current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [M] COG2980 Rare lipoprotein B, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTTLGNLast
1 -92.500[M] COG2980 Rare lipoprotein B  ali  100  1MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTTLGN 193
2 -33.400[S] COG5468 Predicted secreted (periplasmic) protein  ali follow..  10  1...MGFVAGALSLAALGGCQVR-GPTGSTSIALAAIEISEADDRVEVRNALVFLTSRGQGEPVNPQYHLALSVSHRTMGVLYE-STDNDHDDDDAGAGRIVVKADYNLTKTGETVKAGNRTAVALVDFPQQEFAKIRAVRD-GENRAAKELAEIIGADLAA................................ 164
3 -14.500[M] COG3056 Uncharacterized lipoprotein  ali follow..  33PNMFKILFPLVALFMLAGCA---LPQQDPSLMGVTVSINGADQRTDLQEVLEKQMTARGYMV-----GPNGPVNLQI---IVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRASYN---VEGAFQASNKNIADAVNSVLTDTIADMSQ.................................... 213
4 -13.300[R] COG3218 ABC-type uncharacterized transport system, auxiliary component  ali follow..  8QKRRALFLAPLFAALMAGCAFDLSADPTALKALDSENIVSDRLPRMVQSKLVEAFEDTGKGVGRPGQGLAIDYQVVSDIRAFE---------IDTARNVANIEISVKLLNDRNGTVKAQEVFRASARVSGSGNANFVKALDQAFAAATREIVAWTLKSL.................................. 201
5 -12.900[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  11  1MRKGCFGLVSLALLLLVGCR---SHPEIPVNDEQSLVMESSLLAAGISAEKPVLSTSDIQPSASSTLYNERQEPVTVIPAHSAVTLYGSANFLGAHKVRLYLYL......................................................................................... 125
6 -12.200[N] COG5567 Predicted small periplasmic lipoprotein  ali follow..  25  1MKNFKTLAVLLTLFSLTGCG---KGPLYFPPA................................................................................................................................................................. 31
7 -11.800[S] COG3126 Uncharacterized protein conserved in bacteria  ali follow..  11  8.ALWQIVGGAALAVSLTGCA-----HQSAEAPVAAPISTATVAASVAQSTVHGTVNIRERVAL----PPDAVVTVTLSDISLADAPSRVIAQKAVRTEGKQAPFTYSLPFNPSDIQPNARVIVSAAITRNGQLLFITDTIQEVINRGAGTQADLLLVPVPSVALEIVPAPAAAT................... 171
8 -9.560[S] COG4380 Uncharacterized protein conserved in bacteria  ali follow..  1MK--PLILGLAAVLALSACQVQKAPDFDYTSKPASILVVPPLNESPVLASTAAPLSEAGYYVFPAAVVEETAADIHAVRPEKLHQIFGNDA-ITVTEYVTTVSAKARLVDRNGKEL---------WSGSASIREGSNNSNSGLLGALVSAVVNQIANSLTDRGYQVSKTAAYNLLSPYSHNGILKGP...... 207
9 -9.130[M] COG1462 Uncharacterized protein involved in formation of curli polymers  ali follow..  11  6KKALLPLLAVATLAGLAGCATETSTALPVQQV-SPIAVGKFDNRSSAKTILITHLQQTNFNVLDRDNMSEIQQEAAIKGQAQRLKGADYVVTGDVTEFG-YAKVALNIVNISTSEVVYSTQGAGEYALSNREVIGDSTLNGKVLDLAMREAVNKLVNAVDS................................ 220
10 -8.550[J] COG2913 Small protein A (tmRNA-binding)  ali follow..  11QRALLAGTAILVSVALAGCT---EGYVLDQQALDSVPV------GSSREQVLLAL---GTPSTTATFDNEVFYYIS----QKRYRAAQFMKPKVIERQILAIYFN-----------DGKVEHIANYGLKDGKLFDFVSRTTPTSGK-DQTFLGQIIQGVSKAPTSLPSAGGS..................... 167

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.