current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] COG5625 Predicted transcription regulator containing HTH domain, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MKQEEMLKKLEDLLKAIGLKKNEIRIYRLLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQSGWLGYIYTPVSPLEILQKIKEHLMKSIEELERDLKNQTRSLast
1 -50.400[K] COG5625 Predicted transcription regulator containing HTH domain  ali  100  1MKQEEMLKKLEDLLKAIGLKKNEIRIYRLLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQSGWLGYIYTPVSPLEILQKIKEHLMKSIEELERDLKNQTRS 113
2 -32.000[K] COG4738 Predicted transcriptional regulator  ali follow..  11  19...GEVEYEMVELLRRLNINRPVALTLACLSKG-DEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKKNHVKLYKLTVQMETIIDTIEENVIAESKTILQNIERLKS. 131
3 -29.300[K] COG1378 Predicted transcriptional regulators  ali follow..  19  17VTFVVTMDEIIEVLKRLGFRDYEARVYATLATR-GEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETI----KSSPAVFRAIDPESVLEEYKEQLVSAVDTAIRSIRESEDF 124
4 -23.200[K] COG3355 Predicted transcriptional regulator  ali follow..  19  19............IAFMYGLSKSDVEVLHILLQ-NGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKEERKGRPVEKERLYRKLEADLEKLAGTVKEALQK.... 119
5 -22.700[K] COG1510 Predicted transcriptional regulators  ali follow..  12  12.AEEHLIEKIAENMHTFGMPSTVGRVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVRKDL-YDVEQ-QTFISLFAANWTKVVSKNKVLYKKLNRE 124
6 -16.300[K] COG1497 Predicted transcriptional regulator  ali follow..  18  1..........MKALRKKG-ELTRFQILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVES---GSGRSHYKITRRGAEKIKEAA-MDLRRYADEVLESMSFYRSV 98
7 -15.900[K] COG1846 Transcriptional regulators  ali follow..  15  25...RRLESTPRTFGRAGALTPSEIHTIDAIGTDEG-LLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPKVSRGIQVVLTDKREAYRAHADMHAAFYEELQQSFTKEEIA 134
8 -15.900[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  21  1..................MKMKTLFLLIKLAKMGATVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRESRKG....................................... 61
9 -15.700[K] COG4189 Predicted transcriptional regulator  ali follow..  16  1MAPNFLLVDAEKEFDVLKAAASLIRVILKLLHEANGLNVNEIAQRLALPQSTVSAGVAVLEEAGLLRTETRKARKGSQKICFATCDELIVSFRKPETPAASNYIAVAMPLGL. 113
10 -15.400[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  16  8...........NILRSLNRSELRRKVLFYLLSIYYRSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQSKNGFKYFKINPEI-VEEVRNMKNMFSD............... 104
11 -15.300[K] COG2345 Predicted transcriptional regulator  ali follow..  21  15...................GDTRRKILLIL-LERAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAANPRQNP...................................... 69
12 -15.100[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  13  1MELSPVFARRLYLAL--------------LVESLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDG........................................ 59
13 -15.000[K] COG1675 Transcription initiation factor IIE, alpha subunit  ali follow..  19  23......................EVGLILFSLGIEGEFTDDQLSLELGIEINEIRKALFALYEIGLADRRRDDETGWMEYYWRINYDKALDVLKRELEKTAKKLREKIEAETST 115
14 -14.600[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  18  1......MSEYEKEIDELINDYDMLRVLKHF-TIAHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDY............................................. 61
15 -14.500[K] COG4742 Predicted transcriptional regulator  ali follow..  15  4...........ELIDVVFRSQKRRDLLLLL--GEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGS-------YELTDMGEQVFKKARALVDVLTLVEK........ 88
16 -14.400[K] COG3432 Predicted transcriptional regulator  ali follow..  16  33...................KRGTMEIMFDILRNEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDR---KIYEITEKGKLLRTHIEEFIKIRENLYSAKEKVSE. 123
17 -14.400[K] COG4190 Predicted transcriptional regulator  ali follow..  14  67..................LTPRVLELIEAI-RQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDGQ........................................ 120
18 -14.300[K] COG1414 Transcriptional regulator  ali follow..  18  1MREPTLETDDRYRAPAL---DKGLDILELLASVDGGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTKLDGDR........................................ 70
19 -14.100[S] COG2469 Uncharacterized conserved protein  ali follow..  15  186.......NFIEKSKPKEKLSEVEEQILTMVYT---GVDSVSVESILGVTTEELNKMYDRLVNLGLARVVKIRKE....................................... 249
20 -13.700[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  14  80.................GLSPIEILILHSIRHRDREKKLADICLALDIDTHIATYAIRKLEKAGLLTTG--KAAKEKTVKITAKGAEACAHYAQIRERLLVDSTANARPSEET 174
21 -13.300[L] COG3415 Transposase and inactivated derivatives  ali follow..  15  9VVKHLPAEELDKRIKKLEKDTRVLQRLYFIRYLYRGMSVEEAAELVGITKATGYTWLKRWNTRGYEGLIPEFGGGRPSKLTKDQKEELKEMLKERDSWTTKEVQELIEA.... 117
22 -13.200[K] COG1777 Predicted transcriptional regulators  ali follow..  19  1.....MIDDIDNFIAAIE-NSTRREIIRMLTQ-FERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFVPS....................................... 67
23 -13.200[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  15  246..................LSPELCEVLDIIRGHKGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLRNGREN...................................... 302
24 -13.100[K] COG0640 Predicted transcriptional regulators  ali follow..  11  1......................................MNEITMQTQADQPKVSSNLAILSEARLVDSIQMGR----EKIYRIAPEKFEDMVD.................... 51
25 -12.800[P] COG0735 Fe2+/Zn2+ uptake regulation proteins  ali follow..  19  1.............MVTPQLTKNQSLVMGALAHSDGPMSAYTILDKLRDNGLQVYRALDKLLEYGLVHRLESLNA....................................... 65
26 -12.700[S] COG4860 Uncharacterized protein conserved in archaea  ali follow..  11  5IKVVNDPGELVSIFHAAD-SEVKRKLLLDLST--GWITLPVIEQKYG---KEGRRALLYLDKIKMIETQWITGQNGPEKAYHTYYTNVQINIMGSLSELADIIYAA....... 104
27 -12.500[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  12  143..................FTPKRAQVVCVLLDAPQDAPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSR-------RRLVRTDELLDLWAAAYPGGLGR........... 221
28 -12.300[K] COG1522 Transcriptional regulators  ali follow..  13  1.............MSKVELDKIDRKI-LEVLQSNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVIR.............................................. 53
29 -11.700[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  11  1MKEYSIFREIINDMDTL----KRHISVINVLLREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPS---REGAILTPDFIEHKEQIIADAEKVLEEATKIAEDVRKM... 103
30 -11.300[K] COG1959 Predicted transcriptional regulator  ali follow..  20  12......................RALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGG...................................... 64
31 -11.300[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  19  183..................LQNATNQRIISEIQNGKCNTNLALAREIGVSRATISWYVKNLKETGLIDE---TRSGRSIIYSINP............................. 245
32 -11.200[K] KOG2593 Transcription initiation factor IIE, alpha subunit  ali follow..  14  11.DNYTPKNNNQKKSAKNGSGGIAVLVLDALTR-RQWVREEDLAKELKLNTKQLRTILRYFEEQQFIMRVHRKEKVHMYSYCCLDYSQIYDVIRYKLHRMKKEFKDVLEDKDNV 135
33 -11.100[K] COG1654 Biotin operon repressor  ali follow..  18  10..........................LISLLADGEFHSGEQLGERLGMSRAAINKHIQTLRDWGVDVFTVPGKG-----YSLPEPIQLLD....................... 68
34 -10.800[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  15  16.........................ILYLITKNQGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKELTEKGAEEAVRIKRKHQVLETLADVLDFDRKEAHREACELEHA 109
35 -10.600[K] COG3888 Predicted transcriptional regulator  ali follow..  16  2....................SLRDVLLRELKRARGLIDQFQIEEMMGFSKSTVSEALKDLEEKGIIKRRTIGGKIKHVWLAEYYPYYDEKLLR.................... 75
36 -10.600[KG] COG1349 Transcriptional regulators of sugar metabolism  ali follow..  11  2..................KPRQRQAAILEHLQKQGKCSVEELAQYFDTTGTTIRKDLVILENAGTVIRT............................................ 52
37 -10.400[L] COG3335 Transposase and inactivated derivatives  ali follow..  11  13..SEDEQTQLAGMVRSRSIPAALVMRARLVLAAAAGEPNSEIAERLQLTRATVGKWRARFLERRINGLYDELRPGKPRTIDDERVAELIKTTLHT.................. 105
38 -10.300[K] COG5340 Predicted transcriptional regulator  ali follow..  21  13.................GLSTRESRLLSHLAAEGHQISIDDVEATLEVAPNTAREIASRLTEKGWLDRLLPG------RYLIIPLA........................... 76
39 -10.200[T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases  ali follow..  24  148.........LDNHLLSIGRRTAIERAAYLIAFLYRPVTQQHVADTLGLSIVHTNKTLRKLVDRGLIR.............................................. 219
40 -10.200[K] COG3682 Predicted transcriptional regulator  ali follow..  15  1................MHITAAEAHVMEAL--RRSPLSADELVAEVSWGEATVKTLINRLLKKKAIKS---ERAEGKHGYRPLVDRS--AYVQAESQGLLDRL.......... 85
41 -10.000[K] COG1733 Predicted transcriptional regulators  ali follow..  16  1MSQHGYKQPLSMAAEVLC-TRWTMVLMRELVA--GSTRFNDLRRGVKMSPTLLSQRLKELELAGIVERKEVPGEKGIFDYRLTEAGRDLRPVVEAMGFW.............. 99
42 -10.000[K] KOG2587 RNA polymerase III (C) subunit  ali follow..  14  384..................YGKEAFRMFRYLSQEGRFVETDKIADAALTEKKDTPQFLLKMWKDGYLHMQKLPGMYTPFLLWKVNKLIVTTQMLDEMYHASLNLSLRLA..... 477
43 -9.990[T] KOG4603 TBP-1 interacting protein  ali follow..  17  10...................AGAAGILLRYLQEQNRPYSSQDVFGNLGLGKAVVVKTLEQLAQQGKIKEKM----GKQKIYFADQDDMVSDADLQVLDGKIVALTAKVQSLQQS 106
44 -9.870[S] COG3756 Uncharacterized protein conserved in bacteria  ali follow..  16  1MSEGGCMNYYERHIGDYYLSVLEHGIYCLLLATEQPIPANKAHRIARAYSKKEKSAVDVVLDEFFLLQ............................................. 77
45 -9.840[R] COG1672 Predicted ATPase (AAA+ superfamily)  ali follow..  23  236.....................EEPRNYFAIMEAAGKTSLGEIMNETGLSRATVAKYLSVLIELDFVKREIASRKSRRGRYYIKDN............................ 304
46 -9.740[K] COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain  ali follow..  14  5...................NELRMISRVAQMYFSEHKRQAEIAQHLNLSQATVSRMLKRAEAEGIVR.............................................. 52
47 -9.570[K] COG2378 Predicted transcriptional regulator  ali follow..  15  27.......................FEIIQILRLARRPVTAQTIADMLEVTARSVYRDIAALQTMRVPIEGERGVG--PLMFSIEETEAIVAELRQAAKKVSDKIAASLPEPLSK 135
48 -9.510[K] KOG3233 RNA polymerase III, subunit C34  ali follow..  10  87.................GSDNQEKLVYQIIEDAGNKIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQ 183
49 -9.440[K] COG5111 DNA-directed RNA polymerase III, subunit C34  ali follow..  10  82.................TMEGDEQIVYSFIKNSGNEIWRKTLTLRTNLHVSVVDRCLKSLESKNLVKSIKSVKNPTRKIYMLYDLVPSTELTGGPWFTDQELDVEFIENLKKV 178
50 -9.330[K] COG1725 Predicted transcriptional regulators  ali follow..  16  36.....................................SVREMGVKLAVNPNTVSRAYQELERAGYIYAKRGMG-----SFVTSDKALFDQLKKELADAITERFLEEAKSIGLD 106
51 -9.290[L] COG3611 Replication initiation/membrane attachment protein  ali follow..  12  9YLKNNRVSQDTSSLVQC-IGQEALSLYLYTISFRKEYLFSSILNHLNFGMDRLIKSLKILSAFNLLTLYQKGDVYQLALHAPLSSQDLEKKIGDVAVEDLKVESADGEEIPVS 138
52 -9.280[R] COG1568 Predicted methyltransferases  ali follow..  17  1.....MKEIVERVKSKTKIPVYERSIENVLSAILASNDIWRIVDLSEEPLPLVVSILEALNELGYVSFE............................................ 64
53 -9.110[O] KOG1498 26S proteasome regulatory complex, subunit RPN5/PSMD12  ali follow..  10  363..........................IRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKE 449
54 -9.110[O] COG5187 26S proteasome regulatory complex component, contains PCI domain  ali follow..  13  311..................VREMRRRAYAQLLESYRALSIDSMAASFGVSVDYIDRDLASFIPDNKLNCVIDRVNGVVFTNRPDEKNRQYQEVVKQGDVLLNKLQKYQATVMRG 405
55 -9.090[K] COG1695 Predicted transcriptional regulators  ali follow..  11  1..................MDRYAIKALVLLSKRTLYQMSKEISTGVQVSHGTLMPMIRKLLQERYID---FETRGREKVY------HLTERGSRFVESLGKIEEDVKQNLISR 88
56 -9.040[DR] COG5124 Protein predicted to be involved in meiotic recombination  ali follow..  13  4..............VKMKSDQKKSILLEIIRGSKSFFKLQELESKKGIVVNTIKEILQQLVDDGLVTAEKVGTSNLYWSFASEGIQKKKLRC-KELMEECERMSQDICRKREY 104
57 -9.040[DR] KOG3433 Protein involved in meiotic recombination/predicted coiled-coil protein  ali follow..  13  4..............VKMKSDQKKSILLEIIRGSKSFFKLQELESKKGIVVNTIKEILQQLVDDGLVTAEKVGTSNLYWSFASEGIQKKKLRC-KELMEECERMSQDICRKREY 104

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.