFSSYQKNPLLEKEISDIIIRGNIHPLTKITLMINKYFDNLNFNYVYGNEIEIDKFNFDYLNIPKDHPAREMQDTFYLENENKLLRTHTTNITARKLLLDKSNLLKYYTTGIVYRNDDNDATHSIQFNQLDFFMLSKSISLANFKYILINLLETIFDKNIPIRFRPSYFPFTEPSFEVDVGCFKCKQNGCEICKNSGWIEILGSGMISHHVLKLVGKDDSNMQGFAAGIGIERLAMLRFNIKDIRNFYLNNLSFLRNY... 345
334 2.000e-43UniRef50_A0A2E8AWM2 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Planctomycetes TaxID=203682 RepID=A0A2E8AWM2_9PLAN  ali  43  28......................DALESARVEFIGKSGRLKATQKLLGKIEKTDKPAAGKRFNEVKTQIQAAYEQQQQQQMANASGGGTGGEQFDPTVPGPRPRLGHLHPITQTIEELKDIMGRLGFSLADGPEIEDEWHNFEALNIPLSHPARDPLDNFYLRYDQALLMRSQTSTVQIRVMENTRPPVRIISLGRVYRPDTPDATHLPMFHQIEGLLVDRQVTMADLKSVLRLFASSYLGADVHVRFRPSFFPFTEPSVEVDMRW------------NDKWIEMGGAGMVDPAVLKAVGYDPDEVTGFAFGLGIERLCARRHGIDDIREIYKNDVRFLHQF... 340
335 3.000e-43UniRef50_A0A288GW11 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=candidate division SR1 TaxID=221235 RepID=A0A288GW11_9BACT  ali  38  5..........ELINNIESARNLQELEESFEVTLGKKGRLSAQYSTLKNLSPEDKKKVGGELAQAKQQLSDTYEAKLDVLKSEYITTQLEQDIVDITTPHPTQHKGSYSLLTYTRRKIEEICQNMGFHIEYGHDMVTKFENFISLNIPLTHPATEMHDTFFLEDRDNYVLRTHTTAMDNDMIKAFGVPCKIIVPSKVYRYEATDASHDTTFYQLEGMVIDKNMSIAHFKDFIQRLLSAILETEITVRMRPGYFPFVEPGFEIDASCPICHGDGCSLCKKTGWIEIMGAGMLHPRVLEQADINPKAYSGFAFGMGINRLVAVKYRIKDIRLFTNGDLRFSRSF... 339
336 3.000e-43UniRef50_A0A2E3JQR6 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Bacteria TaxID=2 RepID=A0A2E3JQR6_9ACTN  ali  40  5...NLDKVIASLKLAIDEVTNVSSISQLKKEYLGPDSIIAKERHNLSQYSDDQKKKIGPMINDATKEMESLLESATQKFELEASKLKEQKEKTDISINWYEAEFGSHHVLTSTMQEVVEIFSNIGFKVESGPEAETSWHNFDALNTPIWHPARYESDTLYLDDKNSTLLRTQTSTVQARHMQKNEPPIFIVVPGRVFRSDQLDATHSPVFHQIEGLAVDEGVTFTDLKGTLEYFAKEFFGKNTKTKFIPHFFPFTEPSAEMLVQW-----------KDDEWLEILGCGMVDPNVFKNVGYK-KHHQGYAFGMGVERLSMIRYGIDHIKNFYDNDLRFLQQFK.. 333
337 3.000e-43UniRef50_A0A0H1S5Z0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Mycoplasmataceae bacterium RC_NB112A TaxID=1524337 RepID=A0A0H1S5Z0_9MOLU  ali  39  11LEKEIIQEREISFQEIEKVTEIEVITKMGKLKKKYLGKEGIIVNFFQFVIKENHLTKKKLLGTLLNQWKKELIGKIEQKIAQLQVKKKDAPPVDIYLEGKKFSVGNLHPITQIIYQIQDVFVSLGYQIVESSEIESEEYNFNKLNMPPEHPARDMHDTFYLNSNKLLLRTHTSNTQIRTMENNPNQELKVITAGKVYRRDEDDVTHTHQFTQLEGFRVGRNISFAHLKGTLELILKELFGNQYPFRFRPSYFPFTEPSVEVDIQCVQCQKKGCGVCKKTGWVEVLGAGLIHPQVLKNCGFNSSKFTGFAFGLGIERLLMIKYGIEDIRHFYLNDLRFLSQFRG. 359
338 3.000e-43UniRef50_A0A2M7QIX7 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Candidatus Roizmanbacteria TaxID=1752723 RepID=A0A2M7QIX7_9BACT  ali  39  1MEIDVTNEKKKAIDFIVNSSSLSELIKTETELLGRNGLINSLLKQLKNIIPEKRKTVGININALKQEVITLINQKKQLLSQKIDD-----KNIDVTMPGTSIKTGTLHPITIAITEISSIFSKLGFIRMSYPEVEWEYLAFDTLNMPKTHPARDDFETTFVNGEPHPTYPHTSSGQIREMWRLKKPPIRMINIGKCYRPNW-DATHTPMFHQFEGLCVDTDINITHLKGALDYFAKEYFGENTQTRLRPHHFQFTEPSFEVDISCTMCQGTGCKICK-SGWLELGGTGMVHPNVLISGGIDPIKYSGWAFGFGIERVIMMKYGVDDIRNYYSGDMRFLSQF... 358
339 5.000e-43UniRef50_A0A1F7V1F8 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Candidatus Uhrbacteria TaxID=1752732 RepID=A0A1F7V1F8_9BACT  ali  41  1MIEDIKKIEREAEAAIGAANAVAALKDARAKYLGRDGALTVILRKLGTLSVEERRRVGPLAQQLKLKLERLCEAQETTLLDTGGSAIDA------TLPPLAPETGHLHPLTQVRWQLEDLFTRMGFIIADGPEVESEWYNFDALNMPSWHPARDMQDTFYVETQKHALSRTHTSPVQIRAMERYGVPLRCIIPGVCFRNEATDARHENSFWQIEGLVIDRDISMAHLNATARTFLKEIFGEKIEARVRPGYFPFTEPSVEYDISCQLCAGKGCPVCKGTGWLEFMGAGLVHPNVLKAGGVDPKKYSGFAFGMGPHRLVMMRSGVNDVRLFRSGDIRFLRQF... 400
340 5.000e-43UniRef50_A0A1Z9BL45 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Rhodothermaceae bacterium TMED105 TaxID=1986665 RepID=A0A1Z9BL45_9BACT  ali  41  1MKQKVDDARQQIEDDV--LDSEEALESFRLTYLSRNGLFSSLFEEFKALPGPEKKEVGKPLNVLXXXXXXXXXXXXXXXXXXXXXXXXXXX--XVTLPVEPSALGSMHPLTLVRHEMTQLFMRMGFTVADGPEIEDDFHNFTALNFPADHPARDMQDTFFVDRSDDLVLRTHTSPVQIRLMKEQKPPIRAIMPGRVFRNEAVTYKSYFQFSQVEGLVVDTFITMADLIHTLVTFAKMMYGDHIEYRVRSSYFPFTEPSIEMDV----------RTSSDADWMEILGAGMVDPNVLRAVNVDPDVYSGFAFGMGIDRICMLKYGFSDIRTLYENDLRMLSQFEHI 337
341 5.000e-43UniRef50_A0A2H0LDW5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_64_10 TaxID=1974  ali  42  25..................APDSQGVEGVRVKFLGRKGALAEQFTRFRDWEPADRARIGKLLNGLKQRLEAALSEASGKQPAAPKTSGPRFDP---TLPGVVPRAGRLHPLTQTIREIIAIFQELGFSAVEGPEAETDHNNFEALNIPADHPSRESFDTYYLAGAQTPDTGHHTSPVQIRYMRTHKPPFQIVVPGRVFRRDAVDATHCFQFHQVEGLAVGPDLSFGDLKGVLEAWARRMFGGRTEIRFRPHYFPFTEPSAEVD------------LKGPRGWLEIMGCGMVHPNVFKAVGL-PPGTAGFAFGMGVERIAMIRHGIQDIRFFFENDLEFLRQF... 348