current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [Z] KOG2659 LisH motif-containing protein, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MRPDPTREELQQLVIDHFLHHGYSEVIETFSKEVNIVVPKKDIDNMNARNEVRRLICVGEMESAIEKMTTLCPTILEDDEINFIVRKQHLIEMVRQKLTKEPVEYFRAHLMKNGQRPCDEKMDIIERIFTMLVFNLEDDVEFNVYFQQSEREQTAKEVNSALLAMNGKLKSSRLDLLAKTIAFTGCSQMRSSSPSRKHATIAEFSEEHYSKPYGLAAETSSAFRGEVDLTQDMRLast
1 -85.300[Z] KOG2659 LisH motif-containing protein  ali  100  1MRPDPTREELQQLVIDHFLHHGYSEVIETFSKEVNIVVPKKDIDNMNARNEVRRLICVGEMESAIEKMTTLCPTILEDDEINFIVRKQHLIEMVRQKLTKEPVEYFRAHLMKNGQRPCDEKMDIIERIFTMLVFNLEDDVEFNVYFQQSEREQTAKEVNSALLAMNGKLKSSRLDLLAKTIAFTGCSQMRSSSPSRKHATIAEFSEEHYSKPYGLAAETSSAFRGEVDLTQDMR 234
2 -44.800[S] KOG0396 Uncharacterized conserved protein  ali follow..  13  118...QWKRIRLDRLVIEHLLRMGYYETAEELAAKSDVR-HLTNLDIFQTSREVEDDLASHSTTKCVLWCIDNKSKLRKNSTIEFSLRVQEFIELVRQNQRFEAVKHSRRYFPAYEKTQLNEICHV---MALLAYPADAQAEHYRKYMDPQRWQKLVLDFRQENYRLFQLSSTSVFSAAVQAGLSALKTPHCAQTCRNLNCPVCQEDLNRIALKLPYSHCVQSRLICRVTGLPLNE 346
3 -36.500[O] KOG2817 Predicted E3 ubiquitin ligase  ali follow..  15  97...ESKKREIDTALSLHFFRQGDVELAHLFCKEAGIEEPSESLHVFTLLKSIVQGIRDKDLKLPIEWASQCRGYLERGSSLEYTLQKYRLVSNYLTKDIMAAIRYCRTNMAEFQKKH---LADIQKTMIALFFCSRNEVLSGTNDSLDLDWKSLELLFVREFCAALGMSLESPLDIVVNAGAIALPILLKSSIMKKKHTEWTSQGELPVEIFLPSSYHFHSVFTCPVSKEQATE 350
4 -36.500[R] COG5109 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  15  97...ESKKREIDTALSLHFFRQGDVELAHLFCKEAGIEEPSESLHVFTLLKSIVQGIRDKDLKLPIEWASQCRGYLERGSSLEYTLQKYRLVSNYLTKDIMAAIRYCRTNMAEFQKKH---LADIQKTMIALFFCSRNEVLSGTNDSLDLDWKSLELLFVREFCAALGMSLESPLDIVVNAGAIALPILLKSSIMKKKHTEWTSQGELPVEIFLPSSYHFHSVFTCPVSKEQATE 350
5 -30.200[S] KOG0293 WD40 repeat-containing protein  ali follow..  10  63....IRKSEFVRIITRALYSLGYDKTGAMLEEESGISLHNSTIK------LFLQQVKDGKWDQSVKTLHRIGPDEKAVKAASFLLLEQKFLEFLKVEKIADALRTLRNEMAPLRINTKRVHE--LASSLISPSSFISHTTSTPGKESVNSRSKVLEELQTLLPASVIIPE-KRLECLVENSLHIQRDSCVF---HNTLDSDLSLYSDHQCGKHQIPSQTAQILESHTDEVWFLQ 281
6 -12.800[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  10  8.....QPQDLNRIVLDYLAKKGYSRTEAMLRLEAS---SGVSVEEKLKSIEETPDAYTHTYTILRDWVDSSLELYKELHRILFPIFVHSYLNLLSQDHYEAAKQF----YELFKDDHTDLHDFDVKNLKSLSLPSHVAEDRTAQQYRQNKYQHFSRITFDLLLHFLFENVSNGGSIIIK....................................................... 177
7 -11.100[S] KOG1333 Uncharacterized conserved protein  ali follow..  11  6.......ERTDELVREYLLFRGFTHTLRQLDAEIKAD-KEKGFRVDKIVDQLQQLMQVYDLAALRDYWSYLERRLFSRHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATELQNQAE-------KDWFVLPFLPSPDTNPFATYFSRQWADTFIVSLHNFLSVLFQCMPVPVILNFDAECQRTNQVQEENEVLRQKLFALQA............................... 204
8 -8.560[R] KOG1334 WD40 repeat protein  ali follow..  60LFPYRDKNDHQHLPEGVSNKDFQSGATRKLLLPGVPDQLQQT----SFEMSHQEGSTGGLPDLVTESLFSSPEEQAVTAASSDIEMAATEPSTGDGGDTRDGGFLNDASTENQNTDSESSSEDVELESMGEGLFGYPLPRMCPR--GGTNHDQCLLDEDQALEEWISSETSA.............................................................. 230
9 -7.480[LKR] KOG4594 Sequence-specific single-stranded-DNA-binding protein  ali follow..  27  18.....AREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNIT................................................................................................................................................................................................. 53
10 -7.080[CH] COG4635 Flavodoxin  ali follow..  11  2...........KTLILFSTRDGQTEIASYLASELKELGIQADVANVHRIEEIGASIRYGHYSAFQEFVKKHATRLNSMPSAFYSVQTNSYARKFLMNSQWRPDRCA----GALRYPRYRWYDRFMIKLIMKMSGGETDTRKEVVYTDWEQVANFAREIAHLT........................................................................ 175

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.