current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [A] KOG4209 Splicing factor RNPS1, SR protein superfamily, from COG1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MSDNDIIDDDVLNIEDMTGDDADLSAIEGDLNEIEEEQKKLKAIQNEMVGHMNLNTSSQSNSSQSLLTPEEKAEADAKSVYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTEKEGMQNALAMTDSLLRGRQIKVDPKRTNKPGMSTTNRPPFRGRGGRGRGNVIVKYVYAGGFRPRGRGARRRPGFAPYLast
1 -81.900[A] KOG4209 Splicing factor RNPS1, SR protein superfamily  ali  100  1MSDNDIIDDDVLNIEDMTGDDADLSAIEGDLNEIEEEQKKLKAIQNEMVGHMNLNTSSQSNSSQSLLTPEEKAEADAKSVYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTEKEGMQNALAMTDSLLRGRQIKVDPKRTNKPGMSTTNRPPFRGRGGRGRGNVIVKYVYAGGFRPRGRGARRRPGFAPY 205
2 -45.100[R] KOG0130 RNA-binding protein RBM8/Tsunagi (RRM superfamily)  ali follow..  18  10..............AEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKELNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR.................................... 165
3 -44.000[R] KOG0118 FOG: RRM domain  ali follow..  16  90FSKLNPMAEEFVPPSLNKQGGNGVNGGFFTSAGSFFRNNGFAGTGNGGYGRRKKSFGQGKRRMNARTSMAQREDVIRRTVYVSDLDQQVTEEQLAGLFVSCGQVVDCRICGD--PNSVLRFAFIEFTDEEGAMTALNLSGTMLGFYPVKVLPSKTAIAPVNPTFLPRTEDE-----REMCARTIYCTNIDKKVTQSDVKIFFESF 293
4 -43.300[J] KOG0899 Mitochondrial/chloroplast ribosomal protein S19  ali follow..  1......MESRHFATALVFLASKGFVDIL--YWVYRFQASSMAFCTK-------LGGHWKQGVNVPVSSMLGSLRYMSTKLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISMNGQELNGFNISVNVAKDWPSLPLSLDESIEEAEKKENKMMSRSVPFVDAFLMKKKNAALNRKIWSRR 194
5 -43.100[J] KOG0122 Translation initiation factor 3, subunit g (eIF-3g)  ali follow..  15  130GKGGAVLMVCRICHKKGDHWTSKCPYKD--LAAPTDVFIDKPPTGESSTMSAAPGTGKAAYVPRSAVGSDMRRRNDENSVRVTNLSEDTREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAIKLNGYGYDNLILRVEWATPRPT............................................... 294
6 -42.800[K] KOG4210 Nuclear localization sequence binding protein  ali follow..  15  145FIAKTKDNERVAAKNSNAMKNKGFCYMF--FKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKKSCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRNNSSSF............................. 338
7 -42.600[AJ] KOG0148 Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily)  ali follow..  20  27FSQIGPCKNCKMIMDTAGNDPYCF----VEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPS-----SQKKDTSNHFHVFVGDLSPQITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPF 226
8 -42.400[A] KOG0121 Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily)  ali follow..  25  11..........................................................RDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAMRVNGTRLDDRLIRVDWDAGFVEGRQ............................................ 114
9 -41.900[R] COG0724 RNA-binding proteins (RRM domain)  ali follow..  14  170........................................................RAGARDPSSDAYRDSRERDDMCTLKIMQVNENADENSLRELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRLDGRGYMNLILRVEWSKPKVKE.............................................. 274
10 -40.700[A] KOG0108 mRNA cleavage and polyadenylation factor I complex, subunit RNA15  ali follow..  20  2........................................................................SMTAGNVVFVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFDSETTAMAVRLNNSELGPRKIRVEFPSNDPRRNQSYEYTERTDRYMEQQNA........................... 108
11 -39.700[K] KOG0147 Transcriptional coactivator CAPER (RRM superfamily)  ali follow..  17  170FSAVGKVRDVRIISDRNSRRSKGIAYVE--FCEIQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNKGNGGPMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALELNGFELAGRPMRVGHVTERLDGGTD........................................... 332
12 -39.200[A] KOG0124 Polypyrimidine tract-binding protein PUF60 (RRM superfamily)  ali follow..  20  33WKPPQGTDSIKMENGQSTAAKLGLPPLT--PEQQEALQKAKQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARA--------FNRIYVASVHQDLSDDDIKSVFEAF 249
13 -39.100[R] KOG0226 RNA-binding proteins  ali follow..  10  118VLGIPAPATIEGAPALYETPAVNAIPQE--LLRTQALQSDIDKMNFKKQTDPFKKKIKEQQAKKKEDPSLAEWDENDFRVFCGDLGNEVSDELLAKAFRKYPSFQKAKVVRESRTNKSKGYGFVSFRDSEDYVRAMEMDGKYVGNRPIKLRKSAWKERNIDVIKQKRKQKK.................................. 297
14 -38.900[A] KOG0120 Splicing factor U2AF, large subunit (RRM superfamily)  ali follow..  13  17.SRSRDRHRERSRDRRHHRNSRRKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASVVPDTPQTAVPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSTVVPDSPHKIFIGGLPNYLNDDQVKELLLSF 230
15 -38.800[A] KOG4207 Predicted splicing factor, SR protein superfamily  ali follow..  23  1................................................................MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPLEPHTKAPRGFAFVRFHDRSDAQDAEAMDGAVLDERELRVRMARYGRRDLPRSSQEEPRGRSWGGRYG........................... 115
16 -38.500[A] KOG0105 Alternative splicing factor ASF/SF2 (RRM superfamily)  ali follow..  16  1................................................................MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNR---HGLVPFAFVRFEDPRDAEDAIGRNGYDYGQCRLRVEFPRTYGG-----RGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREA 134
17 -37.900[D] KOG2186 Cell growth-regulating nucleolar protein  ali follow..  16  365..................................EDIKQLLVAYSKEELVNLIYKTAEKGSRLISAILESADRDIAQRNIFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEKPGKAGKEQ......................................... 494
18 -37.900[A] KOG0128 RNA-binding protein SART3 (RRM superfamily)  ali follow..  17  613IEGVASIRFARKANSD--LVHRGFAYVV--MENDQKAQQALLKDRVPVKGRPMFISANDPEKR---VGFKFSTTLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHK-DGKPKGIAFVDFDTEASAQKCVSGDKLMLRERELEVALSNPPVKKDKSHGKPAAIGASLEEDGPRKGHA...................... 788
19 -37.300[R] KOG0114 Predicted RNA-binding protein (RRM superfamily)  ali follow..  17  2................................................................NKRNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRV---GNTPETRGTAFVVYEDIFDAKNACDLSGFNVCNRYLVVLYYQSNKAFKRVDMD........................................ 100
20 -37.300[A] KOG0146 RNA-binding protein ETR-3 (RRM superfamily)  ali follow..  16  1........................MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSLHEQKTLPRPIQVKPADSESRGGSSCLRQPPSQ----------DRKLFVGMLNKQQSEDDVRRLFEAF 175
21 -37.000[R] KOG0126 Predicted RNA-binding protein (RRM superfamily)  ali follow..  16  1..........................................MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVNFNGIKIKGRTIRVDHVSNYRAPKDSEEI........................................ 124
22 -36.900[A] KOG0145 RNA-binding protein ELAV/HU (RRM superfamily)  ali follow..  13  66FGSIGEIESCKLVRDKITGQSLGYGFVN--YIDPKDAEKAINTLNGLRLQTKTIKVSYARP---------SSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIGLNGQKPSGATEPITVKFANNPSQKSSQGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPF 320
23 -36.500[AJ] KOG0123 Polyadenylate-binding protein (RRM superfamily)  ali follow..  14  119FSAFGNILSCKVVCDE--NGSKGYAFVH--FETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKER-EAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDP-NGKSKGFGFVSYEKHEDANKAVEMNGKEISGKIIFVGRAQKKVER-QAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDEKLRKEFSPF 317
24 -36.300[AR] KOG1365 RNA-binding protein Fusilli, contains RRM domain  ali follow..  15  197FAGLDIVPGGIALCLSSEGRRNGEVLVQ--FSSQESRDLALKRHRNFLLSRYIEVYKAGLDETGSSTEAMEFVSANAIIVRMRGLPYDCTDAQIRTFFEPLKLTDKILFITRT-DGRPTGDAFVQFETEEDAQQGLLKHRQVIGQRYIELFKSTAAEKRCNLINSSPAVANAVEAPEEKKKDCVRLRGLPYEATVQHIVTFLGDF 408
25 -36.300[A] KOG4205 RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1  ali follow..  15  1..........................MTTTVSTGATAVATLRETSPPVDGHEE-------ARLNADSDDGSHGSQDPGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRTQAKLVTK---------------TKKVFIGGLSATSTLEDMKQYFETY 157
26 -35.900[R] KOG4208 Nucleolar RNA-binding protein NIFK  ali follow..  18  2........................................................................AAFSRSAGPILSLN-PQEDAELQKEVAQCDTVTRFRLSRKKRTGNSKGYAFVEFESEDVAKIVTTMNSYLFGERLLECHFMPPEK................................................ 86
27 -35.900[R] KOG0149 Predicted RNA-binding protein SEB4 (RRM superfamily)  ali follow..  18  1......................................................MAYQPVPGSGFHYLNSPFGDTTFTKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRANCNLASLGRPRPPLPYAV....................................... 112
28 -35.300[R] KOG0110 RNA-binding protein (RRM superfamily)  ali follow..  12  270FKPLKPYS------VRLPSKVHGFCYVG--FKTEKDMAKGMLKNKSFIKGKQVFDAGNAKWKHQQDSLSKEDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNLDGTDFHGRLLHLLPSKDIEKNPKEDLDENDASAFDEPAKKRSNTVILAKNLPAATEISEITPIFSRF 575
29 -35.300[A] KOG4212 RNA-binding protein hnRNP-M  ali follow..  14  1............................MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPANPTKRYRAFITNIPFDVKWQSLKDLVKEVGEVTYVELLMDA-EGKSRGCAVVEFKMEESMKKAAELNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGHALQAGRLGSTVFVANLDYKVGWKKLKEVFSMA 227
30 -33.900[A] KOG0106 Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily)  ali follow..  18  3..............................................................................RVYIGRLPNRASDRDVEHFFRGYGKLSDVIM--------KNGFGFVDFQDQRDADDAVDLNGKELCGERVILEFPRRKVGYNEERSGSGFRGREPTSRPCSTRFRLVIDNLSTRYSWQDIKDHIRKL 135
31 -33.900[R] KOG4454 RNA binding protein (RRM superfamily)  ali follow..  19  2..................................................................EIKPTPSPPEERTIYVANFSEEVDEELLEELFIQAGPVVKVILRDV--RDSNAKFALVEFEDELSVLFAIEMNGVRLFNQELQVKPRNGTNQEELYKRK........................................ 99
32 -33.900[R] KOG0125 Ataxin 2-binding protein (RRM superfamily)  ali follow..  14  40.TEYGVPHTQDYAGQTGEHNLTLYGSTQ--AHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQS--SENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNE--RGSKGFGFVTFENSADADRARELHGTVVEGRKIEVNNATARVMTNKKMVTPYANG................................... 203
33 -33.400[A] KOG0131 Splicing factor 3b, subunit 4  ali follow..  15  45FVQAGPVVNVYVPKDRVTNLHQNYGFIE--YRSEEDADYAIKVLNMIKLHGKPIRVNKASQ--------DKKSLDVGANLFIGNLDPDVDEKLLYDTFSAFGVIASNPIMRDPDTGNSRGFGFISYDSFEASDAAIEMTGQYLSNRQITVSYAYKKDTKGERHGTPAERAATNPTAQKSRPHTLFAMGPPSSAPQVNGLPRPFAN 243
34 -33.100[A] KOG0107 Alternative splicing factor SRp20/9G8 (RRM superfamily)  ali follow..  23  2.............................................................................SRVYVGNLDPRVTERELEDEFRSFGVIRSVWVARR-----PPGYAFLDFEDSRDARDAIEVDGKNGWRVEQSHNRGGGGGRGGGRGGGDGGRGRGGSDLK............................ 97
35 -32.200[A] KOG4206 Spliceosomal protein snRNP-U1A/U2B  ali follow..  12  3......................................................................TADIPPNQSIYIQNLNERIKKEELKRLFSQFGRILDVVALK---TPKLRGQAWVTFSEVTAAGHAVQMQNFPFYDKPMRLQYAKAKSDCLAKAEGTAPSFQPSGQETMPPNNILFIQNLPHETTSMMLQLLFEQY 181
36 -32.000[K] KOG1548 Transcription elongation factor TAT-SF1  ali follow..  16  53............................VSDVTAEATEGKESSNGEDRHTKRLYESTSAEGYPSGSRNKKSKSPVINKAVYIQGLPLDVTVDEIEEVFKKCGVIAKNIDNGTPEDGTPKGDALIVFFRSESVELAEQFDDTEFRYGSGQKMRVQKANIDYKKEKTVNKDVG.................................. 211
37 -32.000[A] KOG0144 RNA-binding protein CUGBP1/BRUNO (RRM superfamily)  ali follow..  15  376........................................................QNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQMNGFQIGMKRLKVQLKRSKNDSKP............................................ 481
38 -31.700[A] KOG4211 Splicing factor hnRNP-F and related RNA-binding proteins  ali follow..  18  31FSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGVHMRGLPYRATENDIYNFFSPL 312
39 -30.100[A] KOG1190 Polypyrimidine tract-binding protein  ali follow..  10  5.......................VPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKG------KNQAFIEMNTEEAANTMVNYTSVTPRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNIIVENLFYPVTLDVLHQIFSKF 207
40 -29.400[A] KOG0533 RRM motif-containing protein  ali follow..  12  54.........................................................KDLDAVQNHGISSRGNDSKVIRVNISNLAPTVISSDLEELFGDYR-LSSVSVNFNE-HGDSLGTGDISLTKRDAERLVQKFSGVALDGKIMKFAVIDSSNMAGRVD.......................................... 157
41 -28.800[R] KOG4733 FOG: RRM domain  ali follow..  12  1MGK--------VWKQQMYPQYATYYYPQ--YLQAKQSLVPAHPMAPP------SPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSLKASGVQAQMAKQQEQDPT--------------------------NLYISNLPLSMDEQELENMLKPF 164
42 -27.900[A] KOG0117 Heterogeneous nuclear ribonucleoprotein R (RRM superfamily)  ali follow..  10  2................ESNHKSGDGLSG--TQKEAALRALVQRTGYSLVQENGQRKYGGPPPGW-----DAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDF-NGNNRGYAFVTFSNKVEAKNAIKLNNYEIRNGRLLGVCASVDN------------------------CRLFVGGIPKTKKREEILSEMKKV 159
43 -27.200[R] KOG1457 RNA binding protein (contains RRM repeats)  ali follow..  11  71.......................................................PNLLQDTVSVLFVHELKTRPGVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTA----RQPVGFVIFDSRAGAEAAKALNGIRFDPQTLRLEFAKANTKMAKSKLMATPNPSN................................. 187
44 -26.700[J] KOG0129 Predicted RNA-binding protein (RRM superfamily)  ali follow..  14  436..........................................................LGSPHCFSHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPPRKTIFVGGVPRPLRAVELAMIMDRY 587
45 -26.700[R] KOG0153 Predicted RNA-binding protein (RRM superfamily)  ali follow..  15  182.............................DKPNEPDDPLCEQNIKDRYYGRNDPVAEKIMKRAASLPTLEPPEDRNITTLYVGNLPEEITEPELRDQFYQFGEIRSIALVPR------QQCAFVQYTKRNAAELAAEFNKLVIQGRKVSIKWAHSQAKQGTAAKT........................................ 313
46 -26.500[A] KOG0115 RNA-binding protein p54nrb (RRM superfamily)  ali follow..  14  42NSNNAARSGGGGGGNR-GGAERGIAPAQ--QPYDNNGGHRSGGGGGRSGGGGTSFNGAAFTESQLMDEVPKKKFTGRCRLFVGNLPNEVKETELKELFSPHGDIAECYLS-------GKGFAFLRLDTRAHAESAKAIDGRIIHGRQVRVRFAVHG-------------------------AAIRVKELSPTVSNEMLYHAFSHF 212
47 -25.300[A] KOG0113 U1 small nuclear ribonucleoprotein (RRM superfamily)  ali follow..  14  57................................KTVETRQERLERRRREKAEQVAYKLEREIALWDPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYHADGKKIDSKRVLVDVERARTVKGWLPRR........................................ 190
48 -25.000[T] KOG0116 RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains  ali follow..  15  231...............................TFNAKASPAKPKSKPVTKPSAARESKAPAPVSEHSSAATIDQQAEGYTIFVANLLMDATPEQLNETFKGFGAITKDGIQVRSYRLKGNCFGFVTFASAEAVKLVLQESAIRIGNRRVSIEEKRGNNDNGRPAMRNGGYRNDNGYRND........................... 380
49 -24.500[K] KOG3152 TBP-binding protein, activator of basal transcription (contains rrm motif)  ali follow..  12  4...............................EESHELTDGISEEKESKETMKSQKADRKKKKLKEKLLKEASKADNRGVCYLSRIPPHMDHVRLRHILAQYGELGRIYLAAGGFRGQRFSEGWVEFAKKSVAKRADMLNGEQIGGKKKS........................................................ 143
50 -24.000[A] KOG4676 Splicing factor, arginine/serine-rich  ali follow..  17  24....................................................................GGGGGGGGTEVIQVTNVSPSASSEQMRTLFGFLGKIDELRLFDDSPLPVSSRVCFVKFHDPDSAVVAQHLTNTVFVDRALIVVPYAE.................................................. 112
51 -23.700[A] KOG4849 mRNA cleavage factor I subunit/CPSF subunit  ali follow..  14  47...............................GGGGGTPSADGAAGPGSGEPGERNSGGPNGVYHQSSGSLTPTMNRRYQLYVGNLTWWTTDQDIANSLRDIGDLQEVKFFENRANGQSKGFSVISLGSESSLRAVLDLPKKEMHGQAPVVTYPSKQA................................................ 175
52 -23.100[R] KOG1995 Conserved Zn-finger protein  ali follow..  20  260.........................................................DAATEKVKQCDADCDDNCDNARIYISNLPPDVTTDELKDLFGGIGQVGRIKIYTDE-KGNYKGDACLAYEDPSAAHSAGGFNNYEMRGNKISVTMAEKSAPRAPTFDQSF...................................... 383
53 -22.200[K] KOG2068 MOT2 transcription factor  ali follow..  14  63...............................EKIVGMTVDQERLASEGNMDRKKIQKSKPKSSDGRKPLTSVRVVQRNLVYIVGLPLNLADEDLKEYFGQYGKVLKVSMSRTQQFPNNTCSVYITYGKEEEAIRCISVHGFILDGKALKACFGTTK................................................. 196
54 -21.600[R] KOG0151 Predicted splicing regulator, contains RRM, SWAP and RPR domains  ali follow..  15  88.VKDQRIRDEERSKEMEKGKTRNIDHFVEELKREQEIRERRNQDRENSRDHNSDNTSSSRFDELPDYFDPDDGDPQTTNLYVVNLSSKVDENFLLRTFGRFGPIASVKIMWPREKRRERHCGFVAFMNRADGEAAKKMQGIIVYEYELKIGWGKV.................................................. 252
55 -21.400[D] KOG4660 Protein Mei2, essential for commitment to meiosis, and related proteins  ali follow..  10  106IDELNFTGLPDELDDLEECDVFCTGGG-MELDVESQDNHAVDASGMQISDRGAANAFVPRKRPNTAGREHPNGEHPSRTLFVRNINSSVEDSELSALFEPFGEIRSLYT-----ACKSRGFVMISYYDIRAAHAAMALQNTLLRKRTLDIHFSIPKENPSEKDMNQG---------------TLVIFNVDTTVSNDELLQLFGAY 293
56 -21.300[A] KOG2202 U2 snRNP splicing factor, small subunit, and related proteins  ali follow..  22  77.....................................................................................HFEDFFEDLFEELGKFGEIESLNICDNL-ADHMIGNVYVQFKEEDQAAAALALQGRFYSGRPIIADFSPVTD................................................ 148
57 -21.100[K] KOG4661 Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B)  ali follow..  11  330.ASSEELAEAPTEAPSPEARDSKEDGRKFDFDACNEVPPAPKESSTSEGADQKMSSPEDDSDTKRLSKEEKGRSSCGRNFWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINLHKTELHGKMISVEKAKNEPVGKKTSDKRDSDGKKEKSSNS........................... 507
58 -19.700[R] KOG0154 RNA-binding protein RBM5 and related proteins, contain G-patch and RRM domains  ali follow..  13  178...............................SSNRHSRRRRSRSYSRERDRNSRRDDRRSNLSNNDRYSDWNPGVPSNKLAILNMPNDVDNTKITLSLGKCGYLVRTMTKFDKNTKQIRTFAFVEFSNRETAEQWMTDYEGWLDGRTLAVEYAKGDPAEISKDQSMELEKLGAHMVGMTPCDTLLIRGLPDGINNSLIFDSLGAL 386
59 -19.500[AR] KOG0109 RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains  ali follow..  14  256............................KRFSVRDKEDQWTVSVQRQLVYRPSTEAGHNNKELP---PPLPPRGACPDDEAVHQKPAPGHRAGDPLSFQAVGKVLECDII--------KNYGFVHIEDKTAAEDTINLHHYKLHGVNINVEASKNKSKA---------------------STKLHVGNISPTCTNQELQAKFEKY 402
60 -18.800[TR] KOG4019 Calcineurin-mediated signaling pathway inhibitor DSCR1  ali follow..  11  2....................................................................EEVDLQDLPSATIACHLDPRVCRAKFESLFRTYDKDITFQYF------KSFKRVRINFSNPFSAADARQLHKTEFLGKEMKLYFAQTLHIGSS............................................ 94
61 -18.800[J] KOG2314 Translation initiation factor 3, subunit b (eIF-3b)  ali follow..  12  2.....................AAVVDIDVLTAQLGINWSDVNLDSIQLPPGNDFGIESDDESVYQDDQSEFDTGFGN-IIVVDHLPFEKLEGVVKKIYNQLGVIKELLMPVDPDTKMTLGYCFIEFNTPQEAQNAKESHGYKLDKSHI......................................................... 136
62 -18.700[R] KOG4198 RNA-binding Ran Zn-finger protein and related proteins  ali follow..  19  226...........................................................TQPINCQADARSFYAERSKIVHVAGLTNDVTQLELESWFTNHGHPVALWTLKTPEPYKSTGTGFVLFASHEDAADALAFNGYCLGDRMLEIIPSSTKVLDKASDILIPFPSSKNRPRPG........................... 345
63 -18.300[A] KOG4213 RNA-binding protein La  ali follow..  14  25FGD-FNLPRDKFLKEQIKLDEIKFNRLNRLTTDFNVIVEALSKSKAEL-SEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTL-HKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDD.................................................. 187
64 -18.200[R] KOG4307 RNA binding protein RBM12/SWAN  ali follow..  13  851........................................................DDSQPSQSELMELIKSIGPRGTVLSCNGFPKDVTLEDVVEFFNDYEPDRNSIRIRRGDDGVMTGECMLACQNQENARRASDLDGQKLRNSVISV....................................................... 945
65 -16.400[A] KOG1996 mRNA splicing factor  ali follow..  14  232.ANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKEAQDASKKSDSNPLTEILKCPTKVVLLRNM--EDLEVETKEECEKYGKVGKCVIFEIPGAPDDEVRIFLEFERVESAIKAVDLNGRYFGGRVVKAC...................................................... 389
66 -15.800[R] KOG2295 C2H2 Zn-finger protein  ali follow..  11  439.EPKGLDSKINTYEEIDNTLKSPEISSNPIKNTDNGDGSKVEEDGEKPSVGKDKVVETETIDLDKVKDGQPRALHRTSSIFLRNLAPSITRSEIEAVCNRFSGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICGLNNQRLRDCEMGAIVNRD.................................................. 593
67 -15.400[A] KOG4008 rRNA processing protein RRP7  ali follow..  14  39......................................................................KKDPSKENSIIVSNIPAFVGEGVVLAIIDQFASFEVEESFVDNSLSQGQLTMSITFDKPEAVIQTLAL................................................................... 112
68 -14.300[R] KOG2135 Proteins containing the RNA recognition motif  ali follow..  14  345........................................................NIRGRGGFARGGFTGAINRDNCTLQVAKIPPENTIAKLNEHFATFGTVDNIQVRYNGEIDS----ALVTYASKFDAGKAYKSPTPVLNNRFIKVFWHNPGGEGSENATGKPSSPTSPPKPVEKPKI....................... 467
69 -12.600[K] COG5175 Transcriptional repressor  ali follow..  15  92................................SPEELKMERAKLARKEKERKHREKERKENEYTNRKHLSGTRVIQKNLVYVVGINPPVPYEEVEKYFGQYGKINKIVVNRKTPHSNNTT-VYITFGSKDDAARCIQVDGTYMDGRLIKAAYGTTK................................................. 233
70 -12.400[R] KOG1855 Predicted RNA-binding protein  ali follow..  12  293FSN-ESILKDAFLLKHVRRNKEGFVSLKLSFKRVRQLTREWKVVGDAVRRKSRKIELNDVGTKVRRIEPSFDETMPSRTIVACDLP-KLTIEKVSDLFSPCGEIALIRILKPGMAIPVKECALVEYLESSSARDARHL................................................................... 448
71 -11.000[O] KOG0111 Cyclophilin-type peptidyl-prolyl cis-trans isomerase  ali follow..  26  3..........................................................................TTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAINMNESELFGRTIRVNLAKPMR................................................ 86
72 -9.440[O] KOG0415 Predicted peptidyl prolyl cis-trans isomerase  ali follow..  18  176..............PRSPSPTYEMLTDQIALDEKEDEDEGKTAEEIAEELQQREMAEQAQILEMVGDLKDADEVPPENVLFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEFDNAKSCEQAFKMDNVLIDDRRIHVDFSQSVSQ............................................... 320
73 -9.100[S] KOG4176 Uncharacterized conserved protein  ali follow..  16  2................................HVEETQQKVNKAKKADKKQRRCLAIIKSDCE-------SPSAEPTPYLAVLNLSNGLTEECLLTAAATGGKVIQVVMLPG------KSYCFFICASLEDSQLIYE.................................................................... 97

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.