current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] KOG3419 Mitochondrial/chloroplast ribosomal protein S16, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MAFTFVFLGSSIGFGPLKTTNWNLLSGYGNIPHQRRPRSRSKWYNPAGLREGVIRLHLRKRINDHVKLDVCQFFLSFSAAKLVLHPSVTAIWSRNVRPLSKPSWSRQPSTDGMSVSAEPAGKNRQADICRRNNFVWTESWRTRIGPETAYWAKEESFANRPFYTIVAAHSKCPRDGLLVEQLGSYDSFPNSHGENLIALNLDRIQHWIGCATHLFLast
1 -127.000[J] KOG3419 Mitochondrial/chloroplast ribosomal protein S16  ali  100  1MAFTFVFLGSSIGFGPLKTTNWNLLSGYGNIPHQRRPRSRSKWYNPAGLREGVIRLHLRKRINDHVKLDVCQFFLSFSAAKLVLHPSVTAIWSRNVRPLSKPSWSRQPSTDGMSVSAEPAGKNRQADICRRNNFVWTESWRTRIGPETAYWAKEESFANRPFYTIVAAHSKCPRDGLLVEQLGSYDSFPNSHGENLIALNLDRIQHWIGCATHLF 215
2 -34.900[J] COG0228 Ribosomal protein S16  ali follow..  24  1.................................................................................................................................................MAVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVA---KPAEVKIDEELALKWLQTGAK.. 65
3 -7.210[K] KOG2652 RNA polymerase II transcription initiation factor TFIIA, large chain  ali follow..  34  432.................DTDN--IVCQYDKI------RSKNKW-----LKDGVMCFGGR----DYV------FAKAIGDAE...................................................................................................................................... 477
4 -7.210[P] KOG4408 Putative Mg2+ and Co2+ transporter CorD  ali follow..  14  306FTYRIRIEMSKDALPQLDSRYWRIVQGPGVVGEF--PTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLVS.............................................................................................................................. 415
5 -6.840[D] KOG1213 Sister chromatid cohesion complex Cohesin, subunit RAD21/SCC1  ali follow..  22  1MFYEHIILAKK---GPLARI-W--LAA-----HWDKKITKAHVFEKLALR-GVVRIYSRK---KYLLADCNEAFVKIKMA....................................................................................................................................... 88
6 -6.750[S] KOG4709 Uncharacterized conserved protein  ali follow..  24  25.........EEIVFDKEKRKEY--LTGF----HKRKVERRKHAQVQLEQQKREERLALRKSLREQRKRELAE............................................................................................................................................... 81
7 -6.700[K] COG5149 Transcription initiation factor IIA, large chain  ali follow..  16  327.......................VLCLYDKVN-----HHKNKW--KCVFRDGVVGVNGKDYLFFKANGEF-EWI............................................................................................................................................. 369
8 -6.660[W] KOG3848 Extracellular protein TEM7, contains PSI domain (tumor endothelial marker in humans)  ali follow..  16  457IVGILILVLIVAT-----AILV-TVYMYHH-PTERRP---SRWVEPVGEKEGF------------IVSEQC................................................................................................................................................ 529
9 -6.600[S] COG4472 Uncharacterized protein conserved in bacteria  ali follow..  22  35............GYNPINQIVGYVLSG-AYVPRYNNARNQIRKYERDEIVEELVRYYLKGQ.......................................................................................................................................................... 84
10 -6.520[S] COG3430 Uncharacterized protein conserved in archaea  ali follow..  19  21...TILLIAITI----LAATPYSLLGGYVSLISAPTPQASMTVTNQQASNDGVYTIYI-SGVNQNISLAKVTLEFQASDGNITVVP................................................................................................................................. 101

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 5 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]