current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] KOG2105 Predicted metal-dependent hydrolase, contains AlaS domain, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MELAHVEHYAELLKKVSTKRPPPAMDDLDFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDDRGTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSGRGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTNLIFLSGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIAHSLRNSPDWGGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKELast
1 -108.000[R] KOG2105 Predicted metal-dependent hydrolase, contains AlaS domain  ali  100  1MELAHVEHYAELLKKVSTKRPPPAMDDLDFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDDRGTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSGRGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTNLIFLSGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIAHSLRNSPDWGGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE 428
2 -80.100[R] COG2872 Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain  ali follow..  24  1...............MTEVLYFLDCYLREFEAIVEKV----------------TDDKYVVLDRTAFYPESGGQPSDTGKLAEFEVVYVGKFNGDISHEITLGLKAGDRVRGIIDWDRRYRHMRMHTATHVIANVIEKEAGAQITGNQLGLDKSRVDFSLEAFDRDKFAEYEKIANKVITENHPVNLYLVSRKEAEEKLSRLTTLAKGFISEVRLVEIEGITIEACGGTHLKNTGEIKGIKIEKLQNKGKSNRRMYFTLLD........................................................................................................................................................................ 245
3 -61.400[J] COG0013 Alanyl-tRNA synthetase  ali follow..  20  440.VKGGSMGAQNETLSSIEVESEFLYEDKTTQGKLLVSIQDDEIVD------EVSGKAQLVFDVTPFYAEMGGQVADHGVIKDANVLDVQHAPHGQNLETLSPLKVGESYTLEIDKERRAAVVKNHTATHLLHAALHNIVGNHALQAGNEVEFLRFDFHFAQVTKEELAEIERQVNEVIWQSLKVETVETDIATAK-EMGAMALFGEKYGKNVRVVKIGDYSIELCGGTHTQTTSEIGLFKIVKEEGIGSGVRRIIAVTGQKAYEAFKDAENTLNEVATMVKAPTSQVLAKVTSLQDELKTAQKENDALAGKLAASQSDEIFKNVQSLNFIASEVTVPDANGLRNLADIWKQKELSDVLVLVAKIGEKVSLLVASKSSAGNLVKELAPFVDGRGGGKPDMAMAGGSKAAGIPELLAAVAEKLA...... 872
4 -52.500[J] KOG0188 Alanyl-tRNA synthetase  ali follow..  16  476.GVPPTNDTFKYKYEAVSDERDSAYNYGVCNSKIVALRFENQFVNEI----TSGQKAGIVLDKTNFYAESGGQIYDQGALVKEFLVDRVYNRGGYILVVEGTLKVGDELELHIDVERRWLTMKNHSATHALNHCLLQVLGKDTEQKGVVPEKLRFDFSKAAMTIEQVSKTEQLTKEMVYKNVPIYAKESKLALAKKIRGLRSVFDEVYPDPVRVISFGQTSVEFCGGTHLRRSGHIMDFVISSEEAIAKGIRRIVALTGPEALKALKKSEAFEQEIVRLKATIDNDKSGKDDEMRNLLKGLKKTLDDKERALRAAVSVTVVERAKTL-LVEQLEAFNNTKALDAALKQVRSQLPDAAAMFLSVDADSKKIAVEKGLKANEWVQHVSATLGGKGGGKPESAQASGTNYEKVDEIVQLASKFAQSKLS.. 966
5 -9.550[J] KOG1637 Threonyl-tRNA synthetase  ali follow..  10  24............................KYIEERNVFWEKCKAEYEAELAAKKREPIKVTL------PDGKQVDATSWETTPYEVARISKVNGEVWD-LDRVLEGNCTLQLLKFDDPEAQAVFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGISTNDYGAMEGLVKQIVKEKQNFERLEMKKSDLKYNEFKVRILNEKVTTDRTTVYKCGSLIDLCRGPHVRHTGKVKALKITKNSS---------------TYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGR......................................................................................................................... 297
6 -8.980[J] COG0441 Threonyl-tRNA synthetase  ali follow..  13  3................................VITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVD----------------------ACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIG--DNGFYYDVDLDTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEAESYKVSILDENIAHDDKPGLYFHEEY-VDMCRGPHVPNMRFCHHFKLMKTAG---------------AYWRGDSNNKMLQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIGK......................................................................................................................... 249
7 -5.800[J] KOG3502 40S ribosomal protein S28  ali follow..  13  19.......................................................................GRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLTL-LESEREARRLR................................................................................................................................................................................................................................................................................................................. 69
8 -5.590[R] COG0618 Exopolyphosphatase-related proteins  ali follow..  3..........................................................................................................SEILQQIKQYETI-ILHRHVRPD--PDAYGSQMGLAEIIRASFPEKKVYSVGNDEVSLQFLGAVDEIADEVYKDALVIVCDTANQERVSDVRFSSGQKLIKIDHHPNDDAYGDLLW-----TTASSCSEMAFWETFSDELILNETAARLLYAGTGRFLYPSTTEETLRLSAHLVTFP--DRPALYRELYELPKNTVKLSGYILQNFVMDENGAATVYLSDTLLREFEVDPRDASALVSCIENVEG---KAWIMFIQEGPVFRARLRSKGPVINELAKEY------GGGGHPLASGATLHNEEEIKEMTVKLARICAAK.... 311
9 -5.490[M] COG2825 Outer membrane protein  ali follow..  8...........................................................................................................................................................................................................................................ASLGLALAASASVQAADKIAIVNVSSIFQQLPAREAVAKQLENEFKGRATELQGMERDLQTKMQKLQRDGSTMKASDRTKLENEVMKQRETFSTKAQAFEQDNRRRQAEERNKILSRIQDAVKSVATKGDANAVAYADSSKDITADVLKQVK......................................... 165
10 -5.150[L] COG0608 Single-stranded DNA-specific exonuclease  ali follow..  12  107..................................................................FEQGYG-------LSIPVAEMAIEKGVQLLMTVDNGVSSFDGVAFLKEKGIRVLVTDHHLPPETLPPADA-----------VNPNLSQCGFPSKSLAGVGVAYLMLAVRAKFRELGIFTAETQPNFTDLLDLVALGTIADPLDQNNRILAYQGLMR-----ARHCRLGIIALAEVANRNVEQFTSSDLGFCIGPR-LNAAGRLDNMSIGVELLLANEMSKARELALDLDQLNQTRKEIEAGMKLEAIKICQNLTALFKELPYGITLYQPDWHQGVLGIVSSRIKDQYHRPVIAFAQDSEG---ILKGSARSIERIHSQHPNMILKFGGHA--MAAGLSIREEHFADFQHIFNQTVADWLDEE 454

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.