current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0010 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst MYNTLNNKEDISLVSNNFGFLRLPVHFNPVETDAEWVITGVPFDASVSGRAGTRFGAEAIRRASVNLAWEHCRFPWDFDVRERLKIVDCGDLVYSFGDNQNFVEELEAHATALLKAGKRCLTFGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENGSRYDHGTMFYHAPNEGLIDAAHSVQIGIRTEFDRNLPFTVLSAPQVNEESVAQTVAKIKEVIGDLPVYLTFDIDCLDPAYAPGTGTPVCGGLSTDRALKILRALKDVNIVGMDLVEVSPAYDQSDITALAGATLALEMLYMQGAKKGLast
1 -112.000[E] COG0010 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family  ali  100  1MYNTLNNKEDISLVSNNFGFLRLPVHFNPVETDAEWVITGVPFDASVSGRAGTRFGAEAIRRASVNLAWEHCRFPWDFDVRERLKIVDCGDLVYSFGDNQNFVEELEAHATALLKAGKRCLTFGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENGSRYDHGTMFYHAPNEGLIDAAHSVQIGIRTEFDRNLPFTVLSAPQVNEESVAQTVAKIKEVIGDLPVYLTFDIDCLDPAYAPGTGTPVCGGLSTDRALKILRALKDVNIVGMDLVEVSPAYDQSDITALAGATLALEMLYMQGAKKG 306
2 -91.100[E] KOG2964 Arginase family protein  ali follow..  35  27YEEVEFSSIVEPMYSGIATFGRLENVECLRSEDFDIAFIGMPFDTGTSYRPGARFGPSSLREGSRRINTKYGAVNVPLEIKSWAKLVDCGDIPVTTYDILKAMDQLESAYFQLIAVLPRVLSLGGDHTIVLPILRALHRVYGPISVIHFDSHLDTWAPADGINHGSYFYFASQEGIMSKDANIHAGIRTPIDVDCGFKIIEAREIDDLGIDGIVKKIRDRVGDNLVYLSIDIDVLDPAFAPATGTPETGGWSSREMRAILRGLQGLKFVGADLVEVAPAYDVAEITSLAGAQLLFDIVSMMVKYP. 370
3 -71.900[E] KOG2965 Arginase  ali follow..  25  1..........MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLSGNLHGQPVSFLLRELCISSASIVYIGLRDVDPPEYDIQYFSMRDIDRLGIQKVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQT. 326
4 -7.520[O] COG0265 Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain  ali follow..  12  122.............................................GLNFGSGFIISKDGYILTNTHVVTGMGSIKVLLNDKREYTAKLIGDVALLKIDATEELPVVKIGNPKDLKPGEWVAAIGADNSVTAGIVSAKGRSLPN-PFIQTDVAINPGNSG---------------GPLFNLKGQVVGINSQIYSRSGGFMGISFAIPIDVAMNVAEQLKNTGKVQRGQLGVIIQEVSYGLAQSFGLDKAGGALIAKILP--SPAERAGLRAGDIVDGGEIRSSGDLPVMVGAITPGKEVSLGVWRKG 381
5 -6.380[BQ] COG0123 Deacetylases, including yeast histone deacetylase and acetoin utilization protein  ali follow..  89.........................................................................................GVFDRALLAAGGAIRAAQAVLNKECENAFAMIRPPGHHAMAIMVKWLLKQGFERIAILDWDAHHGDGTQEIFYNDDRVLFISTHQMPLYPGTPEECGTGKGEGYTVNIPL-TGDEGYMMVIDEIIEPVVNEFKPQFIAISAGQDN-DP-----ITSLALTARGYAEMMRRAVAMAEKHCDGRLVAVLEGGYSVEGALPYTNLGIIAAMAG....... 312
6 -6.200[H] COG0190 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase  ali follow..  12  88.............................ADKNIDGILVQLPL-------------PKQI-NAEAIIERIDPKKDVDGFHPYNVGRLCQRIPTLRACTPYGVMKLLETTGIDL--HGKHAVIVGASNIVGRPMSLELLLAGATVTV----THRFTKNLENHVRQADILVVAVGKPNLISGDWIKESA-----------------VIDVGINRVDGKLVG-----------DVEFDKAAEKAAYITPVPGGVGPMTVAMLMSNT........................................... 274
7 -6.000[L] COG1533 DNA repair photolyase  ali follow..  13  113....................................................................................................................................LDKELSKEGYQPRTIAIGTNTDPYQPIEK-------------------RIMREILEVLEARGHPVGIVTKSAL----VTRDIDILSRMAERGLAKVALSVTTLDRMLARTM---EPRASTPTKRLEAIRQLSDAGITSVMVAPIIPGLTDQEMERILDS............... 248
8 -5.900[S] KOG4093 Uncharacterized conserved protein  ali follow..  4.................................................................................................................................................................MHGASLLSRPAEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQLKLTPYDDQIYATFRQD--FPDLHVGRLTDDILKSATAKL----KWRQFAEKFNKLDDYSY--GTLMRADASREFSPDNSIFVFRVQFLAIEIARNREG 140
9 -5.870[R] COG1244 Predicted Fe-S oxidoreductase  ali follow..  37.....................................................................................MCSYPAQAPKKTSQERILSHFLEAVHKIKGKDSIRIFTSGSFF-TRIRIFREISKLDNVYEVVVETRSEIIRE----DWVRELAEMVEDKWFE----VAIGLESANDDIADVSINKGSTFND------FVRASEIIHNAGAKVKTYL----------LKPI---FLSERDAIEDVKFSIEKAEPYTDTFSINLTN.......................... 215
10 -5.830[H] COG0113 Delta-aminolevulinic acid dehydratase  ali follow..  13  10........................................................HRRLRQTAAIRNMVRETKLHIDDLIYPIFVKEGEGVPSMPNVYQLSLDQLDAEVDEIVSLGIPAIILFGEHGIVQQAIRQVKESYPDLTVI-----ADT-CQFTDHGHCGVIE---EGKILNDPSLDLLARTAVSQAKAGADIIAPSNMMDGFVAAIRAGLDSAGFTDVPVMSYAVKYASAFYGPAHSSPVFGDRKTYQM-EALREARSDVEEGADFLIVKPALSYLDIIREVKNETGLPVVAYNVSGE. 278

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.