current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] COG5625 Predicted transcription regulator containing HTH domain, from COG1018

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MKQEEMLKKLEDLLKAIGLKKNEIRIYRLLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQSGWLGYIYTPVSPLEILQKIKEHLMKSIEELERDLKNQTRSLast
1 -41.300d1sfxa1 a.4.5.50 (A:1-106) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  38  2...SNPLGELVKALEKLSFKPSDVRIYSLLLER-GGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFTD.... 106
2 -26.500d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  18  1MMKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTEGKKIGRKYYYSISSNILEKIRNDLLNCAKRMELAAT..... 109
3 -23.700d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  19  7.AKKLIIELFSELAKIHGLNKSVGAVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIKDIAKRKIAKTYEDLKKLEEKCNEE 121
4 -18.700d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  16  28.......KDWQQWLKPYDLNINEHHILWIAYQ-LNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTEETEVFWSLLEEFDPTRNAVFKGSQPLYH. 132
5 -18.500d4aiha_ a.4.5.28 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}  ali model 3D-neighbors follow..  11  17.......ALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSPIIEQVDGVISSTRKEILGGISSDEIA 123
6 -18.200d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  15.......AELDRRLSHLGLSQARWLVLLHLARHRDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKDVLIADIEAIAASVRNDVLTGIDESEQA 121
7 -18.000d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  31.................PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSERAMHACLDESERALLAAAGPLLTRLAQF 143
8 -17.900d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  25............IKKHLTLSFVEFTILAIITSQNNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQDHAEQLLAQVNQLLADKDHLHLVFE.. 125
9 -17.600d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  20  17.......VEGRKVLRDFGITPAQFDILQKIYF-EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKEEVIEKVIERRENFIEKITSDLGKEKSS 122
10 -17.600d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  11.AREAAMSFFRPSLNQHGLTEQQWRVIRILRQ-QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKQQCFVSMSGDMEKNYQRIQERFGEEKLA 122
11 -17.500d2fa5a_ a.4.5.0 (A:) automated matches {Xanthomonas campestris [TaxId: 339]}  ali model 3D-neighbors follow..  13  32..............DRYGMAIPEWRV-ITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALSPARQVYETVAPLVNEMEQRLMSVFSAEEQQ 130
12 -17.400d2frha2 a.4.5.28 (A:102-224) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  11  25............IKKEFSISFEEFAVLTYISENKKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQRKKIESLLSRVNKRITEANNEIE..... 122
13 -17.300d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  13  18.........SNIEFKELSLTRGQYLYLVRVCENPG-IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKIYATEKGKNVYPIIVRENQHSNQVALQGLSEVEIS 121
14 -17.300d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]}  ali model 3D-neighbors follow..  11  16.......TRFDIFAKKYDLTGTQMTIIDYLSRNKNEVLQRDLESEFSIKSSTATVLLQRMEIKKLLYRKVSGKDSRQKCLKLTKKNKLETIILSYMDSDQSQMTSGLNKEEVV 123
15 -17.200d3e6ma_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}  ali model 3D-neighbors follow..  13  30.......SELNQALASEKLPTPKLRLLSSL-SAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQRKRTVVLTRKKKKLAEISPLINDFHAELVGNVDPDKLQ 135
16 -17.200d3bpva_ a.4.5.0 (A:) automated matches {Methanobacterium thermoautotrophicum [TaxId: 145262]}  ali model 3D-neighbors follow..  14  18.........IGRELGHLNLTDAQVACLLRIHREPG-IKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYLEVTRRGEEIIPLILKVEERWEDLLFRDFTEDERK 121
17 -17.100d3bjaa1 a.4.5.0 (A:1-138) automated matches {Bacillus cereus [TaxId: 222523]}  ali model 3D-neighbors follow..  19.......KNLDKAIEQYDISYVQFGVIQVLAK-SGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKEETKKQVDVQYSDFLKENCGCFTKEEEG 124
18 -17.100d3cjna_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}  ali model 3D-neighbors follow..  16  25.......ANLRKEMTALGLSTAKMRALAILSAKDG-LPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDSDDQRSSRVYLTPARAVYDRLWPHMRASHDRMFQGITPQERQ 130
19 -16.900d5eria1 a.4.5.0 (A:22-168) automated matches {Peptoclostridium difficile [TaxId: 1496]}  ali model 3D-neighbors follow..  16  23.........NDIKYKELKLQKGQFTFLTRICENPG-INLVELSNMLKVDKATTTKAIQKLIKAGYVDKKQDKFDKRGYLTPTDKSLEVYELIIEEENRSIEICFDNFTDEEKQ 126
20 -16.900d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  22.......PEMLESMEKQGVTPAQLFVLASLKK-HGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEDIKFEEVLAGRKAIMARYLSFLTEEEML 127
21 -16.900d3jw4a_ a.4.5.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}  ali model 3D-neighbors follow..  13  17.......TSADARLAELGLNSQQGRMIGYIYENQESIIQKDLAQFFGRRGASITSMLQGLEKKGYIERRIPENNARQKIYVLPKGAALVEEFNNIFLEVEESITKGLTKDEQK 124
22 -16.800d5dd8a_ a.4.5.28 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  15  49.......REIERTYAASGLNAAGWDLLLTLYRSAPPLRPTELSALAAISGPSTSNRIVRLLEKGLIERREDERDRRSASIRLTPQRALVTHLLPAHLATTQRVLAPLSAQEQR 157
23 -16.600d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  19.......SYLPSNEEISDMKTTELYAFLYVAL-FGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKKEIFGEILSNFESLLKSVLEKFSEEDFK 124
24 -16.400d5ffxa_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  14  17.......QKADQKLEQFDITNEQKHTLGYLYAHQQDLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENE 124
25 -16.200d4gxoa1 a.4.5.0 (A:7-141) automated matches {Staphylococcus aureus [TaxId: 426430]}  ali model 3D-neighbors follow..  13.SSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEK-LNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEIEREASDIINNLRNFVSK 134
26 -16.200d3mexa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  17  31..............QRLDLTPPDVHVLKLIDEQRG-LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDELAIHQHAEAIMSRVHDELFAPLTPVEQA 129
27 -16.100d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  14.SSREMTKQYKPLLDKLNITYPQYLALLLLWEHET-LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIGEDLKQLKSALYTLLET 135
28 -16.000d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  16  13.ATFQVKKFFRDTKKKFNLNYEEIYILNHILRESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTKANIQKLISELEEYIKN........... 115
29 -16.000d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  15.IEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQENTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEREKIAERVTLFDQIIKQFNLADQS.... 124
30 -15.900d4hbla1 a.4.5.0 (A:1-145) automated matches {Staphylococcus epidermidis [TaxId: 176279]}  ali model 3D-neighbors follow..  18  19.VSRLFAQFYEKKLKQFGITYSQYLVMLTLWEENP-QTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNQQQQEAVFEAISSCLPQEFDTTEY.... 126
31 -15.800d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]}  ali model 3D-neighbors follow..  13  1.................GIDPAIVEVLLVLENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLF..................... 80
32 -15.800d2bv6a1 a.4.5.28 (A:6-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  14  24...........KVFKKYNLTYPQFLVLTILWDESP-VNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNAQDEVKELNRLLGKVIHA 135
33 -15.200d2heoa_ a.4.5.19 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  10  1...................DNLEQKILQVLSDDGGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSP............................................ 50
34 -15.200d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  21.......RLLNEYLSPLDITAAQFKVLCSI-RCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGAAICEQCHQLVGQDLHQ........... 115
35 -15.000d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  15  5..................LGDLERAVMDHLWSRTEPQTVRQVHEALSARRTTVMAVLQRLAKKNLVLQ---IRDDRAHRYAPVHGRDLVHFVERVGADEADALRRALAELE.. 121
36 -14.900d2htja1 a.4.5.73 (A:1-73) P fimbrial regulatory protein PapI {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  5..........................ILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYWFLKGEKQA.......................... 65
37 -14.500d2lkpa_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  12  13PLDSQAAAQVASTLQALA-TPSRLMILTQLRN--GPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVV---GDRAGRSIVYSLYDTHQLLDEAIYHSEH............... 106
38 -14.400d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]}  ali model 3D-neighbors follow..  7.................EIFSLVKKEVLSL-NTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMV............................................ 57
39 -14.400d1xnpa_ a.4.5.64 (A:) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  28  1.....MGEELNRLLDVLG-NETRRRILFLLTK--RPYFVSELSRELGVGQKAVLEHLRILEEAGLIERVEKIPRGRPRKYYMIK............................. 77
40 -14.100d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  19  13..................LGNPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVV------EITDFGMEEAKRFLSSLKAVIDGLD.. 99
41 -13.900d5nl9a1 a.4.5.0 (A:1-145) automated matches {Leptospira interrogans [TaxId: 267671]}  ali model 3D-neighbors follow..  13  2...KDSYERSKKILEDAGITVQRLQMANLLLSKPQHLTADQVFQLINASRATIFNNLKLFAEKGIVNLLELKSGITLY................................... 83
42 -13.800d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  18  11...........EVIKVML-EDTRRKILKLL--RNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEGNLVEKYYGRTA............................. 82
43 -13.800d4mtea_ a.4.5.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}  ali model 3D-neighbors follow..  11  2.TTQELLAQAEKICAQRNLTPQRLEVLRLMSLQDGAISAYDLLDLLQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFICDRCGAVKEECAEGVEDIMHT 120
44 -13.600d2jsca_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  19  1.........LARLGRALA-DPTRCRILVALLD--GVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVV---ATYEGRQVRYALADSH........................... 71
45 -13.400d4raya1 a.4.5.0 (A:1-134) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}  ali model 3D-neighbors follow..  17  1.....MVSRIEQRCIDKGMTDQRRVIAQVLSDSADHPDVEEVYRRARISIATVYRTVRLFEEESILERHDFGDG--RARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQRE 113
46 -13.300d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  12  7..........................VRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVRISETSEG...................................... 55
47 -13.200d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  20  14..QTVDISGVSQILKAIA-DENRAKITYALCQ-DEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGK----LALYSLGDEHIRQIMMIALAHKKE............ 106
48 -13.200d1qbja_ a.4.5.19 (A:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  4...................QDQEQRILKFLLGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKE............................................ 55
49 -13.100d1oyia_ a.4.5.19 (A:) dsRNA-binding protein E3 (E3L) {Vaccinia virus [TaxId: 10245]}  ali model 3D-neighbors follow..  14  1...................RSNAEIVCEAIKTIGIEATAAQLTRQLNMEKREVNKALYDLQRSAMVYSS............................................ 51
50 -13.100d4etsa_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}  ali model 3D-neighbors follow..  15  3VEYDVLLERFKKILRQGGLTKQREVLLKTLYHSDTHYTPESLYMEINVGIATVYRTLNLLEEAEMVTSISFGSA--GKKYELANKPHHDHMICKNCGKIIEFENPIIERQQAL 122
51 -13.000d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  21  13...........................AAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRG....................................... 59
52 -13.000d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]}  ali model 3D-neighbors follow..  17  4AIAPEVAQSLAEFFAVLA-DPNRLRLLSLLAR--SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGR----HVYYQLQDHHIVALYQNALDHLQE............ 97
53 -12.900d3gw2a_ a.4.5.0 (A:) automated matches {Mycobacterium bovis [TaxId: 233413]}  ali model 3D-neighbors follow..  15  1.RKAALLDQVARVGKALA-NGRRLQILDLLAQ--GERAVEAIATATGMNLTTASANLQALKSGGLVE---ARREGTRQYYRIAGED........................... 79
54 -12.900d1jmrb3 a.4.5.33 (B:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  5....................KKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKR........................................ 57
55 -12.900d2fe3a_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  14  1....HELKEALETLKETGVTPQRHAILEYLVNSMAHPTADDIYKALNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQ.... 112
56 -12.900d4hw0a_ a.4.5.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}  ali model 3D-neighbors follow..  16  1...................KRGTMEIMFDILRNEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDR---KIYEITEKGKLLRTHIEEFIKIRENLYSAKEKVSE. 91
57 -12.700d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  14  6..................FRGWWLASTILLLVAEKPSHGYELAERLAGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQLYLREILRSLEDMKRRIETLEERIKRV 111
58 -12.700d4lmya_ a.4.5.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 198466]}  ali model 3D-neighbors follow..  12  8.QALDAYENVLEHLREKHITETRKAIISYMIQSTEHPSADKIYRDLNMSLATVYNNLKVLVDEGFVSELKISNDLTTY................................... 91
59 -12.600d2xiga_ a.4.5.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}  ali model 3D-neighbors follow..  18  6.TLESILERLRMSIKKNGLSKQREEVVSVLYRSGTHLSPEEITHSINTSISSVYRILNFLEKENFISVLETSKSGR--RYEIAAKEHHDHIICLHCGKIIEFADPEIENRQNE 122
60 -12.500d3pqka_ a.4.5.0 (A:) automated matches {Xylella fastidiosa [TaxId: 2371]}  ali model 3D-neighbors follow..  12  1...EDMEKRANEVANLLKTLSHPVRLMLVCTLVEGEFSVGELEQQIGIGQPTLSQQLGVLRESGIVE---TRRNIKQIFYRLTEAK........................... 80
61 -12.500d2b0la1 a.4.5.66 (A:167-257) GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  23........................HIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKG...................................... 73
62 -12.500d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  14  1...................KKSKLEIIQAILEAKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQ-------YMLTKKGEELLEDIRKFNEMRKNMDQLKEKINS. 87
63 -12.400d4gcva_ a.4.5.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}  ali model 3D-neighbors follow..  19  2........PIARSLERVG----EWWSILIMRDAQGLRRFDEFSRSLDIAPNMLTRRLNALVEAGLLERQPYSQRPLRYQYVPTAKGEDFRVVLMAFVAWGNR........... 92
64 -12.300d1bm9a_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  17.......................LKLYMITMTEQERLYGLKLLEVLRPNHTEVYRSLHELLDDGILKQIKVKKEGQEVVLYQFKDYEAAKLYKKQLKVELDRCKKLIEKALSD 118
65 -12.300d3eyya_ a.4.5.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  16  2.......TDWKSDLRQRGYRLTPQRLVLEAVDTLEHATPDDILGEVGINISTVYRTLELLEELGLVSHAHLGHG--APTYHLADRHHHIHLVCRDCTNVIEADLSVAADFTAK 111
66 -12.200d4k2ea_ a.4.5.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}  ali model 3D-neighbors follow..  20  2...QEMEKNSAKAVVLLKAMANERRLQILCMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRKEAQ----TVFYTLSSTEVKAMIE.................... 87
67 -11.900d3mwma_ a.4.5.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  15  3..................ATRQRAAVSAALQEVEEFRSAQELHDMLAVGLTTVYRTLQSLADAGEVDVLRTAEGESVY................................... 67
68 -11.900d4ggga_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}  ali model 3D-neighbors follow..  18  1....DTLERVTEIFKALG-DYNRIRIMELLSV--SEASVGHISHQLNLSQSNVSHQLKLLKSAHVVKAKRQGQ----SMIYSLDDIHVATMLKQAIHHANHP........... 91
69 -11.600d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  11  3..................IKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHET............................................ 53
70 -11.500d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  2........VENSELRKAGLTLPRVKILQMLDSAEQRMSAEDVYKALDVGLATVYRVLTQFEAAGLVVRHNFDGG--HAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKE 112
71 -11.500d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  1................LDMAEIKEKIC-DYLFNVSDSSALNLAKNIGLTKARINAVLIDMERQGDVYRQ............................................ 53
72 -11.500d1tbxa1 a.4.5.48 (A:3-93) Hypothetical protein F93 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}  ali model 3D-neighbors follow..  11  1...............STPFFYPEAIVLAYLYDNEG-IATYDLYKKVNMSTATFYDAKKFLIQEGFVKER--QERGEKRLYLTEKGKLFAISLKTAIETYKQIKKR........ 91
73 -11.400d4ejoa1 a.4.5.0 (A:1-111) automated matches {Eggerthella lenta [TaxId: 479437]}  ali model 3D-neighbors follow..  14  1MAYDDIVSSMVLELRRGTLV------MLVLSQLREPAYGYALVKSLAIEANTLYPLMRRLESQGLLASEWDNGGSKPRKYYRTTDERVLREVEAQWHVLCDGVGKLLET.... 110
74 -11.400d1on2a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  25  9.......................IEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEK........................................... 55
75 -11.400d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  14  2LREGNLFAEQCPSREVLKHVTSRWGVLILVALRDGTHRFSDLRRKMGVSEKMLAQSLQALEQDGFLNRVSYPVVPPHVEYSLTPLGEQVSDKVAALADWIELNLPQVLAQRE. 114

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.