current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [O] COG5187 26S proteasome regulatory complex component, contains PCI domain, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MCSPSATLTHRTMTEKARTVSDLTISQAIFELSSPFLENKSQKALDTLFSAIRDHDLAPLYKYLSENPKTSASIDFDSNFLNSMIKKNEEKLAEFDKAIEDAQELNGEHEILEAMKNKADYYTNICDRERGVQLCDETFERATLTGMKIDVLFSKIRLAYVYADMRVVGQLLEKLKPLIEKGGDWERKNRLKAYQGIYLMSIRNFSGAADLLLDCMSTFSSTELLPYYDVVRYAVISGAISLDRVDVKTKIVDSPEVLAVLPQNESMSSLEACINSLYLCDYSGFFRTLADVEVNHLKCDQFLVAHYRYYVREMRRRAYAQLLESYRALSIDSMAASFGVSVDYIDRDLASFIPDNKLNCVIDRVNGVVFTNRPDEKNRQYQEVVKQGDVLLNKLQKYQATVMRGAFKVLast
1 -122.000[O] COG5187 26S proteasome regulatory complex component, contains PCI domain  ali  100  1MCSPSATLTHRTMTEKARTVSDLTISQAIFELSSPFLENKSQKALDTLFSAIRDHDLAPLYKYLSENPKTSASIDFDSNFLNSMIKKNEEKLAEFDKAIEDAQELNGEHEILEAMKNKADYYTNICDRERGVQLCDETFERATLTGMKIDVLFSKIRLAYVYADMRVVGQLLEKLKPLIEKGGDWERKNRLKAYQGIYLMSIRNFSGAADLLLDCMSTFSSTELLPYYDVVRYAVISGAISLDRVDVKTKIVDSPEVLAVLPQNESMSSLEACINSLYLCDYSGFFRTLADVEVNHLKCDQFLVAHYRYYVREMRRRAYAQLLESYRALSIDSMAASFGVSVDYIDRDLASFIPDNKLNCVIDRVNGVVFTNRPDEKNRQYQEVVKQGDVLLNKLQKYQATVMRGAFKV 409
2 -89.000[O] KOG0687 26S proteasome regulatory complex, subunit RPN7/PSMD6  ali follow..  42  6...........LEEEGLPKNPDLRIAQLRFLLSLPE-HRGDAAVRDELMAAVRDNNMAPYYEALCKSLD----WQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVL---HSLPAVRQYLFSLYECRYSVFF-QSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVI....... 387
3 -81.100[OT] KOG0686 COP9 signalosome, subunit CSN1  ali follow..  17  50VENPSLDLEQYAASYSGLM----RIERLQFIADH--CPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQQAILTKLKCAAGLAELAARKYKQAAKCLLLAFDHCDFPELLSPSNVAIYGGLCALATFDRQELQRNVISSSSFKLFL---ELEPQVRDIIFKFYESKYASCL-KMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMRAAVLRNQIHV 475
4 -75.900[J] KOG2758 Translation initiation factor 3, subunit e (eIF-3e)  ali follow..  13  1..MAEYDLTTRIAHFLDR---HLVFPLLEFLSVKEIYNE--KELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFPKGRDNIIDLFLYQQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMG--NNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKL... 426
5 -72.300[O] KOG1463 26S proteasome regulatory complex, subunit RPN6/PSMD11  ali follow..  2..AAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEQSILELGSLLAKTGQAAELGGLLKYVRPARLVRSLLDLFLDMEAATGQEVELCLESIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALR---YAGRQTEALKCVAQASKNRSLAD-FEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK..... 420
6 -70.700[OT] KOG1464 COP9 signalosome, subunit CSN2  ali follow..  11  31....DLENQYYNSKALKEDDPKAALSSFQKVLEEGEKGEWGFKALKQMIKINFKPEMMNRYKQLLTYIRSAVTRNYSEKSINSISKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANML--MKSGINPFDSQEAKPY---KNDPEILAMTNLVSAYQNNDITE-FEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKL....... 442
7 -69.200[O] COG5159 26S proteasome regulatory complex component  ali follow..  10  59.........................................LELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQS--RGIDAMKAVAEAYNNRSLLD-FNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQL---FEKASV.. 432
8 -51.500[OT] KOG1497 COP9 signalosome, subunit CSN4  ali follow..  13........................RSQLMGLINFTGTHKDQADKYRQLLKTVLTNTGQELIDGLRLFVEAIVNEHVSLVISRQIKLPDDLSKMLSHFTLEKVNPRVIEEQVAGIRFHLANIYERNQQWRDAATVLVGIGQKQYSVECKLGTYLKIARLYLEDNDSVQAELFINRASLLQAETNSEELQVLYKVCYARVLDYRRKFIEAAQRYNELSYRKIVDQRMTALKKALICTVLASAGQQRSRMLATLFKDERCQHL--------PAYGILEKMYLERIIRRSELQEFEALLQDHQKAATSDGSSILDRAVFEHNLLSASKLYNNITFEELGALLDIPAVKAEKIASQMITEGRMNGHIDQISAIVHFENRELLPQWDRQIQSLCYQVNSIIEKISVA........ 398
9 -51.400[O] KOG1498 26S proteasome regulatory complex, subunit RPN5/PSMD12  ali follow..  10  20YSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDLESPATDVFGSTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEM.. 451
10 -44.700[O] COG5071 26S proteasome regulatory complex component  ali follow..  10  10..SEKFAELQKSLNNLNTIDIDANLEKLLIFEKQVRQASDTSTNTKVLIYIADLLFRAGDFQGLNEQLVSLFKKH---TYLPGIDDLKTKINLIETLRTITDGKIYVEVERARLTQLLSQIKEEQGDIKSAQEILCNEPVETFDLKEKVAFILDQVRLFLLRSDYYMASTYTKKINVKFEKEDVQSLKLKYYEQKIRIGLHDDAYLDVCKYYRAVYDTAVVQEDPEKWKEILENVVCFALLTPYDNEQADLLHRINADHKLNSLPLLQQLVKCFIV---PKIAEIYGSALRSNPVFAENDEKGEKRWSELRKRVIEHNIRVVANYYSRIHCSRLGVLLDMSPSETEQFLCDLIAKHHFYAKIDRPAQVISFKKSQNVQEQLNEWGSNITELLGKLEKVRQLIIKEEM.. 433
11 -29.700[OT] KOG2582 COP9 signalosome, subunit CSN3  ali follow..  1MIGAVNSVEAVITSIQGLSGSPEDLSALHLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLYFLEVLTCG----------PVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLRGVGPLLNAVQSSKRLTALHPDVLQLCLQAKSYKSGFSILSDD---IVEIDQPRDFFLYSYYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKCASTAAQ---RSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFEEDKNLG--VKQAVSSLYKRNILRLTQKYLTLSLQDIANMVQLGAKEAEMHVLQMIQDGQIHALINQKDGMVRFLEDPEQYKSSEMI----EIMDSVIQSTWNQVDMEMTVL 394
12 -22.500[O] KOG2581 26S proteasome regulatory complex, subunit RPN3/PSMD3  ali follow..  12  169....................................................................................................................LSYELTNDLAEIRSTLLALHHSATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRF--EAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVASLGFRIQCNKWAIIVRLL-LGEIPERSIFTQKGMEKTLRPYFE--------LTNAVRIGDLELFGKIQEKFAKTFAEDRTHN--IVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYST-NEPQTAFNSRIAFCLNMHNEAVRA.... 448
13 -19.700[O] KOG2908 26S proteasome regulatory complex, subunit RPN9/PSMD13  ali follow..  1........................MTAQDYL---NGKLAAANGPLADDWKNLKELWEKKLWHQLTVLTRSLVK--------KPQFVASTDMHEFYRLFVAEWELRVNPLQLVEICISIAQ--IATKDKQKSMEFLSKIGNVINKDKIEIEARLENKDKNGQIIDLKSIRTQIDSTQHEVDSVGVTEVHAPFYRVSSLYLREVGDFAGYYREALRYLGVEDANNLTTEQK-HAVLLGFAALLGENVHNFGELLAHPILKSLEG--TRERWIVDVLLAFNSGDLTR-FFSLEGDWGGWDD----LKKQKDFLTAKIRLMAVMELATKARSVSFKEIATKCQIPFDEVEFLVMKALSKDLIRGDINQVEQVVYVTWVQPRVPQIMQMATRISAWRNDVNSMEGIVSKEAREI 383
14 -16.200[R] KOG2753 Uncharacterized conserved protein, contains PCI domain  ali follow..  11  17..................................KQLQELRQYLNKHDSVKLDPNGPSETAQNMIEICSTLNV-------LPSWSQDVDLVLNSISSLIVVVPGEKCEPVVDSFIKNVAPQFYKGTGWASAVRVLSNLYKGYSNFHTVEKIFKALVDMCAEARLIGELECNLETLQDRFNTKTPVEGQREILRAVHRALLVDQRVDQAAKVMTALLGTYTEKDAAAARDDAMECVRTAVVDPKSFSFDHLE----RLSAVKALKTSDPLMFTALELFISGTLKD-YKEFVAKNPKFVTEHLKVDE--TILLKKIRLLTLMSLAEEKNEISLDELAKQLDIADETLEEFVIDAIQVNAISGKINEMARTLIVSSYQHRREQWVLLEKRLKVLIANLKQTHNNVHEVNQRI 387
15 -12.300[OT] KOG3250 COP9 signalosome, subunit CSN7  ali follow..  1....................................................................................................................................................................................................MTQDMLLGNEEPSKSKETFLEKFCVLAKSSTGAALLDVIRQALEAPN-----GELLAEPSVLQLKD--GPDSKHFETLNLFAYGTYKEYRAQPEK-----------FIELTPAMQKKLQHLTIVSLAIKAKSIPYALLLSELEINVRHLEDIIIEAIYADIIHGKLFQNTRILEVDYAQGRDGYTGQIVETLQAWVNSCDSVSNCIEMQIKYA 203
16 -12.200[L] COG5600 Transcription-associated recombination protein  ali follow..  130...............................................................................................................................IEECGRTIHRSFTICLNDRNCYMFANLEFSIYHRLSNKDMIKNLVKVLESRVNARDIPPLNKSLAMEH-YYGCLENDHERGFFHLNEALLQCPMLYVESTGKIMILLVPLALLTKRLYPHWDHPVIAGVITRSKRLSQVYPTLVRSVIS-----NLSLYEATAASHE-----RFFLSQGLHVVITLLREVVFTRLVQRKSIMPLKILLATKQHQLDALECRLASAIASGLLRAYLSHSNRCIVFSKKEP................................. 418
17 -12.200[D] KOG2688 Transcription-associated recombination protein - Thp1p  ali follow..  130...............................................................................................................................IEECGRTIHRSFTICLNDRNCYMFANLEFSIYHRLSNKDMIKNLVKVLESRVNARDIPPLNKSLAMEH-YYGCLENDHERGFFHLNEALLQCPMLYVESTGKIMILLVPLALLTKRLYPHWDHPVIAGVITRSKRLSQVYPTLVRSVIS-----NLSLYEATAASHE-----RFFLSQGLHVVITLLREVVFTRLVQRKSIMPLKILLATKQHQLDALECRLASAIASGLLRAYLSHSNRCIVFSKKEP................................. 418
18 -11.600[OT] KOG4414 COP9 signalosome, subunit CSN8  ali follow..  13  8.......................................................................................................................................................................................................ESAFSFKKLLDQCENQ--ELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPP--AIKSANSELGGIWSVGQRIWQRDFPGIYTTI-----NAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQ--------QADSTTRMVLPRKPVAGALDVSFNEQQLARLTDYVAFLEN......... 209
19 -11.300[S] KOG2796 Uncharacterized conserved protein  ali follow..  11  98LDQPDLYYEYYPHVYPGRRGSMVPFSMRILHAELQQYLGNPQESLDRLHKVKTVCSKI------------------------EQGLAEDGGMSSVTQEGRQASIRLWRSRLGRVMYSMANCLLLMKDYVLAVDAYHSVIKY--YPEQEPQLLSGIGRISLQIGDIKTAEKYFQDVEKVTQKLDGLQGKIMVLMNSAFLHLGQNNFAEAHRFFTEILR-------MDPRNAVANNNA-AVCLLYLGKLKDSL--------------------------------RQLEAMVQQDPRHYLHESVLF-NLTTMYELESSRSMQK--------KQALLEAVAGKEGDSFNTQCLKL......................................................... 378
20 -11.100[U] KOG1586 Protein required for fusion of vesicles in vesicular transport, alpha-SNAP  ali follow..  11  1...............................MDNSGKEAEAMALLAEAERKVKNSEACEIYARAANMF--------------KMAKNWSAAGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKK-ADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIA-ELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDTPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGD............................................................................................ 290
21 -9.980[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  4..............................................................................................................................................................................................................................................................................................................YEKEIDELINDYDMLRVLKHFTIAHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDTSIKRTEAKLKKSAEVHKHHTYYQINKKAEAVLKEI.............. 100
22 -9.820[J] KOG1076 Translation initiation factor 3, subunit c (eIF-3c)  ali follow..  12  382..........................................EVMQSMMKLLLANADIIMSESVAEEHEEYATSPF--AAVERLDDEFVKLLKECDPHSNDYVSRLKDENVVKTIELVLQYFERSGTNNERCRIYLRIYAKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMS-HLQDNIDAADPATRI-ANLGLCAFRQGNVKDAHHCLVDLMVTGKPKELLNLELLECVYLVSAMLAAHEFDARRRMISKTFYQQLRSSESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLF-DRVREMLTKFIKEESLRTYLNVYTSISIPSLAQMYELPVPKVHSIISKMIINEELMASLDDPSETVGMHRSEP-SRLQALAMQFVDKVTNLVDVNEKVF....... 840
23 -9.450[V] KOG0624 dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains  ali follow..  20......................................AGTAEEVAKHLELGSQFLARAQFADALTQYHAAIELDPKSYQAIYRRATTYLAMGRGKAAIVDLER-ELKPDFYGARIQRGNILLKQGELEAAEADFNIVLNHDSSNNDVHRQLRHQIKSAYAGGDCATVEEYINHIIEIQVW------DASLYRMRAKCLEERGELKKAIHDMRIVS-KLSTDSTDTMFETSKLLYTVGDLEESLNVIRECLKLNPDHKSCYPFYKKLRKVVKSLESMKKKVENSDWMACLEEGQKTMKFDPTPSVQLNVFRITNRCQREAGHISE----AIAECNEILNDDPSDADILCERHILDEDYDSAIEDYQKATEVNPDHREAKEGLEHAKRLKT-QAGKRDYYKIL....... 384
24 -9.310[JK] KOG3677 RNA polymerase I-associated factor - PAF67  ali follow..  11  199..............................................................................QYRCKTAKKSEEEIDFLRSNPKIWNVHSV--NVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKM-SLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYVGFAYLMMRRYQDAIRVFANILRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFS-KFLSPVVPNYDNVHPNYHKEPFLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLEFQSASEVDFYID--KDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKM........ 560
25 -9.100[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  13  19......................................................................................................................................................................................................................................................................................................................LKKNEIRIYRLLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQSGWLGYIYTPVSPLEILQKIKEHLMKSIEELERDLKNQTRS.... 113

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.