current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] KOG4073 Pterin carbinolamine dehydratase PCBD/dimerization cofactor of HNF1, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MVVRLNEQERAEKLQPLLDAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYNKVDVTLSTHDVGGLSSQDIRMATHLETTANLLKLast
1 -79.100[K] KOG4073 Pterin carbinolamine dehydratase PCBD/dimerization cofactor of HNF1  ali  100  1MVVRLNEQERAEKLQPLLDAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYNKVDVTLSTHDVGGLSSQDIRMATHLETTANLLK 101
2 -63.400[H] COG2154 Pterin-4a-carbinolamine dehydratase  ali follow..  25  16.APHVSDEELPVLLRQIPDWNIEVRDGIMQLEKVYLFKNFKHALAFTNAVGEISEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMAARTDEVAKTAE 115
3 -6.600[C] COG3658 Cytochrome b  ali follow..  15  57.....................WGIWGSDTA-----RFSRFSGIREYMKNGIPEHVQPGHNPLGALMVVALLAAVSFQVGTGLFAAD............... 120
4 -6.510[S] COG5515 Uncharacterized conserved small protein  ali follow..  6FITGPDDSAFCHRVTAALNKGWQLYGS------TYAFNAATGVMHCGQPVVKEVDGVDYTPDIKLG................................... 66
5 -6.290[I] KOG2369 Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase  ali follow..  14  115..........HDMIEMLVGCGYK--KGTTLFGYGYDFRQSNRIDLLILGLKKKLETAYKR-------GGRKVTIISHSMGGLMVSCFMYLHPELVECPSIY 197
6 -5.170[S] COG4012 Uncharacterized protein conserved in archaea  ali follow..  11  93...............................NRVFRFRMFESLLRKNPGIEGFLFHHREIPPEFNRMRDAASSVLDYVRAEVYVVDTVFAAIAGCALQVKE 162
7 -5.070[R] KOG4131 Ngg1-interacting factor 3 protein NIF3L1  ali follow..  10  1....MDLKALLSSLNDFASLSFAESWDNVGLSPPHTVNTLFLTNDLTEEVMEEVLQKKYHPPIFRPMKRINLEYSPH-----TAYDAAPQGVNNWLAKGL. 119
8 -5.070[I] KOG4015 Fatty acid-binding protein FABP  ali follow..  8..........................GRWKLVESENFEDYLKEVGVGLLLRKAACAAK--PTLEIKVNGNKWHVNQLSTFKNTTLEFTLGVEFDE...... 74
9 -5.030[M] COG3774 Mannosyltransferase OCH1 and related enzymes  ali follow..  16  123......PYDSHVKFPAFIWQTWSNDEGPERVQDGFAHEVLNHD----VINALVHHYFYSIPEILETYEALPSIILKIDFGGVADIDTFPVQPIPNWIPE.. 231
10 -5.030[S] COG0327 Uncharacterized conserved protein  ali follow..  14  1....MNALELEQILNHKLNSQAISDYAPNGLQGKKDIKKIITGVTASQALIEYAVSQNHHGYFWKSENPCIRGMKGKRIKTLLVNDINLYG.......... 95

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 5 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]