current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [O] COG2999 Glutaredoxin 2, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAILast
1 -101.000[O] COG2999 Glutaredoxin 2  ali  100  1MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFDEFSTPAARQYFIRKKEASSGSFDNHLAHSAGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLRNLTLVAGIHWPTKVADYRDNMAKQTQINLLSSMAI 215
2 -56.900[P] KOG1422 Intracellular Cl- channel CLIC, contains GST domain  ali follow..  12  14IELFSIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPELKDLAPGTNPPFLVY-NKELKTDFIKIEEFLEQTLAPPRYPHL-SPKYKESFDVGCNLFAKFSAYIKNTQKEAN----------KNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAGEPPVRRLFLDGDQLTLADCSLLPKLNIIKVAAKKAEFSGVWRYLHNAYAREEFT....... 226
3 -55.200[O] KOG0406 Glutathione S-transferase  ali follow..  14  5VILLDFWPSPFGVRARIALREKGVEFEYREENLRDKSPLLQMNPVHKKIPVLIHNGKPVCESMNVVQYIDEVWSDKNPILPSDPYQRAQARFWVDFVDTKLFEPADKIWQTK-------------------------EEQETAKKEYIEALKILETELDKPYFGGDTFGFVDIAMTGYYSWFEASEKLPECPTLMASAKRCLQRESVV....... 196
4 -55.000[O] KOG0868 Glutathione S-transferase  ali follow..  15  9LKLYSYWRSSCAHRVRIALALKGLDYEYIPVNLQFDSDFKKINPMGTVPALV-DGDVVINDSFAIIMYLDEKYPEPPLLPR-DLHKRAVNYQAMSIVLSGIQPHQNLAVIRYIEEKINV--------------EEKTAWVNNAITKGFTALEKLLVNCAGKHATGDEIYLADLFLAPQIHGAINR-NMEPYPTLAKCYESYNELPAFQ....... 206
5 -54.000[S] KOG4420 Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1)  ali follow..  47LVLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQEPWFMRLNLGEEVPVII-HRDNIISDYDQIIDYVERTFTGEHVVAEVGSLQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLKKILGELAMVLDQIEAELEELWLCGCAFTLADVLLGATLHRLKFLGEDGSRPNLQSFFERVQRRFAFR....... 312
6 -51.700[O] COG0625 Glutathione S-transferase  ali follow..  18  4ITLWGRNNSTNVKKVLLTLEELELPYEQILAGRNHDADFLAMNPNGLVPLLRDDESDILWESNAIVRYLAAQYGQKRLWID-SPARRAEAEKWMDWANQTLSNAHRGILMGLVRTPPE---------------ERDQAAIDASCKECDALFALLDAELAKKWFSGDEFGVGDIAIAPFIYNLFNVGTWTPRPNLQRWYQQLTERPAVRKVVMIPV 209
7 -38.900[O] COG0435 Predicted glutathione S-transferase  ali follow..  15  55YHLYVSLACPWAHRTLIMRKLKGLEYQHEFLYQLYXHADPHYSGRVTVPVLKKNHTIVSNESAEIIRMFNTAFDALGAKAGDPPALQTKIDELNGWIYDTVNNGVYKA-----------------------GFATSQQAYDEAVEKVFESLARLEQILGHRYLTGNQLTEADIRLWTTLVRFDPVHRISDYLNLYGFLRDIYQMPGIA....... 284
8 -35.100[O] KOG0867 Glutathione S-transferase  ali follow..  13  215IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALQLTDEYKKINRFQKVPAIV-GGDFHLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPM-----------NGIAPKPKPEQIQALIEGVENNLGLLERLWENDFLVGKNLTMADILGSSEINQLSVLN............................. 393
9 -32.300[T] KOG4244 Failed axon connections (fax) protein/glutathione S-transferase-like protein  ali follow..  12  59VYLYQFNLSPFCMKVETWLRMSDITYEIPPCSLS------TRSQEGTLPFVEL-NGKEYYDSSFILRDIDQVIKHTSLDDHLSAEQKATSRAFEAMSEKSLAISACYYRMENVEKMLDQRTYVSALLRRITGSDIGFHSREDIINIGSEDLKAISKYLNKHYFHGFKPTKVDACIFSHLCQIYYAP-DGECKNLAEYVERIKNR........... 289
10 -31.000[O] KOG1695 Glutathione S-transferase  ali follow..  15  4YKLTYFDGRGLAEPARMLFHLGGVPFEDSRIPVDM-ADVKKKAPFGKYPVLKI-DDIEIAQSAAINRYLARQFG----FAGKNPIEEAQADSYIDQCQEYNTSFRACMYATLQGKPEEEVQKIREE-------------YIPAQNKFYEIFSDILNRNKSGFLVGDSLTWADLVIADHLYSLDTMEDAWRCETLKKFQEKIYEHPLLKGY..... 210
11 -28.200[U] KOG3028 Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1  ali follow..  1MELHIWTIDVVSLQFLACSKMCASPVRVIQST--------WRSPSGELPMVAQGEAKPVTDFEKFVDILKKCGQDVVIDADLTTIEKAQLDAFSCYLHHNLYPAVMHTFWTDELNYNTYNLYYLEKRRKKALRLLAGKNDTEILKEAFMALNTLSTKLDNKFFCGNKPTSLDALVFGYLAPLLRVP-LSACPNLVRFVETVSSI........... 229
12 -22.400[O] COG4545 Glutaredoxin-related protein  ali follow..  4PILFYAETCPDTAPFVAELDRLGVDYDEVEIMTSLPNDNSKANGYLGIPALLLPNGDVVLDLSKLKVIF.................................................................................................................................................. 86
13 -21.600[O] KOG2903 Predicted glutathione S-transferase  ali follow..  15  38YWLYVALPCPWAQRTLITRALKGLA-PIIGCSVAHFKTKPDYKGRFTVPVLWDLETCTINESSDIIGIMNSAAFDEFVGEEYRRSLEAQITEFNSWVYDKINNGVYKAGFAE--CAEVYEREVTSLFQYLDKLENLLDKKYT--DLEAEYGKNNKDKILRYFAIGDTLTEADVRLYPTIVRFDVVTIRDDYSRIHTWLKNIYWRHEA........ 328
14 -19.700[O] COG0695 Glutaredoxin and related proteins  ali follow..  15  4VEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAREEMIKRSGRTTVPQIFIDAQHILDARGGLDPLLK................................................................................................................................................. 83
15 -14.500[O] KOG1752 Glutaredoxin and related proteins  ali follow..  16  56VVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEQDALYKMTGERTVPRIFVNGTFILHKEGKLLPLVHQC............................................................................................................................................... 140
16 -12.300[O] COG5494 Predicted thioredoxin/glutaredoxin  ali follow..  14  2IKIVLHHTCKSSYTLFKALKNTP---GVKFEMASQPYFTYLKNYVLSVPAVFKDGELYLLEPDDIKSLIEGRAERELDVDEADHAIRGVMASQAMLTAVMLYKSLRPILDAEIISVISRAKFHGQTAKVPQIIQRIREREEELLKEHWEHLVKL............................................................. 156
17 -10.200[J] KOG1147 Glutamyl-tRNA synthetase  ali follow..  10  3VSVALKAKPIAYGAVACANYVNLSGAGSISVKYEDVALLDKQNKESNVSIQLNGSDSPVFGSKLALQTFSQVYPKLFIGENDRSLVESWVETASALA------------------------------------------GNHNFLELSSLLAQLDDHLIRSLFVGYSLTSADFSIWGALKSAAGAVRTGQYFNLARWYKFMDSQNAVSVTMEEF. 178
18 -9.970[O] COG0278 Glutaredoxin-related protein  ali follow..  12  16ILIYKFPSCGFSARAVEALMHCKVPFGYVDILQHPRAELPAYANWPTFPQLWVDGELVMFQQGELQTLLADV............................................................................................................................................... 102
19 -9.180[P] COG1393 Arsenate reductase and related proteins, glutaredoxin family  ali follow..  12  2IKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLTREELLDILTKTDNGIASIVSSKNRYA-IEDLSVNEVLNLIMETPRILKS...................................................................................................................................... 92

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.