current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG0006 Xaa-Pro aminopeptidase, from COG1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# E-value Template Links and tools%idFirst MNQNPIKRLQDSLVERALDAFLIEKDEDISYFLQDQARSGVLLITRDEAVLFVSPLDKDLYARIQDVVLVSYSKSVDQELGSYIENTGLKTIGFDSEYTPYGIAQKRMNSGYAFSPQSLVAEKLRCVKSTEEIQKMTRAAEIGSAGYDFVLAALRPGITEKELVRMLHVFWANLGIEKVSFPPIIAFGENAAFPHAIPTNRSLKKGDVVLIDIGVCYEGYCSDMTRTVAFGATPEQQLLDGYVAVAEAQRAAIEFCRAGVPCRDVHKEAVRILRAHGMEKAFIHGLGHGVGREVHEYPRLSPFSDATLQLNMAVTVEPGVYFPGVGGIRIEDTIMIGVNENLNLTNRKVSSEIIIILast
1 0.000e+00UniRef50_A0A2N6DGY3 Uncharacterized protein n=5 Tax=Deferribacteraceae TaxID=191394 RepID=A0A2N6DGY3_9BACT  ali  26  2...QRLHKLRQEMKLKGISNLLVSSLSDIYYLTGFTGSAAYLFVTPENAIFITDGRYTEQSRQVGPDFQVDIVKDYRQAVKELCEGLSGMHV---TYACSLADYEMLEMPGNVLIDSDRLISTLRMEKEEPELEKIRQMFVCAKISFEASLDSFQIGRSELLWASELERYMKINGAKSPSFDTIIASGARGALPHGIASEKLVEPNDSVVVDFGAKKE-YCSDVTRLVMTGEDSDVTL--IADIVYTALAKAKDKVKAGVKCSEIHNVARDYIIEKGYGDFFNHGLGHGLGIDVHEKPVFNPKDNTVLKENMVLTIEPGIYLPGKFGVRLEDTVVVKNDGCENLT........... 339
2 0.000e+00UniRef50_UPI0009D6D5AE aminopeptidase P family protein n=1 Tax=Desulfotomaculum alcoholivorax TaxID=265477 RepID=UPI0009D6D5AE  ali  28  28.YARRRSELFKILAHRGIEQVIVGKPLNIYYFTGIYERFVALLLDSKSCSMILPSLEKEIAS-VKGIPEILHRDDEDPILKLLEVLDGCNTLGVEMDYFDMKLGEKFILPKMKLIDASKLIGNLRIYKDQEEIEKIHTAARYGDQVLGEVRDLIQIGRSEKDIQFALFRAMAKPGVVTDSFVIQVLGGERTANPHGFSGDYVFQKGDAVALDYGVYYDRYWSDYCRTFFIGK-PDPRMETIYKIVLEAQTAAIEKVHPGIPIKEIDLTARQIIEKAGYGEYFIHRTGHGIGLDIHEYPKIHRQNEDILEEGMVFTIEPGIYIPQLGGVRIEDDVVVTKNGAKVLNSYSKEFKDMIL 389
3 0.000e+00UniRef50_A0A1F8JHV7 Uncharacterized protein n=1 Tax=Chlamydiae bacterium RIFCSPHIGHO2_12_FULL_27_8 TaxID=1797601 RepID=A0A1F8JHV7_9BACT  ali  34  1MFENRINQAKKLLKEFSADMLFINDPESIKYLTGLYFSLGRLFISGKSVELVVDGRYFSIAKKLNFLNVTLLEKD---SFKKFIKKNDIKKIGFDSSFITYLDYENIKKSLEKLVPINNPLQNLRLYKDKNEIALIKKSCEINWQGFLHISKLLKEGISEIELALEYEIFVKKHGAEKLSFDPIIAFGKNSAFPHHKTSNTKLKSSDNILIDIGVSYQGYASDMTRVVFL-KEKNKTLEKYYEIIKEASFKAIELCRPNVKLKELDIAARIILKQNNIEHLFVHSLGHGVGLNVHEFPRIKFDNEDKLKDGMVITIEPGLYDESIGGVRYENMILITQDSHEVL............ 345
4 0.000e+00UniRef50_A0A1H3LMR1 Xaa-Pro aminopeptidase n=2 Tax=Tindallia TaxID=69894 RepID=A0A1H3LMR1_9CLOT  ali  29  22...................CLFLSPSVNLNYLTGYDERLVFVLPTKGEGFFVAPKLYEAFITKTPNNVFWSDQEDPFQMLLKEMREIGITRIALENSMAAFMLPIQKKIKDADFRLAGYLFESLRKIKSETEIEKLKNSATVVDNILKKILERDWIGRTEKELAATLEQEMKQHGMEGPSFSPIIATGSNSASPHHKTGTDKILKNQPLLMDLGGLMDGFCSDMSRTVFLGDEPDEFFLEIYEIVLEAQRKGIEAVRPKVSAESIDKVVRDHIISKGYGDYFIHRTGHGIGMEVHESPYIVEGNEEMLEPGMLFSIEPGIYLPGKFGVRIEDIVLVTDTGCQILNQFPK....... 362
5 0.000e+00UniRef50_A0A2N3G7N8 Uncharacterized protein n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G7N8_9ACTN  ali  32  8..................DALVITKAENVRYLSGFTGSSAVAVITGEAATIFTDGRYREQARETANWNVNIVTRDITESIAASLHKRQGA-VGLESSTIAFQQRLIKSLPDSTIEFTSKVVETMRERKDPTEIEAIRLAAGCARRAWENLLPMISPGVSERELAARLDFLMMSAGADKPAFDTIVASGPNSSMPHARITDRRLEQGDLVVIDFGALKDGYCCDVTRTICLGE-PTQLQARVTDVVREASDAAFAILAPGVAAADVDRAARERLEALGFAENFVHGLGHGVGLEAHEKPTLSSLSTDTLEPGMVFTIEPGVYIEGEFGARHEETVLLTENGANILT........... 334
6 0.000e+00UniRef50_R7BNP1 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=R7BNP1_9ACTN  ali  28  1MNNSRIVRIQEKMKQQDIDAVYVRSLSNILWATMFSEPAHALLVLPDRVLLHSDSRYGSAAAKESGIEITIERKQHFDLLLKAVKQSHSLTVGIE-DSISLKEYRVLETRSIRLVELSGFIEELRETKDGEEVQLMKKAQQITDQAFSYIVSYIQPGMTERHIQQELENTMFSLGAEGLAFSSIVASGSRAAMPHSIPGDTAIQVGECIVMDFGAKYRGYCSDMTRTVFVGK-PNERMQKAWEALVEANESCENLIRKGVIASCVHRNAEDVLAKHGFASTMGHSLGHSVGIDIHEVPNLSPLNDRPLEVGNVVTVEPGIYLDDDFGMRLEDFGVVTEDGFEVITQS--THEMVII 376
7 0.000e+00UniRef50_C8WVB7 Peptidase M24 n=6 Tax=Alicyclobacillus TaxID=29330 RepID=C8WVB7_ALIAD  ali  29  4.FEHRRARLANSCSECGWKYAVLTHPANWHYFTGVRERLACLVISDHGAFAIAHEMFAAWVERGVPYELWRDGENAHALLADRLAE--GSRVGVDGGLPAHHLLLMREARLCSFDLADAAIASLRIRKDAREIELLLEASRRADRAVDLVRAHIRPGVSELELADTLARIWREVGSPGMSFPPIVAAGEGGAEPHHEPGARRISPGDVVIVDTGGFCEGYVSDITRTFVLGQPP-AEFAAVYDAVMRANLAAIAAVRPGVKFCEIDRAARGVIEEAGFGAYFTHRTGHGVGLDIHEPPYVDAANDGAVEPGMAFSIEPGVYLPGKFGVRIEDLVIATEDGALVLNRAPKRLEDVML 362
8 0.000e+00UniRef50_J9E2S7 Peptidase M24 n=12 Tax=Alicyclobacillus TaxID=29330 RepID=J9E2S7_9BACL  ali  28  1.................MEAVVLSHPANFYYFTGVWERLSALAVFADGRCFLVHEMFADPAAAGVPVLTWRDGEDPYVLLTSLMADAH-RTIGVDGTLARHLLSWMRVSQGLAFHLGDAMVEKLRVNKDVTELDLLRTASRQADDVVGAVKQHIRPGVSERDIARTLESLWQSVGAEGMSFPAIVATGAHAAEPHHEPGLAAIERGHAVIVDTGGIYRRYCSDITRTFILGE-PSSLLKEVYECVLAANLAGIAAVKPGVTLGEVDHVVRSEIERAGYGSYFTHRTGHGVGLDIHEAPFVVGGNDQVLEPGMVMSIEPGIYLPGQFGVRIEDLVAVTETGVEVLNQAPKALGDVVI 344
9 0.000e+00UniRef50_A0A2V8GAX1 Xaa-Pro dipeptidase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8GAX1_9BACT  ali  32  10...RRHDLVRAEMRRLGIDALLVTHPSNIRYLTGFIGTAGALVITERTCQLLVDFRYVTAAGDIAVVTVHAVDRSYDDAIIARLRESNAQRIGIEAAWLSVKRFNALSAGLASLVPTERIVERLRMIKDAVEVETLREAGRRLSTIARDVADLVRDGRTELEIAADLEAAIRGAGFSKPAFETIVASGPNSALPHARPGPRVLSAGDPVVLDFGGVYDGYCVDLTRTVQLG-APSPALERLYDAVDAAHRAAIKTVRPGVRPSAIDAAARGVLAARGLADAFGHGTGHGLGLEVHEEPRISRETDDPIEPGMVFTIEPGAYVPGVGGVRIEDDVLVVAGGCERLTEAPS....... 378
10 0.000e+00UniRef50_A0A1G2YVN0 Uncharacterized protein n=1 Tax=Planctomycetes bacterium RBG_13_60_9 TaxID=1801963 RepID=A0A1G2YVN0_9BACT  ali  28  5..QQRVRTIRTQFDKNHIDALILTRPANVTYLTGFSGEDSWAIVVRNAVYLLTDSRYVEQAQKECRRTIVVERKDPIAEAAGKLRLKSVKTIGVE-DSISLALYEVLKSAPARLKAVGGIVEGPRSIKDKTELAAIKTSACIAATAFKRVVRHAKPGVSETELAGLLDLEMRRLGA-KNGFETIVAFAANASRPHHHPTXXXLRERDTILIDFGAAYQGYCCDITRSFAFGK-PTAAYRRAHDIVERAQAAAIALARAGVDLVQVDAAARKVIRDSGLPVY-RHGSGHGFGLEIHEIPFLKEDAKGKLQAGQIITIEPGIYIPGKLGVRIEDDILITENGCEILTDDCPRRSLLE. 356
11 0.000e+00UniRef50_A0A1U9NGI5 Putative peptidase n=1 Tax=Phycisphaerae bacterium ST-NAGAB-D1 TaxID=1936003 RepID=A0A1U9NGI5_9BACT  ali  30  1MNEQRLKAVRKQMKEKGFDALVLLCNENLTYMTGFTGHESALVIARSGMTMVTDSRYTEQAGECFACKYYEHAKGLAKGVGEVLARKNIETVGLETSYAAFDLLKKEKATKAKVKPASGLPEAVRRTKNDDEAKNVQRAGKIAFKALEETLGQVRVGITEKELGGLLDFTMRKMGSQ-AGFETIMAFGPNCSRNHHQPGSRKLRKNDTILIDWGARYNSYTSDTTRSLAVGKV-NKQHEKIYYAVLEANLAGIEACKPGASLREVDAACRQVLRKHDV-PVFKHGTGHGLGLEVHEAPSFSPRAKGVLKAGDIVTIEPGCYIAGKMGVRIEDDVLITDKGHKVLTKFSFAKELQVI 367
12 0.000e+00UniRef50_UPI0009FC68B0 aminopeptidase P family protein n=1 Tax=Mariniblastus fucicola TaxID=980251 RepID=UPI0009FC68B0  ali  27  24.FPARRSRLIERLDGA---TLLVSNLVNVRYLTGFTGSNAFLLVRDGMTLLLTDGRYVTQASECPDVEIRSVDSTMLDLLIAALQDHGVSNCLIESDTMTRALWRDLAADNVDFEDSTGIVAQIRAIKDQGELVQIRRSVAINEDAIRATLSKFCSSWTELEFSWQLEREIRERGGEGYSFDPIVAAGPASALPHYHPGSVVISDHSLLLIDWGTSFEGYASDLTRVVAIRSVP-EKLLQIHQIVADAKQAAMETVRDGAELRTVDTAARQLIADAGFAEQFNHGLGHGFGLEIHETPFLSPAYDGQLRSGMVITIEPGIYLPGIGGVRLEDNILVTADGCERLNALPDD...... 373
13 0.000e+00UniRef50_A0A1G3AAT5 Aminopeptidase n=1 Tax=Planctomycetes bacterium RBG_16_64_12 TaxID=1801971 RepID=A0A1G3AAT5_9BACT  ali  29  24....................LLVTNFTNVTYLTGFTGDDSYLLVRQDGDVILSDPRYTTQLGEECPGLDLHIRRTMARSIARVLRRAKIARLGIEGQSMSVALRDQIALKKLALVTTAGLVERLRAIKDKHEIAQLRRAVWYAEKAFGALRATIRPENTEKEVADELEHQLRLFGAVRSGFPSIVAVGPRAALPHATATDRQIGSSDFVLVDWGADGGLYKSDLTRVLVTGRI-SPKLERIYRVVLNAQRKAIAAIRPGVVAHDIDRAARKVISKAGFGRYFGHGLGHGLGLEVHEAPRLGANSRVVLKPGMVVTVEPGIYLPGWGGVRIEDDVLVTRTGHEVLTSVPKGLEEAVV 363
14 0.000e+00UniRef50_A0A174ABB6 Uncharacterized peptidase SA1530 n=12 Tax=Clostridiales TaxID=186802 RepID=A0A174ABB6_CLOVE  ali  29  6..EERLKRVLQEMDKNNLSQMIITETAPIFYLTGVWERLMALYITKGDKKFIVNELFPVDNNLGVEVVYYNDTENPLDLLKGIINNNEV--LGVDKDFAHFLIGLMDRKVAKSFVNSSPIIDKIRMIKDLEEINLMREASRINDLVVEKVITEIKDGISEKFILNRLGELYEENKAEGFSFEPIVAFGENGANPHYETGRCILKKGMGVLIDTGCVKNHYCSDMTRTVFFKEV-TDKQKEIYNIVLEANINAMEKVKPGARFCDIDNAARNTIEKYGYGKYFTHRTGHSIGIEVHDFGDVSAVNSEELRPGMIFSIEPGIYLAKDMGVRIEDLVLVTENGFERLNNL--SKELQVV 360
15 0.000e+00UniRef50_A0A1Q9HJT7 Peptidase M24 n=2 Tax=Vibrio panuliri TaxID=1381081 RepID=A0A1Q9HJT7_9VIBR  ali  32  10..............QQEFDALLVSDTHHKRYLSGFTGSGGYLLLTPSCSELLVAGKYWQQVAEQSCQRFCTDQDRWLNVLQQRLDVHSIERLGFEAHALSYQQVMQLQALSQQLVATDHVVTPSRRWKSAQEIALIRKACEITEAAIEQGLAHFRFGMSERELAAHLEFYARMLGAESIDF-LIVVSGERGALPHGRPSERIIGRNELVTIDFGVVYQGYHSDVTRTFCTGEVA-PQLQQLFDAVYCAQKLGVEMLAPGIAANRVDHTVREYLGALGYGEAFCHGLGHGVGLQGHEYPLLTPDSLATLEVGMVVTVEPGVYLSGLGGARVEDTLVITPSGCESLTKLPR....... 345
16 0.000e+00UniRef50_A0A231RGF5 Uncharacterized protein n=4 Tax=Bacillus TaxID=55087 RepID=A0A231RGF5_9BACI  ali  27  8..KARITNLQEYFRSNELTGGLITSKNNIYYLSGFHERFVGIFIFAEDPIFVLPEMELDSAGWVYDYLSYTDSEDVWDKIRRRLKLSKNGSIAVEESDISLKYIQMVKLPEVDLRNLDNKLSEMRLIKNFDEINSLKIAAKYADYAVHLGINALYEGVTELEVLGEIEYQLKKRGIREMSFTPMVLFGKNASNPHGVTSENKLKAGDTVIFDLGVKYNGYSSDITRTVVY-KKSSDEIEKIYDIVLKANRAALKECKVGNSISKIDEAARKVIDEGGYSQYFPHRIGHGLGIDVHEEPSLHSNNEQLLKAGMVLTIEPGIYLPGVGGVRIEDDIVIMEEGPDLLTEFWRDLQVI.. 370
17 0.000e+00UniRef50_A0A1F6AYG0 Uncharacterized protein n=1 Tax=Candidatus Gottesmanbacteria bacterium RIFCSPLOWO2_01_FULL_46_9 TaxID=1798394 RepID=A0A1F6AYG0_9B  ali  30  5....................LLITTPTNIRYLTGFTEREAYCLLAQNDLYLFTNALYIESAIKQNKIQILEIRENPFAELSRVLKSLGVNKLGFEENSLTVLEYNKLELKGITLIPTQNRVEEMRMIKRDDEIASIKKAAQITDQCYDFILKKIQPGVTESDIAWEIESFFRKHGAT-TAFSPIVAFGKNSSQPHYNPTKKPLKNNDVILLDFGARVNGYCADMTRVVFIGKPKDEWIR-AYHSVLEAQKKALLAMKVSISGAALDRAARKHIEDASFSPY-PHSLGHGVGLDIHESPRLSVKNDELLTPGMVCTVEPGVYVEGQYGIRIEDLVFLRNDGIEILSKSNKD...... 377
18 0.000e+00UniRef50_A0A2S6SSY1 Putative peptidase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2S6SSY1_9PROT  ali  25  1MTNKKINKLQAALIDENLDLLAIVPGSNFLYLTGFHERPTILLISKNKPIAILPVLEVDSFNKLADIIEWQDSDGYQSAFNKAYEKLPIKKIGIEGQRMRVFESQAIAFKNIEIINAHKFINKIRLNKDEAEINNLQKAVNIAETSLKETIKFVEEGKTEIEIKNFLIQQLYRYGAEGIAFDPIVLASDNSALPHGHSKDYKIRNGDCLLFDFGATVNGYHSDITRTFFV-KSVSDEQKNIYEAVLRANQIGIEISKPGLTLHELDDTVLKSLADSNYRELIVHKTGHGLGLDVHEDPYVMRKNHDVLEEGMVITIEPGLYKKGSLGVRIEDDVVITKSGCKSLTT--FPKQLTII 365
19 0.000e+00UniRef50_A0A291CWY8 Aminopeptidase n=2 Tax=Enterobacteriaceae TaxID=543 RepID=A0A291CWY8_9ENTR  ali  29  7........LREWLTAQHLDAVLLSSRQNKQPHLGLSSSSGFVFVSHKSAHILVDSRYYTDVERGYQIHLLDATQTLYSCINHIIDDEKLSAVGFEGEQVSWETANRWSDKHARLVSAVPDV--LRQVKTAQEITCIREACRVADLSAEHIRRFIQPGLSEREIAAELEWFMRRQGAEKASFDTIVASGWRGALPHGKASDKRVEAGEFITLDFGAQCQGYCSDMTRTFWISDAGAAEESSVYQTVLAAQRAAVAAIRPGRPCHEVDAAARQVIADAGYGDCFGHNTGHAIGIEVHENPRFSPTDTTELMAGMLLTVEPGIYLPGLGGVRIEDVVLVTPDGSEVLYNMPKTL..... 354
20 0.000e+00UniRef50_A0A0D1LIR3 Dipeptidase n=19 Tax=Lactobacillales TaxID=186826 RepID=A0A0D1LIR3_9LACT  ali  29  3...DKLAKIQNWLNENQLDVAYFSDFHSISYLTGFEERVLALVVPQDEPFIFAPALEVEAVKGAGWTHPVQDHEQPYQLIAQHLHAHHATTWAVEKGQMTLDRAAALQTPDAKFVDLSPVMVEMHLIKTPDEIAKMHKAGDDADRAFEFAFAAMQAGVSELQVMAKLEYDLKSAGVVGMSFETLVQFGAHAAEPHGDTGSTLLQRGDLALFDLGTIYEGYVSDATRTVAF-QTVSDHQRDVYNVVLEAQLAAQSQAKPGMTAGELDAIARDIITKAGYGEYFVHRLGHGIGSSVHESIQIATGNELVLQPGMAFSIEPGIYIPGDLGIRIEDSVVMTETGADSFTHS--SKELRII 365
21 0.000e+00UniRef50_UPI000D6D3996 aminopeptidase P family protein n=1 Tax=Oceanotoga teriensis TaxID=515440 RepID=UPI000D6D3996  ali  28  1.....MEKLLKAMNENKVSQILLTSPYHIKYFTGKMERFLGALITKEGKCIFLNKLFSVEEVEGFNVHIYEDKNDPVNLICEFIEKNNI--LYVDNELKSFLVKIIEKLKNIEIKLGNYLIDNLRVIKDSDEINLMRESSNINDLAMEDMIKLVPEMLPEKLLARAVEANLMKHGASGNSFTPLIAYGKNAAEPHHDSDKTPLKSGVNVLIDMGGVYKGYCSDMTRTVFFGD-PGQKAKDIYNIVLEANLKAIEMVKPGMKFSEIDAAARDFITKKGYGDFFTHRTGHNIGIEVHEWPDVNENIDILLKPGMIFSIEPGIYLKNILGVRIEDLVLVTENGVEVLNKY--DKDLLII 352
22 0.000e+00UniRef50_A0A162M749 Putative dipeptidase PepE n=16 Tax=Bacteria TaxID=2 RepID=A0A162M749_9FIRM  ali  24  4..KEKLQKAIKMMEQEGLDVLCIGPSPDLEYLTGLDERFKALFLLKNGLYFISPEICVEESKEALGDEVWGDSEGFLKAIEKAKEEFGLNKVGVNGGIRAVDVIDISRVLNVIFLNATRLMEELRIIKTKDEVEKLKKAAAVADEVAEKVAGFIKPGMTEKDIKEMVEKMLLEFGGEELAFETIVASGPNSSKPHYNEYSRRIQEKDVIILDFGCRVGGFCSDISRTYFVGE-PTEEQRKIYDIVLKANKKGEEAVREGVTAEEVDRAARNVIKEAGYGEFFFNRVGHGIGFGVHEAPYIMEGNKTVLKSGMAFSVEPGIYIPGKFGMRVEDIVVVTEKGCEVLNKA--TKDMIII 365
23 0.000e+00UniRef50_A0A2W5IG13 Peptidase M24 family protein n=1 Tax=Lawsonella clevelandensis TaxID=1528099 RepID=A0A2W5IG13_9ACTN  ali  28  7.YLSRRNQLRENIQSGNIDAVLIFGLSSIRYFSGFSGSNALLWIDGSDAVLITDGRYTTQARGECPGLTIDIQSSGSAALCATAAERGLHTLGVDGEFLNWLDYQEIAAWLAQLVDISPQIAQLRAVKDSAEIVALDKAARCAEAALCDLIDELAPGVTENEVAARLDYLMKIHGSECVSFETIVGTGANGALPHHSPDGTQISAGDLVVIDFGAVVDGYHSDCTHTFCIGD-PQPWQKEISDIVWQAHQAAVAAVVPGITAGSIDDAARAIITDAGYRECFGHSTGHGVGIDIHEHPWVRTGSQESIVPGTVFTVEPGIYLPDRGGVRIENTYVLEEDGNVR-SLQAFSAELLLV 387
24 0.000e+00UniRef50_A0A1G1J560 Uncharacterized protein n=1 Tax=Omnitrophica bacterium RBG_13_46_9 TaxID=1801818 RepID=A0A1G1J560_9BACT  ali  29  8...ERIDRAKFLLKKSGLDALLISGEANILYLTGFSGKDSFLVLNANGNFFLADSRIYDEAKKVDCANMLRITKSSFSLMADTLVRSKIRKLGFESQYVTYFLHKKLAFNKMKLLPTEGVIEQLRAVKSRNELSSIKKSSSVTKKIFQKIQKLVHPGVSETEIAKEIDIMIKMSGGSS-SFDTIVATGKHSSWPHATPSKRKLGSNDIMLMDFGARIAQYCSDFTRVIFTGAAK-KRFDMMHEVVAKAQNKALESMKPGLI---IDSVVRRVIEEAGFGKFILHGLGHGIGLEIHELPWLSAKSNFPIKKNMVFTIEPGIYVPGVGGVRIEDTVYMGDDGPEVLTR.......... 354
25 0.000e+00UniRef50_F7UWU3 Uncharacterized protein n=33 Tax=Bacteria TaxID=2 RepID=F7UWU3_EEGSY  ali  28  5.YKQRVETVMHNLKQRGLSHLLVCDPRSIQYLTGAYERFLGLVLAEDEPTLVLNELFTVPDTSACAVRLYSDTDDPLALVATLCDADQP--LGCDKNAARFLLPLMERDAATKFQLASDAVDDARARKDAAERAAMRAASRTNDAAMGRFRELVHEGVTEAEVAGQLEEIYRELGAQGHSFTPIVSFGANAADPHHEPDATRLVAGDVVLFDVGCRQDEYCADMTRTFFFGE-PTERQREVYETVRRANEAARTLVAPGVRFCDLDRAAREVIEEAGFGPFFTHRLGHQIGLDVHEPGDVSATHDAPVQPGMCFSIEPGIYLPGEFGVRIEDLVLVTEDGCEVLNSYP--RELTVI 360
26 0.000e+00UniRef50_A0A0G1T943 Aminopeptidase P n=1 Tax=Candidatus Peregrinibacteria bacterium GW2011_GWA2_47_7 TaxID=1619058 RepID=A0A0G1T943_9BACT  ali  30  2................................SNFSGSNGSLFVTQKAAYLLTDFRYILEARSIVPISVIDYGRKGFEKIKDLLKKHRVKRIGYEADALTCRQYKKITSKSIFYTDLGDAVSALRMQKESVELAHITRAQNITDNIFSALKKKVRGGMSEKEIAWLIEELARAFGADDISFEPIVAFNEHSAEPHHHCTDRKLKKGNLILLDFGVRYKGYCSDMTRMLF-SKKPTKKERRVYETVLHAQESARAQLRAGVHGDAIDTTARDIIDRAGFKGRFGHSLGHGVGLDVHELPNLSAYYKGIIPEKSVVTIEPGIYLDGEFGVRIEDMDVVEKNGTRVLTRSPTRIE.... 325
27 0.000e+00UniRef50_A0A1Z9D8R0 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1Z9D8R0_9ACTO  ali  31  4.HHQRRSRLRDALSAXSGGVFVTRDLASVRYLTGFSGSNATVVIGTDEVHLVTDGRYREQAAHESPDVVAIIDRDVVGAMRGLCTGCEIDL----DDRTPVGIAQQLTEAGLTVRAVADPVAPLRMVKDAQELDALSRAGHITARALEQVADTITVGDREADVARRLEAAFAEWGAEDRAFATIVAGGENSALPHHRAGDRQLAVGDLLVIDCGAKVEGYHADMTRTFXVGAAPDEWQHEIHSLVLRAQEAARDALAPEVIAGDIDAAARELITQAGFGEAFAHGTGHGVGLDIHEQPMLSARSSAVLPEHAVVTVEPGIYLPGRGGVRIEDTVVV-AHAPQVLTDLER....... 346
28 0.000e+00UniRef50_A0A136LB45 Putative M24B family peptidase n=1 Tax=Chloroflexi bacterium OLB15 TaxID=1617416 RepID=A0A136LB45_9CHLR  ali  28  5.FQQRLNAVRAI---SGVDAVAIMPGTSMRYFSGLSERPIILFVLPDKLGLVVPKLETIQKRDDLNVELWDDDEWFTPAFNRAIDALGLKTLGIDSLTMRASEVLGLQAPTLKLKPVDEALLRIRAIKTADEISLMRRAAQASEAALSDLLKIVQPGMTEEEIAAKLDELQFAHGGEALAFSTLIQTGENSSNPHGETTDRALRRNEFLLIDFGCQVGGYHSDITRTFVIGNI-SPEMQKIYDTVKLANAAAFATVAPGVPASAVDKAARDVITEAGYGQYFTHRTGHGLGMDGQRFPQISSSAHYPLEVGMTFTIEPGIYVPGLGGVRLEDNVLVTETGAESLTTFPK....... 361
29 0.000e+00UniRef50_UPI0009856CF4 aminopeptidase P family protein n=1 Tax=Mobilibacterium timonense TaxID=1871012 RepID=UPI0009856CF4  ali  28  1MSNERIERVIEKMKKKGLTQLLVSDPFSIRFLTGVNERLYALILTNGKHTFLLNYLFFVQ---DTGFEEV-WFGDTVDQIKIILDNIDTKTLGIDKTWARFLIPLMEACPELKVVWGSDCVDDVRAEKDPEEIALMKKASEINDSVMLKVRDFIKEGMTEKEVAEFIDNEYLKAGAEGVSFDTIVCFGENAADQHHMPSERKLAAGECILIDMGCKYKGYCSDMTRTYYC-KSADPEQTFAHDIVRESVERAEALCKPGTPICDIDKAARDLMDEHGYLKYWTNRTGHFIGQEDHEYGDVSPLNKKPAVPGMIFSIEPGVYIPGKYGVRVEDLVLITEDGHEILNHVEKKWEIV.. 357
30 0.000e+00UniRef50_A0A0F4LUG2 Xaa-Pro dipeptidase n=2 Tax=Lactobacillus TaxID=1578 RepID=A0A0F4LUG2_9LACO  ali  32  1MNS--LDKIRQEMRAVAVDTLLISRPANLSYLLDFADYEGLMIITLNEQYLYTDGRFFAQIQAAPQFQIVDMKEHP---LADFLKSCAVHKLMIEPDFLNVTTFRQLEHQSWSVVDSSNLVEKIRMVKTPAEIAKVQAAAQIADQVFDHILKYLQPGQTELAIATEMEHYGKKLGATATSFPTIVASGVHSAMPHATATNKVLAAHELVVLDYGFVYQGYDSDITRTVALGSV-DPQLQQIYQIVLEAQTAIIKQLHLNQPLAEIDKFAHDYIAKRGFGPEFMHGTGHSVGRECHEYPTMNAQSIETLPAQMTFTIEPGIYLPNHGGVRIEDDLYLTSGQVHFLTNAK--RELIVL 350
31 0.000e+00UniRef50_A0A1S6IP37 Xaa-Pro dipeptidase n=11 Tax=Carnobacteriaceae TaxID=186828 RepID=A0A1S6IP37_9LACT  ali  27  1MSEQ-MEQIIERMKSDGIDIAFFNDPQTVEYLVGFHERILALILFQDAPILFTPALDQEDAKDGIDVYSYLDTENPWQSIKNLIKSLPTTNWAIEKEQLTVAEALQSQFPNSQFKDYSKLLHTIRMQKTSAELEKMKKAGFWADEAIKIGARALKVGITESEVVAEIEYQLKKRGVDQMSFSTMVLFGENAASPHGVPGPNKLKEDQFVLFDLGVIYEGYASDTTRTLFFGDQPTSEQKDVYQTVLNAHDTAMDQAKINMTASELDTIARRIINQKGYGPYFNHRLGHGIGQSVHEFPSIMEGNQLPLIDSMCFSIEPGIYIPGNIGVRIEDCGYLDDSGFHSFTFFPTTID.... 364
32 0.000e+00UniRef50_A0A212KUR4 Xaa-Pro dipeptidase n=1 Tax=Chlamydiales bacterium SCGC AG-110-P3 TaxID=1871323 RepID=A0A212KUR4_9CHLA  ali  33  2...ERIKKLQATLKSHGVDGLIIDDTTDLYYLTGLSLSLGRLLVTQRLARLFVDGRYYETATKQAPCPVTL---SPPTTLFDALEKTKISSLGFDAAITTVQDLSALRKSPVTLKPLTAPVAPLRMYKDASELRILRKAARLGNSGFEHVKTLLKEGVTEAEVAAKLEIFWLQQGGQSLAFEPIIAFGANSSKPHYSPGKTRLRLGQPILVDIGVTVDHYHSDMTRVLFYG-TPKPIMKRVYHAVLEAQTAALALCRPGTSIADLDKTAREVLATHDLGDKFTHSLGHGIGLQVHEQPGIRQTRKQRLAPGMVITIEPGAYLPNVGGVRIEDTVIITEQGHQNLTSP--SKALTVL 361
33 0.000e+00UniRef50_A0A1V6GYH1 Putative peptidase n=1 Tax=Thermotogae bacterium ADurb.Bin062 TaxID=1852923 RepID=A0A1V6GYH1_9BACT  ali  31  1MKEERVDKLLASMAESSVDAVLIANEENLRYFSNFTGSTGYLLISRDKQMIFTDSRYWEQTLAQSPLTLEKIKERTRPFVARFFQ--NYKRIGFEAKALTVDFFEALLPPDVEWIPVDGMISEIRCSKSVLEKNKIVEANKIAIDAFKKVIGELKVGMTEKEVAIALEFQMLKLGGEDKSFGTIVASGWRSALPHGAASDKKIEKGEFIVFDFGCFLGGYCSDITRTIALGK-PSDEMLEVYDIVKKAQNSAERAAKAGMSGKDIDTIARDIITNEGYGEYFGHGLGHGIGLEVHEEPRVSQINTNALPVGAVVTIEPGIYLPNRFGVRIENDIFLGLETTEVLTVFPT--DLIIV 362
34 0.000e+00UniRef50_A0A117L5V6 Xaa-Pro aminopeptidase n=1 Tax=Acetothermia bacterium 64_32 TaxID=1635286 RepID=A0A117L5V6_9BACT  ali  30  3.YAGRLEVVSGWLEERGLDLLLLMDRANTRYLTGFRLASSCLVVPRKGPVYVVAQLDLERARRDCWLEEVEDVPDHMAVLAPFLS--GARRVGVERGLFSLELAERLAKGEVEFVDAGGFLLELRARKSPKELELLREAAAIADRVMAEVRKHVRPGVREQELVGWVEYLTRRFGAEGPSFEAFFMSGENAWLPQRVATEKALAEGELALLDMGAVYQGYCSDLTRTFAVGE-PAKRQRELFQVAREAQAAALAAIRPGVRAHEVDQAAREVIERAGWGEYFPHITGHGVGLAIHELPILDRSSDYELSPGMVMTVEPGIYLPGVGAARVEDMVVVTEDGCQVLTSSPRDL..... 360
35 0.000e+00UniRef50_A0A0F9NC31 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9NC31_9ZZZZ  ali  27  19..EHRVAALGQKIKKEKIEAFLIKGTENVSYLSHYWI-EGEVLLSSRDKFFITTSLFAEEAKRLNGWQIVIQKDSLEKTISEICKKLRGKRVGFEASHFSFAEYERLKIREVEWVPFSGLIENQRAIKDGGELTCIEEALKVTRAAFAYLENELETGVTEKDISRKAVYFLREN-ADEEAFPPIVLFGERTSLPHGKPSQKKLEKGELVLLDLGARVGGYCSDLTRTIFLAGIK-EKWRQIHHLIVKAQEEVIKKLKPGISCSDIDKMIREKIKEAGYGKNFIHGSGHGVGLAVHELPSITSRSKDILKAGMVLTLEPGIYLEGEGGVRVEEMIVVSEEGGRVLN........... 360
36 0.000e+00UniRef50_A0A073IRV2 Peptidase M24 n=3 Tax=Synergistaceae TaxID=649777 RepID=A0A073IRV2_9BACT  ali  26  4..KERLARLAEELKNRGLDALYIGPSADLEYIGEFRERVRGLMVGSDGRCFLTPLLYREEMMDAPFYSMWDDHEGFAGAFKRGCEHLGVGKVAFNDGVRAVDLFAMLEAVDIQPANGQDLLANMRSRKDGEELDRLRRAGAIIDGVVEKLYTFIKPGMKERDVIRAIPDFIEELGGEGESFAPIVASGPNGSMPHYGGDRRVIEEHDSVILDLGCRYKSYCSDTTRTFFVGE-PTREMREVYEIVRRAQAAGEAAVKPGVTAEEVDRAARRVIVDAGYGKYFFNRVGHGVGIAVHETPFIIEGNKKPLEPGNVFSVEPGIYIPGKFGVRIENLVAVKPDGAEALN--KTTREMRII 366
37 0.000e+00UniRef50_A0A2E8EGQ8 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon TaxID=2026714 RepID=A0A2E8EGQ8_9ARCH  ali  31  2....RTERVSKSLESEGLDAYIVTREPNIFYLTG-SNSGGILIIAPDHPILLTPRLNLYLAQDSALGCCIESYERKEKEVKEKLNQIKTEKIGFDELSLIEYQMIKKKLGSVVLKENQDLIWAMRKVKDLSEQKFMKRAGALSDLGMEAIQEFLTEGVREHEVAASAASAIRMEGANDISFPFIVASGPRSAYPHAGVSGRKIKRGDFVTIDMGATYKKYCSDITRTFIIG-SPSEKQRTIYENVLEANTAAFPEIKEGARGIDVDRIARDIITTAGHGEDFFHSLGHGVGLEVHEPPSLSKSSGDTLTIGNVVSNEPGIYMNGFGGVRIEDTVLVTSSGPERLTNFDSDLD.... 350
38 0.000e+00UniRef50_A0A1F2QXB7 Uncharacterized protein n=4 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2QXB7_9BACT  ali  30  36.HRARLDRAQVLLGAHGLAALLVGPGSSLRYFTGLSERLFGLVLTRGDPIWITPAFEEDRAREQADVRAWDEDESPYALVARALRERGVATVGIEETMFAFSNGVAREAPALSLASGTPVTAGCRMTKDPHELQLMRRACEITVRAHRAVLASLKEGTTVAQATAWSEAAHRRLGAPGGA---LVLFGPDAAFPHGTTKPRPLGIGDVVLIDGGGNVHGYTSDITRTAVFGAPPTDRQRRIWDLVRRAQEAAFRAARPGVECQAVDAAARQVLEDAGFGPYLTHRLGHGIGLDGHEWPYIVRGNAIRLVPGMTFTDEPGIYVPGELGIRHEDTVVVTESGCENL............ 390
39 0.000e+00UniRef50_A0A1V5KLW5 Putative peptidase n=1 Tax=Firmicutes bacterium ADurb.Bin467 TaxID=1852894 RepID=A0A1V5KLW5_9FIRM  ali  30  2...SRLERFLDALRARGLFAALIHRRENIRYLTGYTG-EGCLFVSENVRAILTDFRYVEQAGQAPGFECVRTGKSVEALVAELFRRSDADKLAVETNVLSYDDHQALSRGDDRLAPLARIPEELRAVKDENEVASILKAASIACRAFSNILGRIRVGMTEMDVKIALNYEMLALGSEGEAFDTIACAGENGSLPHAVAGRRVLKSGELLTLDFGATVDGYRSDMTRTVGIGHI-GKDLRALYEAVLEAQLLALPAVKPGAVCEDVDRIARDFLE-ARYPGAFGHALGHGVGLFIHEQPRLGAGDRTALRPGHVVTVEPGAYIPGLGGCRIEDMAILTPDGF--INPIDAPKQLIEL 355
40 0.000e+00UniRef50_A0A2R7Y1N3 Uncharacterized protein n=1 Tax=Aigarchaeota archaeon NZ13_MG1 TaxID=1980982 RepID=A0A2R7Y1N3_9ARCH  ali  31  2...DRIKRLIDLMDEKAFSAYLLTSSENLYYFTGFKGDGVAIVMSDGTVKLYTLPLYYESALHAIQGVDVIKTKTQDMFKEELTEELGVGDVGFDYMDAETFWGMTSKLRFLHLIPSPDIVWKLRSIKDEKELENISKAAAISDVGMEVASDLISPGVTELDVKAELTEELLRCGADRVAFDIIVASGSKSSLPHGGPGNRQIQNGDVVVIDLGASVNEYSADITRTFFVGNKVPEKVEKVYRLVEEAKNLAEEHMMAWVSASSVDRVARQFIENAGFGEYFIHSLGHGIGLSVHEPPRISPNSKDLLAENMVVTCEPGVYIPKQFGIRLEDTLLIKKDGVVRLSKAPF....... 350
41 0.000e+00UniRef50_A0A101E7J4 Xaa-Pro aminopeptidase n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A101E7J4_9FIRM  ali  27  16.YNDRIKRIRELMRERNVECLFAAPPSNIFYLTGLDERLQLAVLLQEGPFLIMPEMYKEVASDGFCLLTWSDHQNPMELVLRACGSIR-GCAAVDPKWAGHLLILMETLKGCTFVNGGEILGRARSIKDEEELRLLKRAGELVDEVMVEVVREINVGMTERELADFIERKIKEKGAEDVSFKPIVASGPNSSMPHHIPGNRKIEKGDFVVLDFGAVLEGYFSDITRTFFMGKAGNEE-RKIYRVVMEANEAGYRAAACGAFCGDVDRAAREVIERAGYGQFFIHRTGHGIGLECHEEPYIVEGSYIPLEKGMVFSVEPGIYIPQK............................... 346
42 0.000e+00UniRef50_A0A1M4SMZ3 Xaa-Pro dipeptidase n=4 Tax=Lactonifactor TaxID=420345 RepID=A0A1M4SMZ3_9CLOT  ali  26  5..KARQQKACELLREQGFDKAIIGDPMSINYLTGISERYYGLVMDAETVTMVNPSVDTGCMKGTVEEVTYLDSDGPAAAIKKVVGDC--KKLAVETKYFSMAIGEIFHSLGCEVADIGTCIAKLRMCKDETEIETMQFAAKIVDEAIAYVSDKIKPGMTEKELNMMLYSYMSTYGFITDEFIILVLGADNSANPHGVSGDYAFKDGDIILLDFCAYYKHYWSDITRCLFLGHVGNPKLAEIYDIVLKANLAAIAKVKPGVKACEIDKAARDVITEAGYGELFLHRTGHGLGLSVHEEPNISSDNQLVLEEGMTFTIEPGIYIEGVGGVRIEDDILVTKDGCHIFTSTSKKMEDHIL 363
43 0.000e+00UniRef50_Q6L0D6 Xaa-Pro dipeptidase n=17 Tax=Archaea TaxID=2157 RepID=Q6L0D6_PICTO  ali  33  11...............RRADAIIIFNGKTFFYLTGARSENSALIVTRDSIKIVTSKLEESAARETGIETLIFNKRSEMEDIIR-NETKNFDSIGINYSSMTLSLYLMRMIPDKDFIDVSESILEARKIKEPEELEKIKNAAKIASDALQDAIKKIKEGITESELASEVAYSMMKLAATGPSFNTIVAFGKNSAIPHYSPGDKRLRPGDFVLIDYGALYNRYCSDVTRTMVFGRA-SQEQRDIYETVKEAQQKSMDAIKAGKNGRDIDAIARSIIDEK-YPGKFIHSLGHGVGMDVHDHPALSPSYDFILKRNMVVTVEPGIYIPETGGVRIEDDVIVTDSGHTRITTAP--RDLIEL 357
44 0.000e+00UniRef50_A0A0D6I4S0 Cytoplasmic peptidase PepQ n=792 Tax=Bacteria TaxID=2 RepID=A0A0D6I4S0_MYCSM  ali  34  1....................MLVTDLVNVRYLSGFTGSNAALLVRVDDPVLATDGRYRTQAAQQAPDAEVVIERACGPHLAARAAADGVRRLGFESHVVTVEAHSALSEAKVELVRAAGTVEALREVKDAGEIAMLRLACEAADAALTDLVERLRPGRTEKEVRRDLESLMLDHGADGPSFETIVATGANSAIPHHRPTDAVLATGDFVKIDFGALVSGYHSDMTRTFILGRA-EQWQLDLYELVATSQAAGREALAAGVELRAVDAASRQVIIDAGYGDHFNHGLGHGVGLQIHEAPGLNSAAAGTLLAGSAVTVEPGVYLPGRGGVRIEDTLVVSDAAPELLTR--FPKELAIV 357
45 0.000e+00UniRef50_A0A2N5GSQ8 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A2N5GSQ8_9BACI  ali  27  6.FLERIEGVRKVMEAKELDVCILTNRASLRYFTGLTAAFSILLISQEEIEYVVARLDLKRAERDCWIKDIEDTPDYLHVLNDFFTQWNQIRVGVELPELNYETYLQEKLANARFTNIAEEMGQLRTIKSDVEIKIIRKSTYIADMAMQEALKAAKPGMKEYEVTAIARYAMLKEGAENPSFEPFLASGENSWLPQRYSSDKALKPYELNLMDMGGIYQGYCSDITRTFSVGET-TPEQKRLFYDVLAVQQETIRSLRPGISAGEVDYIARQAIHELGYGEYFPHLTGHGLGIDIHEGPIIDKGRTDILQKNMVLTIEPGVYLPGVGAVRIEDMVLITEDGYEILTQTKRNL..... 363
46 0.000e+00UniRef50_A0A1Y4TZ92 Peptidase M24 family protein n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4TZ92_9FIRM  ali  26  1MNEGRTQKILKAMEENSIPQMIISDPVAIFYLTGKWERMLALYLNVKGNHLVINRLFPQERDLGVELVWYDDIEDAVELLSRYVDRDAV--MGVDKNWARFLLRLQELGGGSSFVNASWIVDQVRMIKDEEEQELMRVSSRINDGVMEKVIPLVAKGMTEMELDHRVREIYKEAGCEGVSFDPITAYGKNGADPHHATDDTKGKRGDCVVIDIGGFKDNYASDMTRTVFIGEV-SDRAREIYNIVLEANLRGIAAAKPGNRMCDVDLAARNYIEEMGYGQYFTHRTGHSIGLEDHEAGDVSSVNTDIIRPGQCFSVEPGIYLPEEGGVRIEDLVLVTEDGCEVLNS--FTKDLIVV 358
47 0.000e+00UniRef50_A0A0R2DIE0 X-pro dipeptidase family protein n=1 Tax=Lactobacillus floricola DSM 23037 = JCM 16512 TaxID=1423744 RepID=A0A0R2DIE0_9LACO  ali  30  4.YQKRREQIYQKLTKEQKQAVLLFNEKNIRYLTGFTGDEAQLLLTQEEAVLMSDSRFMGQIESEKQVEIYNKKKSLLKELSEVITSRNIKQLAIEGDHISASLFMDLRLSLIELNFCHQWVEKLQMIKDTDEVSLIKKAIEISEKSLEKILPKIKPGITEKQVANLLDFQLKQDGLSDISFETIVASGYRSAWPHGAASDKKIKNNELVTIDFGGYYKGYTSDITRTFVVGEV-SDELQRIYHIVLEANKRATDKARIGCTGLEVDRAAREYIQECGYGEYFGHGIGHGIGLNVHELTRLSFK-DVTLQKDMIITIEPGIYVPGLGGVRIEDDVLVTDGEPEVLTTLSKS-QLIKL 362
48 0.000e+00UniRef50_A0A0G1VW36 Peptidase M24, Xaa-Pro aminopeptidase n=1 Tax=Microgenomates group bacterium GW2011_GWC1_49_7 TaxID=1618530 RepID=A0A0G1VW36_9BAC  ali  29  1............MRKHGVDALFITNPTNIRYLTGFVGRDAYCLVTQNQFYFFTSSLYLESAKKLAKVLEISRENPIAKEIARLCEELKIKKLGFEEANLTVAEYNKLK--GLHLVPTNNRIEQLRMIKRADEIAHIRLAANLTDQCFKFITRRIRPGVTESRLALEIEGFLRSRGAD-LAFSPIVAFNEHSFQPHHERSYDPLRRGSLILLDFGAKINGYCADMTRVVFVGKPKDGWVR-AYNTVLQAQNKALGLLRDGVSGATLDAAAKEVIAEANLPPY-PHSLGHNVGLDVHEGPRLSVKKDEKLLPGMVFSVEPAVYIEGTYGIRIEDLVRLTDKGIEILSTSP--KEMIIL 346
49 0.000e+00UniRef50_A0A1X6VVL7 Peptidase n=16 Tax=Chlamydia TaxID=810 RepID=A0A1X6VVL7_CHLAO  ali  53  1MFQDRIERAQAALVDYGIDGFIVERSEDLAYFLGDKVTSGTLLIGKNEVVFFVYRMDKDLYADLQGPSLVFCDRNIGEFLLPYLETTTYQILGFDSFHTSFHRYQERENASCSWMPIHLFTEKLRSIKSADEIEKMSQAAALGSEGYDYVLSVLKEGITEKEVVQLLRIFWAKAGAEGPSFSPIVAFGHHSAFPHAMPTDRALRKGDIVLIDIGVLYQGYCSDMSRTVAWGR-PDSRLVESYPAVVEAQQEAMKLCRAGALCLDIHEEAARILRKYDLEDYFCHGVGHGVGRNIHEYPVLSPKSTTTLETGMTVTVEPGVYFPGIGGIRIEDTVLIDGNKNFSLTNRPVSTELVCL 356
50 0.000e+00UniRef50_A0A0M4MYS3 Uncharacterized protein n=2 Tax=Lawsonella clevelandensis TaxID=1528099 RepID=A0A0M4MYS3_9ACTN  ali  28  7.YAERRNRLRRSVEAE---AIALFGLSSIRYFTGFSGSNALLWITADNDFLITDGRYTLQASECPGIAVEICSSRGSAALTEVMRHLQANTLGVDGEFLNWLDYQELAAWLSSLNDVSAHIAQLRSVKDDSEITALDHAAQCAEAALQQLIEELLPGATEIEVAARLDYLMKVRGSEGVSFETIVGTGANSAIPHHSPDSTPIAAGDLIVIDFGAVVGGYHSDCTRTFCVGES-TAWQEEIAYCVWRAHQAALAEVHPGVSAGDLDKAARSVIDDAGYGPYFGHSTGHGVGVDIHEHPWVRSGSPEELVAGSVFTIEPGIYLPERGGVRIENTYVLEECGNVR............. 366
51 0.000e+00UniRef50_C8P5M3 Creatinase n=3 Tax=Lactobacillus TaxID=1578 RepID=C8P5M3_9LACO  ali  31  10...SRLTKLQLKLPQLDIDAFVITNHYNLKYLVNFEPGDGCLLVTKDSATLITDARYQEAIEEEINDPAVVITRDYYGEVQRQCAKKGAKTLGYEGT-IPMAIYRQIQGDDYQMVFENNVVETMRRIKEPVEIENIRKACQLQSQAFDYILSYVKPGMTERQVVNELDHWMKLRGAENISFTTIIASGENGAKPHATATDKKLKKGELVTLDFGYFINGYTGDMTRTFAMGPV-SDKLHEMYDLVQKANEEVRAVIKDGMHGDDMDRPGRDLIWSHGYKDNFEHGMGHGIGLSVHELPTYGPGRHEVVVENEIITVEPGIYVPGVGGVRIEDDVLVRKTDCETLTTAPRDLQTI.. 365
52 0.000e+00UniRef50_A0A0S7XGG9 Uncharacterized protein n=1 Tax=Planctomycetes bacterium DG_23 TaxID=1703414 RepID=A0A0S7XGG9_9BACT  ali  30  20...................GLLVKGEANIYYLCGFSGVDSLLLVTPDELFLITDFRYVEEAKEAPGVEIVRRRGTLITAAATKARRLRFKKIAFEAHFFTYSDFQALTAKKRRFVPVTGLVEGLREQKDAEEIKMIKRSSRIAQAAFMRLKQIIEPGATEKEIADELEMLLRREGASESAFPIIVAAGKRASLPHARPGEHRIGENEAVLIDWGAKFNFYNSDLTRIVFMGKI-SPKMRGVYETVLEAQHRAIKAIRPGVEMKEVDRAAREHIASCGLGKRFGHGLGHGVGLQVHEAPAIGPKVKGRLRVGMVFTVEPAVYIPNWGGVRIEDMVRVTRSGCEVLSRLPK....... 350
53 0.000e+00UniRef50_A0A0R2QH94 Uncharacterized protein n=8 Tax=root TaxID=1 RepID=A0A0R2QH94_9ACTN  ali  29  24........VRTELQRVGASALLVVDLNNIRWLTGFTGSAGTLIVRPDDMVLVVDGRYGDQAREQIRNCGVVEGRSAV-ALREALANKSIAIVHFDSGELTVGQLENMEQLSSELRKIAPIVPKLRRRKTEPEIERMQLAALATDFAMAEVVPMLSQGLTERDIRDELDYRMRRHGAEFTSYDTIVASGPNAARPHHRPVSRRIETGDSVVIDVGGLVDGYHSDMTRTYLIGDV-DPVLSEMHEVVSQSQLLGLAAVKAGVMAQDVDKTCRDYIAEAGFASEFTHSTGHGVGLQIHEMPWVRTGFAEPLEVGEVVTVEPGVYREGLGGVRIEDLVVVTQSGCRILTSSKKDRQ.... 375
54 0.000e+00UniRef50_A0A2M7KVN3 Uncharacterized protein n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A2M7KVN3_9CHLR  ali  28  324MRISRLTKLSESLRASNLDALALNPSPSLTYLTSLHERPVVVIFTADHPVIILPELEMLKVTGLPYIKAFPYPENPAEWFRRAVQSLGLRRIGVEPRAMRLLEFRHIQAPEADFPDASDAVSRLRVRKDPDEIAAMRKAVKAAQSALEATIPFIKIGMTEKEIAGELVVQLLRHGSSEMPFAPIVSGGPNSANPHASPSERRLQPGDLLVVDWGASVDGYISDLTRTFAIGEV-EAEYRKIHQIVLEANAAGRAAAKPGVPCANVDKAAREVIEKAGYGQYFTHRTGHGIGMEGHEEPYMRSDNMQILEPGMAFTVEPGIYLPERGGVRIEDNVVISEKGAECLSDME--RELRVV 690
55 0.000e+00UniRef50_A0A0H4QFH5 Uncharacterized protein n=2 Tax=Lactobacillus TaxID=1578 RepID=A0A0H4QFH5_9LACO  ali  29  1MDNSRVITIKNYLHENKVDAYLITDKEDQFYVANYTGDDGFVVIDAENKYIVTDARFFEQIKEAPEFEVIDINK---QSLADFLSS-KYKLVAIESDSLLTQDYQAIVAKGVETVSANLVIKKMRMYKSTEEIGYIQKAADITDKVYDHIINFMKVGMTEVEVADEIEATGKKLGAQKLSFETIVASGVRSSFPHGDATDKVIEDGDVVTLDFGFVYNNYYSDTTRTVVMGTA-TEEVKKVYSIVKGAEELGIKFA-PMVTFGDLDRAVRGYIDDSGYGKYFNHGTGHGLGLVCHDYPIIRTSNDDQLEDGIVFTIEPGIYLPNKFGVRIEDDIY-KDDNGETVHVTKSTNELIII 351
56 0.000e+00UniRef50_A0A0M0BFG9 Uncharacterized protein n=1 Tax=miscellaneous Crenarchaeota group archaeon SMTZ-80 TaxID=1685135 RepID=A0A0M0BFG9_9ARCH  ali  24  4.YQSRFNKVIKNMEKKSVDFLFLFPSANMYYLTGFWPRAIFSILSKGDSFFIAPEMYEGQILKHTWIKIWKTKVDFERVFDELVKEFKMHKIAIEDTWADFIIRIQNKIPNSKISLASNLIKDLRIRKTTEEIMFMKKAGTLAEEIIKKITENLDIGISELEISGLIEYEARKKGSKRMAFDTITSFGQNSANPHNEPSEKKLRQGDIVMIDFGPRCNGYCSDITRTIFKGK-PTKKAESIFKIVAEAHDRAASAIKPGIKASELDKLARGAIRKYGLDKFFIHGTGHGLGLDIHEEPYIKKDSSIKLDEGMTFTIEPGIYLPNEFGIRIESSYLVIDDGYDSLTSNPRD...... 362
57 0.000e+00UniRef50_A0A0E9FAI6 Putative peptidase n=13 Tax=Bacteria TaxID=2 RepID=A0A0E9FAI6_CHLTH  ali  34  5..........................................................................................NLAFEETQVSFADYSLLEELPCELVPVMGLIEELREVKDEEEVAIIEKACAIADQGFAFVLEMIKPGMTEIEVANQLDFFMRSKGASGVSFETIVASGLRSAMPHGVASHKVIEKGDLITLDFGCYYEGYVSDMTRTFAIGSIQ-PKLKEIYDIVLEAQLKVLAEAKPGLTGIQLDAIARDHIASYGYGDAFGHSTGHGIGLEIHEGPNVSFRADKQFVPGNVITDEPGIYLPGIGGVRIEDDLLITAEGNRVLTHAP--KELIIL 268
58 0.000e+00UniRef50_UPI0005AB342F aminopeptidase P family protein n=1 Tax=Parachlamydiaceae bacterium HS-T3 TaxID=1314958 RepID=UPI0005AB342F  ali  33  3.YKGRIQRLQHKLIHQSLPSALVTNLTDIFYLTGLQLSAGKMVVTSKNATLIVDGRYIEKCQADSPIPVLLSEKNLWECL------INQSTLAIDSDGISYQSFIDLQERAIHLLPVKGLFTDLRAIKDREEIHLLQESARLCVQGFDYACSLLSEGISEETVAQELELFWKRQGRTSLSFDPIIAFGANSSMPHYRAGKKALKKGDIVLIDIGVELNSYHSDMTRVVFFGDV-NIELKKIYDIVYQAFQKAASFCRPGILIGELDEIARAVIREAGYGDCFNHSLGHGIGLEVHEYPIIKQKSELPLKAGMVITIEPGVYLSTIGGVRLEDTFLITETGCESLT........... 347
59 0.000e+00UniRef50_A0A174G596 Uncharacterized peptidase SA1530 n=35 Tax=Firmicutes TaxID=1239 RepID=A0A174G596_9FIRM  ali  29  1MNQKRINKVLEKMEERGIDYLLVADPVSIDYLLDYGERMYVMVLSSKGNHLFFNNLFYVEKDLGMPITWFDDTDNAPALLADYLKD--AKVIGVDKNMPARFLIPVQDRVNAKYVLGSLCVDEVRMQKDDEEKALMFKASEMNDTAMAEVKRLLATDKTEIEMDEALLAYYKSLGASGHSFSPIMGYGANGANPHHSCDDSRLKPGDSIIVDMGCIYKGYCSDMTRTFFYKEV-SQKQKEVYNLVLKANEAAEAAIKPGMKLSEIDAVARNIITEAGYGKEFNHRLGHFIGKDVHEFGDVSSVSDIIAKPGMIFSIEPGVYLQGDFGVRIEDLVMVTEDGCKVLNSYP--KELTII 356
60 0.000e+00UniRef50_A0A1C5KUA2 Xaa-Pro dipeptidase n=21 Tax=Coriobacteriales TaxID=84999 RepID=A0A1C5KUA2_9ACTN  ali  28  11....RIERVRELMDERGYDAVIIRDEANLRWLTGYTGEPHAAFITASNTFLHTDSRYYEHLPADSPWVLDMEVIGIPRWAAERARDAKCRVVAVEDTMLSFYDGLVRGLDDLSICALHGDLRLMRAVKDEEEIALMKRAQAITDAAFAHMLEFIRPGLTEKQIKLELENFMFENGADGLAFGSIVAAGPNAANPHAIPSDRPVQKGEFVLMDYGARYHDYDSDMTRTVAVGE-PSAKMREIYDLVQRTHEECAKAVYAGVDGNEIHELSRKIIGDAGYGEYYGHGLGHGVGIDIHELPNFGRTHNTV-GEGSVVTIEPGVYLPGEFGVRLEDYGLVTAQGFVPFTQSP--HDLQVI 374
61 0.000e+00UniRef50_A0A0G1VPD6 Peptidase M24 n=1 Tax=Candidatus Peregrinibacteria bacterium GW2011_GWA2_47_7 TaxID=1619058 RepID=A0A0G1VPD6_9BACT  ali  27  6....................ILVANKTNIRYFSNFTGTAGHVVLDKGRGFLFTDARYHLVAKAVSSYTLIDTTNGFMETWKKFYKSHKIHEVGIEGNDVTLQFFKTLKKSGVKLVDVGDELNKKRMIKTNDELKKIQTAQKITDGILEILKRWITPGVSEKAIAWKIECLARELGADGISFPAIVGFNEHSAAPHHQVSEQKLKRDDMILIDMGVVYQGYCSDMTRVLFT-KQPTKLQAEVYELVRLAQETAIKKLHAGVHGKEIDSIARSVIIEAGYGDHFTHSLGHGVGLEIHELPNLSRHYEREISAKSVVTVEPGIYLEGKFGVRLEDMLVVNEKDATNITASPKALKSAII 344
62 0.000e+00UniRef50_A0A0S8H4A1 Uncharacterized protein n=2 Tax=Gemmatimonas sp. SM23_52 TaxID=1703359 RepID=A0A0S8H4A1_9BACT  ali  32  11....RIQRVRAELAELGLHGLLVSQLANVRYLTGFSGSSARLLIDGTAAILLTDGRYGQQAEEEAGFELLISRDGLLAELVEQAKRQSGSRLGFEGQHLSFAEWERLRDSAVEWVPVSGLVEGVRAVKDEKEIAAIERAARIAASALAETLTLVEPGVREADIASELDYRMRQLGAQRPAFETIVASGARSALPHAATSNRKLRGGDIVLFDFGAHWQAYCSDVTRTFVVGEA-EPRQREVYELVLAAHWAARAALRAGVSGAEVDAAARQIFAEADVEERFTHSTGHGLGLEVHESPRLGRRSEDRLESNMVVTVEPGLYFPGWGGVRIEDTLVVTDDRPRAL............ 356
63 0.000e+00UniRef50_A0A117LJD6 Peptidase M24 n=1 Tax=Desulfotomaculum sp. 46_296 TaxID=1635262 RepID=A0A117LJD6_9FIRM  ali  28  2..KRRVDLLRNKLYQKGIDGLLVMKPENRKYLSGFSGTAGSLVVTQEQLFLLTDFRYIEQAEECKQWQVIEIRTSTFDSLKNYLPDWKISRLGYEEDFLTHKQFLELKVPDGSLIPAAGTVEDLRMIKSQEEIARMINSARMADEAFAHILSFLKPGCTEVEISLEME----------------------------------------------CEFNDYCSDITRTVCLG-APTEMQEHIYRIVLEAHDAGINLIRQGVKASDVDQAARSVVERYHFGENFRHSTGHGVGLIVHESPVISSKDGTILQAGMVITVEPGIYLPGWGGVRIEDMVLIEENGARLLTHTPRDY-LMVL 310
64 0.000e+00UniRef50_F9VPD7 Proline dipeptidase n=13 Tax=Sulfolobales TaxID=2281 RepID=F9VPD7_SULTO  ali  28  2...KRIARLRELMKERMIDYVILGPGSNMFYLTGFTERPLFLIIDSWNVYFLAPKLYEEQLSHNIPVVSYSDDENPYKKL----NIEKGKSIAIDDTLWSSFTIDIINFSPSQIIKANEIMKELRIIKQDEEIEIMKEGVRIAEKSFLNAINHIKPGLNEKKIAKMLVDEFLNNGADGVSFEPIVTSGPNTSMPHLRSTTREIKQGDILIFDFGIKYKGYSTDTTRVVSIGK-PIEEIVKIFEIVKEAQQKAEDMIKENVQACEIDKVARQVISNYGFSKYFIHRTGHGIGIDVHEEPYIAPNYKRKIEKNMVFTIEPGIYLPEKFGIRIEDMVYV-NSKAVVMNNLQKD-EIFIV 353
65 0.000e+00UniRef50_UPI0002F75730 aminopeptidase P family protein n=1 Tax=Zavarzinella formosa TaxID=360055 RepID=UPI0002F75730  ali  28  4.FQRRRKELMQAVKAAKVDALLVSKAVNVSYLTGFTGDASFLLVTPKRCIILSDERFRIQLKDECPAEIRGADRNTFQLTGAIVGKLGLRDMFVEATGLTLNEFETLKDKSANLAPKNGMVEELRAIKDTDEVDRIRHAIRIAEQSFLAAKALLRPADTEKGIADLIDQFIKRLGGTGHAFSPIVGVGERSALPHCPVTDKPLSDSWFMLVDWGAEIRQYHSDLTRVIPTRKAVESKLQKTYTIVAEAQARAVEKLRPGIHVREADNAARGHIRDSGFGDYFNHGLGHGLGLEVHEAPSIRWNSEDVLKAGMVVTVEPGIYLPDIGGVRVEDDFLITEDGPVRLTTLPREWD.... 364
66 0.000e+00UniRef50_A0A1C7FAI9 Xaa-Pro aminopeptidase n=7 Tax=Vibrio TaxID=662 RepID=A0A1C7FAI9_9VIBR  ali  33  10..............QAQFDALLVSDNNHKRYLSGFTGSGGHLLLTQTGAELLVAGKYWHQVAEQSCYRECTDDAGWLPTLQQRLDFHGVERLGFESHALSYQDFELLQQGLSQQVPTSDVIAPLRRCKSKQEIRLIAKACEITEAAIELALDDFHLGMSEHQLAAHLEFHARMLGADSIDF-LIVVSGERGALPHGRPSERIIGEGELVTIDFGVVYQGYHSDVTRTFCIGAI-SSQLHDLFTAVHNAQRLGVEMLRPGIRAAAVDEAVRHYLTQLGYGEAFCHGLGHGVGLQGHEYPLLTASSNARLEAGMVLTIEPGVYLQGVGGARVEDTLVITENGCESLTKLPRKLRDI.. 350
67 0.000e+00UniRef50_A0A101FZ20 Putative M24B family peptidase n=1 Tax=Anaerolinea thermophila TaxID=167964 RepID=A0A101FZ20_9CHLR  ali  30  3...DRIETLQTKMIEKGLPLIAVPAGPDLSYFTGLSERPAVLLIAASKPAFIYPDFETTKVKACRPFPYSEERESWVQVFAQALQSLNIQKVGVNSTQMRYLEMDLLHQANSEFVASDALFQSLRTRKDSSEVESIRKAIQIAEEAFRETLKIIQPGRTEKEIAGELVVNLLRLGSDELPFSPIVAAGPNSANPHAVPSDRKLEQGDLVVIDWGARSNHYISDITRTLSIGQ-PDEKFSNMAQITKAANEKARQTAKAGIPCNQVDEAARAVISEAGMGEYFTHRTGHGIGMEAHEAPYIASDYPHELEVGNTFTIEPGIYLPDEGGVRIEDNILITTVGAETLTTL--SRELIII 366
68 0.000e+00UniRef50_A0A2M6YZ92 Aminopeptidase P family protein n=1 Tax=Ignavibacteriales bacterium CG07_land_8_20_14_0_80_59_12 TaxID=1974045 RepID=A0A2M6YZ92_9  ali  30  1MHATRLIALRTLMEKERLDALLLTDPPHVRFFSGFKGSTALLFITRRSALLITDGRYRGESRSVQHVAVHIAKRSLFEALGKKVHLPPDSVVGIHERHASFADVQAMKLPGMKVRTAAKLIGSVTSVRSRRDLASQSTAVKLSEFVFGEILDMLRPGVREDEIAAEITYLHRRFGAERDAFEPIVASGPRSTLPHACPRGRKLRRGDLVVIDFGCVVGGFTSDIARTVSIGR-PSRRVREMYDAVLEAQSRAIEAVADGVRGKEVDRAARDLLTSRGYGREFIHAAGHGLGIEVHEPPRISPRSNDILARGNVIAIEPGVYLPRVGGIRLEDDLIVTRSGAALLTHLP--REMIIV 356
69 0.000e+00UniRef50_D6ST07 Peptidase M24 n=4 Tax=Desulfohalobiaceae TaxID=213117 RepID=D6ST07_9DELT  ali  28  8....RRKKLKKNLAEKDVHAHLITSPANRYYLSGFEESAGCLLVTREKDYLLTDPRYLEEGKAFPEEDIFVYTRDKYKQIKSYLNKTGIYRLGFEPQWMNYEFYAAISQ-EFEMVPLKGLVEDLRFVKDKRELDLVKKSCALNHKVFTRLEQILRPGLREKDIAWEAEKMFKEEGASEMSFSTIVAAGERSALPHASPGDRELRDGMPLLVDMGGRYQDYCSDQSRTFWIGSKEDVFFRQTRDLVRKAQDLVIEWMAPGRSISEAYQIVSSFFAEHGVDRHFTHSLGHGIGLETHEAPSLGPNAKGEFIPGMVVTVEPGLYYAGWGGVRWEYMVLVTRSGVEIL............ 354
70 0.000e+00UniRef50_A0A226BXG0 Uncharacterized protein n=1 Tax=Natranaerobius trueperi TaxID=759412 RepID=A0A226BXG0_9FIRM  ali  27  5.YKERINSLKEVIRQNNISLAIIPPSPNLRYLTGYDERFFGFFIPKDGPFLIAPELAKPQTEIMPVSEFYKDGEDPYQIILSVLRELSSNKILVDNSNASFLLPIQRIFIQSEFELADNILKELRICKDHEEIKALKDAGELTDKVLGEVLSWIA--KTERDLALSLEFKLRNCGMEGVSFAPIVACGSNGATPHHKCGDTTIKEGIPIVIDFGGVYHGYASDMTRTVVFGE-PDEEVKKVYTIVKQANEEAKKIVRPGIEAEKIDIVARKVIEEAGYGENFIHRTGHGIGMETHEAPMIVEGNKRLLKPGMTFSIEPGIYLPGKFGVRLEDIVVVTKNGIDSINNYP--KELI.. 365
71 0.000e+00UniRef50_I0GK99 Putative M24 family peptidase n=1 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0GK99_CALEA  ali  27  1.....MQKLFEKIENTNVDALFVSKIQNVRYITHFTGEEGFAIIIPPKIYLLVDSRFTEQAHEVKESVEVVEWSDLKEAISSILTKNKVHFLAIEEGSLKFSTYKLLQLGFLVLVGTFDLIEEIRMIKEDWELEKIRTACDISTKAFLETLKFLKEGISELEISAELEYRFKKFGGEKPSFDTIVASGERGALPHGVASKKHINAHEPIVFDFGVFFEGFASDTTRVVSIGEV-SQEVRDVYKVLMEAQRIGREVAKEGILASNVDKTVRDFLSEKGFGSYFTHGLGHGVGLEIHELPYVNARSKYTLLRNMVITIEPGLYFPNKYGLRLEDTVIVKEDSIENL--IDLPHEIIVV 350
72 0.000e+00UniRef50_A0A1J5FCD8 Uncharacterized protein n=1 Tax=Candidatus Levybacteria bacterium CG2_30_37_29 TaxID=1805237 RepID=A0A1J5FCD8_9BACT  ali  30  1MNPNRIQKIQTILTERKIDALLVSSSINIRYITGYSERDAYIFVTKKYAILFTNTLYFDEVKKSVPIKVFLITQ-LQKTLEEFLKHEKITNIGFEEN-LTYSEYIRFKKLGVKLKLAESIIEEIRTIKDQTELKSLHKACNLTDSALDYVLKKIRNGITELELAWEIEKFIREHGGE-LGFPSIIAFGKNSAIPHHKTDETKLKSSSIVLLDFGAKAGGYCADMTRTVFFGKAP-EKFKRMYETVRIGQEKGF---KPKMTPQDLDKIPRDYIISQGY-PNIPHSVGHGVGLAVHELPHISPGIKEKINPNTPFTIEPGIYINGFGGVRIEDTVYFDGEKINLLTQSP--KNLIEL 355
73 0.000e+00UniRef50_A0A265EKG3 Uncharacterized protein n=2 Tax=Marinococcus halophilus TaxID=1371 RepID=A0A265EKG3_MARHA  ali  30  5.....IELWRQALLEREEDAAILTDPANIYYASGFHERLLMLMIFQEGPVLVCPEMEKSLVINSGWIVTYRDSEDPWDSVKKMFHKQNPFRIAVEKAHLSVARFEKLQLPGVRYTDFERVVVESRQVKSREELTHIQQAVDIAEQALKAVAAGLQEGVTERQVVHQLEDAMKRAGADGAAFDTIVLFGEKSAYPHGVPSENPLQKGDLILVDLGARYGRFCSDITRTWVFGGADETSQQRL-NLVSQAKAAAIKACRHGGRIGDVDKAARDVLTKAGHGDHFITRVGHGMGMDVHEAPSIHGNNDDLLEAGMVLTIEPGVYIEGWGGIRLEDDVVVGEHGGKIMNRLETLLDM... 363
74 0.000e+00UniRef50_B9DU08 Putative Xaa-Pro dipeptidase n=619 Tax=cellular organisms TaxID=131567 RepID=B9DU08_STRU0  ali  29  3....KIDHIRHFLTEEKAELAIFSDPVTVNYLTGFHERQMFLFIYEQAPVLFVPALEVARASKIVNFPVYMDSENPWEKIRKVLPNTDAKTIYAEFDHLNVTKFQGLQTVSGRFENLTPFIQGMRLIKSADEIEKMMIAGDFADKAVKVGFDNISLEATETDIIAQIEFEMKKQGISKMSFDTMVLTGDNAADPHGIPGTNKIENNALLLFDLGVETLGYTSDMTRTVAVGK-PDQFKLDIYELCLEAQLKAQEFVKPGVTAAEVDAAARSVIEKAGYGEYFNHRLGHGLGMDVHEFPSIMAGNNMIIEEGMCFSIEPGIYIPGKVGVRIEDCGHVTKDGFQPFT--KTSKELL.. 357
75 0.000e+00UniRef50_A0A1G8YFF3 Xaa-Pro dipeptidase n=5 Tax=Bacteria TaxID=2 RepID=A0A1G8YFF3_9CLOT  ali  26  1MKNIALEKLCKEMSNQGINGFMLGVSTDLEYFTGFHSRFQALFVDNGKKFYIVPEILQEEAPESTTIVSWADDEYFLKKLSTAVDEFGLKVIAVNEGIKAIDLLDIQNIMKAKFHNGKDILEKIRVRKTAEEIHNLREAAKLADAVMEDLTKYIRPGIQEKDIKKKIEELFSQKGADELAFDPIIASGPNSSKPHYNDAQRYIQEEDIIILDFGCRYKGYCSDISRTLFVGGA-TPKQKDIYNIIYRANAEAKEMVKPGITAETVDKAARTIIKDAGYGQYFLCRTGHGIGMAVHESPYIKTGNQEILQEGMAFSIEPGIYLSGQFGMRIEDIVVVTDNGVEVLNQ--FPRELIVL 364
76 0.000e+00UniRef50_R5JH20 Xaa-Pro dipeptidase n=4 Tax=Clostridiales TaxID=186802 RepID=R5JH20_9FIRM  ali  25  1MKENRVSQVLKKMKENNIPQFLVSDPLSIFYLTGYFERLFSLYLSEKGDHLFVNALFPIEEDLGVEKIIFTDTDNSIEVVANHIDKS--ATVGVDKNWPARFVLGLMDYCDGKFVNASYIVDTLRMYKDEEEKDLMRKVSLMNDEACEEIIKRITGDKTEKQIASELIKLYEEMGAEGLSFDPIIGMAANGANPHGEPGDRYAQPGDAIIIDIGCKKDMYCSDMTRTVFWKEV-SEKGKEVFEIVLEANRRGIAASKPGARFCDIDAACRDYITEMGYGEYFTHRTGHHIGLEDHDYGDVSSVNTAVAEPGMIFSIEPGIYLPGEFGVRIEDLVLITEDGCEVLN--KFDKELTVI 356
77 0.000e+00UniRef50_A0A1F5ZQQ2 Uncharacterized protein n=2 Tax=Candidatus Gottesmanbacteria TaxID=1752720 RepID=A0A1F5ZQQ2_9BACT  ali  30  1MEKN-LNLLRIELKSLKLDALFLSNQHNVTYLSGFTEREGFFLITRKHAYLLTFPTYFYLYKDSPGYFSITREKNIKKHLEEIVYEENIKRIGIEKENLTLSELESLKKDKTDFVGTENLVENLRIIKTETEISNIRYAAQITDQAFDFIIKNIKKDQTEKDIALAIEFFIKKH-ADNIAFSPIVAFNDHAAIPHYLPTNYKLQTKSLILLDFGAKISGYCSDMTRVIFYG-TPKDEWLKIYNTVLKSQKLALDAIKPGKTGQEIDSVARNFIIKNGYPQY-PHGLGHGVGLAIHESPRLKIDSKDILEESMIVTVEPGIYLEGDCGVRIEDLLIIKRPRTEILSTS--TKELIIL 360
78 0.000e+00UniRef50_A0A0G0KAU6 Peptidase M24 n=5 Tax=Candidatus Levybacteria TaxID=1752719 RepID=A0A0G0KAU6_9BACT  ali  31  7.......KVRNLLSKNGFDAILISSVSNIIYFTGFSEREAYLFITKNQQYILTDGRYTAAVKTLPDFKLIEISSSFEKALKNLTKKHKIKKVGFEGKNISFLEHKKLLKCFDD--SNHRDLDSLRSVKTSDEILKIEKACELGDKTFKYILKEIKLGVSEKELAVKIELFIKQNLAD-ISFPPIVAFGANSAIPHHQVTNSKLANNQIVLLDFGVKLDNYCSDMTRTVFFGSAK-AEFRRIYEIVLTSQQKAIQQLEKGIKASEIDKIARNYIISKGYST-IPHSLGHGIGLEVHEGPHLSPKSKDILKEGMVFSIEPGIYIPNFGGVRIEDLAVLEKNKLRLLTHSP--KNLIEL 389
79 0.000e+00UniRef50_UPI0008635AA5 aminopeptidase P family protein n=1 Tax=Merdimonas faecis TaxID=1653435 RepID=UPI0008635AA5  ali  27  2...ERLEQLRAYMEDKGLDAFFCAKPANVRWISLYTGEDSFLFITRENQYFITDPRYTEQASECPAYEIVNWRTNMGKTLAECGKGQDIKAIGFEEDYLTYDKWSAIQENEAELVPTENVIEKFRAVKTPEELYNLRAACEISSRAFEKILKDIHPGVTEKELASKLSHYMVMEGADTKPYGGILISGAKTSLLHGIPDQKAVEYGDFVLMDYGCQYKGYLSDMTRTVIVGKA-DEKQREVFDLCRRMTEDTERAIRPGVTGIECYEASLEAIKDTEYFQYHYQGIGHGVGMFVHELPNIGARCENVLEENNILTVEPGIYIPGWGGVRIEDQGIVTADGYENL--ISATHELIEL 357
80 0.000e+00UniRef50_A0A0G1TTZ6 Peptidase M24 n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1TTZ6_9BACT  ali  27  5.YPGRLAHLRRAMKQRGLAAVYLTSTVSRRYITGFTGTSGTVLITPHLAEFFTDFRYLERAAEETLFKIIDVGNDGLKVLSQILKDNHVRRLGFEDRAISVARHLQKQLKPCSLVGIGDMVEKLRAVKDDYELDTLRRAVGATDKTFQELLKRIKRLPSEEAAAWKVRDIIHSKKFGEISFEPIIASGANAARPHHEPSPKKLKLGEMVIIDLGVKVNGYHADMTRTIFLGE-PTTKQRKIYETTLSSQLSAISYLKKGRSAKQADMQARRII-DAKFPGAFGHALGHGVGLEIHERPKLAQNSDDILKSNMVFSIEPGIYLPGEGGVRIEDLVVLKESGSEVISKSPKILRQTII 368
81 0.000e+00UniRef50_A0A2E8X215 Xaa-Pro dipeptidase n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A2E8X215_9CHLR  ali  28  1MNKNRLNNLRREMDNFSIKGFLITSNKNCQYISGFSGSNGYIFVTQYESYLFTDTRYISTARQMDDWIVLPITRNYLSKVNDISQSDNDFTLGFESAHISFEEYTKLKNDIVSLEPITSLVESMRSIKDLEELTLLNDSVKLADSIIQEVLSNIKPGISEVEISHMIDSLVVNSSADGTAFPSIVATGLNSASPHHAPTDEKVKTGDSVLVDMGVLYKGYRSDISRTIFVGEM-EQKFSEIYSIVLEAQMITCRAAIPGITGQYLDKTAREFIISKGYGDYFIHGLGHGVGLDIHEKPMIVSSSQDILDVGSVFTXEPXIYIPDWGGVRXEDIFIMEENGPXRLSXAPK....... 359
82 0.000e+00UniRef50_A0A239U2U3 Putative Xaa-Pro dipeptidase n=57 Tax=Bacteria TaxID=2 RepID=A0A239U2U3_9STAP  ali  33  2....KIEEIVKEIRNQDADAAWITTPLNVFYFSGYHERLLALLITAEGQVLFVPKLEVEEVKASPFGKVVADGEDPFKLV-----DYHFDKLLVENEHLTLKRQKELIDGGVEFGDIDGAIKALRNVKTPEEIDKIKKAAELADKCIEIGVDFLKEGVTEKQVVRHIEYEIQKYGVDQMSFDTMVLFGDHAASPHGIPGERTLKNNEYVLFDLGVVYEQYCSDMTRTVAFG-TPDQKAKEVYDIVLKAEKEAINMIKPGVVIGDVDRKARGIIEEAGYGEYFLHRLGHGLGLEEHEYQDVAGHNTNKFVSGMVVTVEPGIYVPEQVGVRIEDDILVTEDGHEVLTHYEK....... 351
83 0.000e+00UniRef50_A0A0F5R8W3 Uncharacterized protein n=8 Tax=Paenibacillaceae TaxID=186822 RepID=A0A0F5R8W3_9BACL  ali  27  6.YKHRWLKMKEALNASGMDLAILTSPASIFYLTGFHERFMALVIGKDGYTLLVPALDEESARQVGRLVGIGDTDDAYALLEKE-TGAQASVVGVESAHLRYSGYLQLARGQAAFRDAEPLVMGLRLVKSEGEIELVKKAVALAEQVLAETVAKAAPGVTELELNAEIEYRLRVLGGDKPAFETSVLGGVRTALPHGRSSGYKLQENDLLLIDMGVYKDGYCSDITRTFLIGEG-TDSQHRIYDSVLKANRSALAAVKAGRPLAEVDRGARSVIEGDGYGFYFTHRTGHGMGIDVHEQPSVHGENKTLMQAGLLFTIEPGIYIPEIGGVRIEDDVYIGLDGPVVLTSYP--RELTRL 368
84 0.000e+00UniRef50_UPI000B44C483 aminopeptidase P family protein n=1 Tax=Bacillus alkalitelluris TaxID=304268 RepID=UPI000B44C483  ali  28  4..EKRMSKLKQWMKDSDIDIIMCQTRANVFYYSGFHERLVAIFIPQDQPFMVCPGMEVNQVQSIFEIIGYTDTENPWEKINNALRSRNLSKMAIEK-LLSWERYLTQICPLTELIEVDEVVLNSRLIKSDDEIRNLREAAKLADYGIQVGIGALKEGITELEVLATIEFELKKAGIREMSFSTMVLFGEKGGDPHGNPGDRKLKKGDSVLFDLGVVWQGYCSDITRTVFFDHV-TDHDKNIYEAVLQAQQAALNECEPGNPISNLDKAARGFFKGVGLDGYFPHRIGHGLGIEVHEFPSLNETNDEPLQAGITLTIEPGLYIPNKVGVRIEDDVLITEDGYETLT--KFPKELTIV 365
85 0.000e+00UniRef50_A0A2H0VNX2 Aminopeptidase P family protein n=1 Tax=Chlamydiae bacterium CG10_big_fil_rev_8_21_14_0_10_35_9 TaxID=1973935 RepID=A0A2H0VNX2_9B  ali  34  5...KRLENVQRLLSSKDMDFLLIDDPDSLFYLTNLQLSAGLMLITQKNANLFVDGRYIATARENSPFQVDLLSQ---EALSETICTYGSKKIGFNSSKTSYCSYLKFKVVDFKLVAIENPLKPFRLIKDATEIQKMKKAANLTWKAFEHICSFLNEGVKETEVAVEFEVFCRKNGADSMAFSPIIAFGENTAYPHHKSSKRALKANDAVLIDIGIVLDHYCSDMTRMIFVGK-PDPEIEKYYSVVKKAHQKALSLCKPGVKLGDLDRVAREVMAEEKMEELFLHSLGHGIGIEVHEYPRIKWDGDDILKPGMVFTIEPGLYKEKVGGARYEDMILITQDGYENF............ 358
86 0.000e+00UniRef50_G8PEG4 Proline dipeptidase n=10 Tax=Lactobacillaceae TaxID=33958 RepID=G8PEG4_PEDCP  ali  29  4.....INQVRLTLRDS---ALLISDYYNIQYLTGFRGAEGKILLTPQKSYIITDSRYEEEATSVYDSFEVQITRSFDEAVVQLLNRENITTLQFE-DTLSYREYRLLKSHSLKLSASRELIDKVRSIKTPSEIGAIKAANELSSEGYQYVLNFIKAGMTEKEVATSLDDWMKSHGSTGASFETIVASGPRAAMPHGSATSKIIQNGEMVTLDFGYYVDGYTSDITRTFAVG-NPSSKMKEIYEIVLYAQELVINTIHNGVGGPDLDQVGRDYITSKGFGKEFNHGMGHGIGLNIHEYPQ-SYGGMQKYQTNEIITVEPGIYVEGLGGVRIEDDLLVTKDGYKDLTTAP--KNLIIV 352
87 0.000e+00UniRef50_A0A2H5WZ43 Xaa-Pro dipeptidase n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5WZ43_9BACT  ali  28  9...QRVAKLQQALLKHGVDAYLAATPVNMLYLSGFSERLMFLLVPQGEPCWFMPALSAESAEANPAGYVWHDSEGPIKQLERCAREQHLETIAVDDEMPAFLLILQEVLPAVLFRRGGEIIAEVRACKDALEIERMRQAAQLTDEALASGLERCIPGVSEWAVALAIQRALYDMGSH-LAFGPIVAAGENSSKPHYTTGHRPLQQGDLIVIDYGGTYEGYCNDITRVVSVGPAPD-EAKKIYEIVYAAHMAARETAKPGVPAQEVDRAARRAIEKAGYGNHFVHRTGHGIGLSVHEPPYIVEGNEAPLEVGHCFTIEPGIYLPGRFGVRIENVYTITEMGCESLNAEPPEH..... 367
88 0.000e+00UniRef50_A0A1F8MU07 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=A0A1F8MU07_9CHLR  ali  30  3...QRLHKLRQQLLERSLDAIIITQPENCRYVSGFTGSSGTLLVSHDSAILVTDFIHFEQAKQEAPDFDIVITRNHAQRFAVLLSRQRIEKLGFEANFLCFADYQHLAEEASNIVATTGIVESIRAVKEEDELAFLEEAAGLADGAVGHIMAEIHPGMTEKEAAWSIERYLRERNSEPVPFDIIVASGPNAALPHAKPTERTISNSEPIVIDLGARVNGYSSDLSRTLCLGDQGDT-FPRIYNLVLQAQLSAIANLEVGMTCSQVDSLARTVIEQEGYQEAFGHGLGHGVGLAVHEEPRLAPNSSSTIMENMVFTIEPAIYLSGWGGVRIEDMVLVEKGKARLLTKTPR....... 354
89 0.000e+00UniRef50_F0HQT9 Putative Xaa-Pro dipeptidase n=72 Tax=root TaxID=1 RepID=F0HQT9_9ACTN  ali  28  1MYEQRIKTVRRNLANRGLEQMLVCDPRSIHYLTGAFERFLGLIVGSDRPTLVLNALFAAPADAACTVRSFTDTDDPLAIVEGLCDADKP--LGCDKNLARFLLPLMERGAASGFVLASDAIDDARAIKDDTERELMRAASAANDAAMDRFRRLVHEGVTEADVAGQLEAIYRELGAQGHSFTPIVSFGANAADPHHEPDDTPLASGDVVLFDVGCRKGEYCSDMTRTFVFGE-PSEKLREVHDTVRRANEAARKLVAPGVRFCDIDAAARSIIEEAGYGSYFTHRLGHQIGLDVHEPGDVSAAHDAPVQAGMVFSIEPGIYLPGEFGVRIEDLVLVTEDGCEVLNSYP--RELVSI 357
90 0.000e+00UniRef50_A0A257ARV8 Peptidase M24 n=1 Tax=Thaumarchaeota archaeon ex4484_121 TaxID=2012532 RepID=A0A257ARV8_9ARCH  ali  33  9..RNRISRLMDLIQENELSAILIHSEANIFYFTGYRG-PGYLLIPLNGPKLYVYPLDFELARMCVRGGVEVEELSMTARVENVVEGLPKSRLGFDS--LSAEDYLRLSLGHESLKPASEIVWKLRMIKDRSEIGNIEKACDIASKVMDLASEMLEDGVMESEVKAEVLEEMLKLGADGASFDIIVASGSRSSMPHGAPGSRVMRNGDVVVVDLGAVFEGYCSDMTRTFYIGGDPPEEVAKIYEMVLEAKRLAEESVKPWTLSSALYDKVYDRFAAMGYADYFIHGLGHGVGIEVHEPPRISKAGKEMIQENMVITIEPGIYLPGKFGIRLEDTLLVEKDGVRRLTSAPYTL..... 360
91 0.000e+00UniRef50_A0A2V2GCT1 Aminopeptidase P family protein n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2V2GCT1_9FIRM  ali  31  11..................EALLLSDERGRRYLTGFDSSFGYALVTPSQKYFYTDKRYLSAAKDFLAGKGWQTEETDLSAVGARAAQSGAKNLLIDYAATTLKEYAALKAMKLPFKDANRRLESLFAVKDKEEIACVAKACEIAEKAFYKTLEFVKEGVSEKQLANELETRMLEYGAEKTSFDTIVAFGANSAVPHHKTGAAKLVRNTPVLMDFGCVYEGYCSDMTRTFVFGE-PSDEFVDAYAAVLEANLAAEEHIRTGMECAAADKIARDALKIAGLDRAFTHSLGHGIGVAIHEYPTVGPRGTGKLKSGTVFSIEPAVYFEGKFGIRIEDTVVL-KGGVKRL--FKDEKNLILI 345
92 0.000e+00UniRef50_A0A1T4MU50 Xaa-Pro dipeptidase n=2 Tax=Olsenella TaxID=133925 RepID=A0A1T4MU50_9ACTN  ali  27  7.NKSRIGHVMSNLESMGLTQALVCDPMSIWYLTGYYERFFALHLSADGSTLFCNKLFPDATGAANAIVTFDDTENPIPLIAAVTKSDKP--LGVDRKLVAHWLLMMDAQIASDFRLASNAVDDARAIKDDAEKDLMREASRINDEAMSWLAAQVHEGVTERKIASGLLAEYRRLGAGDHSFSPIVSFGANAADPHHEPDGTTLGKGDMVLFDVGCKRQGYCSDMTRTFFTAE-PTDRQLEVYNTVRRANEAAEAIIKPGVTFAEIDLTARHVIEDAGFGPYFTHRLGHQIGLEDHEPGDVSCTHDEPVKAGMIFSIEPGIYLPGEIGVRIEDLVIVTEDGCEVLNHY--SHEPQVL 366
93 0.000e+00UniRef50_A0A256ZDA6 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_135 TaxID=2012509 RepID=A0A256ZDA6_9ARCH  ali  32  29.....LREFRSLASGKELDAILISRPSNIFYATGFKGGSRLLVPADGEPVILVGGVDLVAAQEHVKVEHIKLGEKLDDLMLKLLKETGIKKLGFDE--LPLKTYSRLELGRGNLTDLNGPIWDLRKSKDKLERELVRKACQMAVKGMEIASELMEPSRTELEIVGEIEEALRKAGSEEHPFNIIVASGPNSALPHARASGRELKKGELVIVDLGATCGGYVSDITRTFVVGK-PEGWQEEIYHIVREAQEKAIMALRAGLKASEVDKVARSVIEEAGYGPYFIHGLGHGLGIEVHEPPRLAPGFEEALGVNYTVTVEPGIYLPGKGGVRVEDTVLVLEDGREVLTEFPYGLEL... 380
94 0.000e+00UniRef50_A0A1C5MDW3 Uncharacterized peptidase SA1530 n=14 Tax=Bacteria TaxID=2 RepID=A0A1C5MDW3_9CLOT  ali  29  1MNNDRIQEILDLMEEARLDYFLISDPQSIAYCTGYHERMFVFMISKHGNHLFMNDLFYLDHDLDVNIVWHKDGQDAIQTIVDEMHFPG--RIGIDKNWASHFLLLMKKLPDAKYINASPCVDLVRMKKDLQEQVLMIESSKINDAVMEEIIPFIQEGVTEKQLAKKLDELFFKH--HSTCYGAIVAFGKNAADPHHENDDTLLRKGDCVLIDMGCVYKGYCSDMTRTFFY-EGILEEEIKVYEIVKKANEAAEAMIKPGVKLSDIDKCARKVISDEGYGKYFTHRLGHFIGRDVHEYGDVSSVNEMEVEEGMIFSIEPGIYLEGNFGVRVEDLVMVTKDGCQVLNS--FTKDIYII 355
95 0.000e+00UniRef50_A0A0M9FNE7 Dipeptidase n=660 Tax=Bacteria TaxID=2 RepID=A0A0M9FNE7_STRSU  ali  27  2...SKLHHVKSYLEANKMDLAIFSDPVSIYYLTGYHERHMMLFVMPDDSLLFLPALDVERAVATVDFPVYMDSENPWQIIKSKLPQKSFSAICAEFDNLNLTRYHGLQSIFSQFSDITPLINTMKLIKSRDEIEKMLVAGEFADKAMQVGFNNISLNVTETDIIAQIEFEMKKQGISKMSFETMVLTGDNAANPHGIPSTNKIENNALLLFDLGVEALGYTSDMTRTVAVGK-PDQFKKDIYNLTLEAHMAAVNMIKPGVTAGEIDYAARSVIEKAGYGEYFNHRLGHGLGMSVHEFPSIMEGNDLVIEEGMCFSVEPGIYIPGKVGVRIEDCGYVTKNGFEVFT--KTPKELL.. 357
96 0.000e+00UniRef50_UPI000424615B aminopeptidase P family protein n=1 Tax=Aneurinibacillus terranovensis TaxID=278991 RepID=UPI000424615B  ali  29  7.....ITKIKDEIRNNGWDAALLTSPISVAFSTGFHERFLGLLLDKDGAVLYVPSLEKDNAEQNPDIKVIPDTDNPYQILQKT-GGSSIKKLAVEKDYLRLSQAEQLSFSGLSLFNIGNMIAELRSRKTPDQISRIKIAVRLIEEVMAEGLKRVRVGMTEVDLVAELEYLMKKKGADYPAFGTTVLAGANSALPHGTPGMTKIKEGEFLLIDMGVFKDGFCSDITRTFVIGE-PTAEMEKIYHTVLAAEEAAIAAVRTGGTLAELDRTARRIIEDAGYGPYFTHRVGHGLGLEVHEYPSIHGENMDKIVPGMTFTIEPGIYIPGVGGVRIEDDVLATDSGPDVLTSFPKTL..... 368
97 0.000e+00UniRef50_A0A0S4PRN5 Xaa-Pro aminopeptidase n=3 Tax=unclassified Armatimonadetes TaxID=1042316 RepID=A0A0S4PRN5_9BACT  ali  28  6.FRKRLAKVQEGMLAEGADAFLASTPVNMFYLSGFSERLMFLLVPREGPVWFVPALSAESAEANPAGYVWHDSEGPANALQRLIQEYPTGVIAVDDEMPAFLLILQEFLPAALFRRGGELMAHARAQKDATEIALMREAARLTDESLAAGLELCAEGYSEWSLALAIQRALYDAGS-KLAFGPIVASGENSSKPHYTTGHRLLQHGDVIVIDFGGVYEGYCNDITRVVSVGAAP-EEAKKLYTIVYDAHMRAREAAKPGVPAQEVDRAARAVITEAGYGDYFVHRTGHGIGLSVHEPPYLVEGNTSPLEVGHCFTIEPGIYLPGRFGVRIENVYTLTEDGAVSLNAEPPT...... 366
98 0.000e+00UniRef50_A0A1V5I8L6 Xaa-Pro dipeptidase n=9 Tax=Synergistetes TaxID=508458 RepID=A0A1V5I8L6_9BACT  ali  27  3.NQKRLAGVAAELNKKGLDAIFIGPSADLEYMSGLDERVRGLVIGRDGRCFMTPLLYREEIGDVPFYSEWNDHEGFAGAFRRGCEHLGVGRIAFNDGVRAVDMLTVRDAMEMSMENGCDLLRPLRARKDEEELGFMREASRLVDEVVRMLRGYIRPGMTERQIAKQIPDFFEEAGADSPSFNPIVASGPNGSMPHYGGGRRTIEENDVIIIDLGGRHRSYCSDTTRTFFTG-TPTAEQRKVYEIVREAQAAGEAAVRPGATGQDVDRAARKVIVDAGYGEYFFNRVGHGIGIAVHEHPYIIEGNDAPLEPGNVFSVEPGIYLPGKFGVRIENLVAVSADGGEALNKFPREIESVII 368
99 0.000e+00UniRef50_A0A0D5ZFI2 Uncharacterized protein n=1 Tax=uncultured archaeon TaxID=115547 RepID=A0A0D5ZFI2_9ARCH  ali  27  23....................AVILSRENICYLTGFNERLTALIVNGKETSLVVPKLSQGQVRDIGVDKTWDDRDDPYAIAKEIIGSGGKGRIALESQT-PLSLYMRFKDMGPDPVFADQLMVALRQRKRGEEVEFIRKAVEISEKALEETTQEIKPGMTEKEVAGILEYNMRRNGSDGNAFSTTVASGKNSANPHHVTSDSRIEAGSSLVIDFGASYRNYSSDTTRTFVVGSIP-EGFKDVYETVRKAQQTGIDCANPGIPAGDIDIEVRKVIENAGYGEYFTHRTGHGIGLETHEPPYINESNRSPLQPPATFTIEPGIYIQGKYGVRIEDTVLMDEKGTRAVNS--FSKELRIL 361
100 0.000e+00UniRef50_A0A2E8RA72 Peptidase M24 family protein n=5 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E8RA72_9CHLR  ali  29  5.FDSRVKHVIDSLESRGLPAVIIKNPSNINYLTGFSGSNGCLLITFQKKYFFTDSRYLEDSKKQFKSWIVQRYSKDFHEIVDKLYDLSIGTVGYESKTLTQFDFENLSKNEIDFVKADGLIEEIRSVKDSFEIIQIEQSIKVADLTMEWILGQNLEGMTEIEVSRMIKRQFLELGADDVAFSSIVATGLNSAVPHHYPDDSIIQSGDCLVIDMGAEIGNYRSDITRTTFIGEKPG-KFDEIYDLVLEAQKTGISLITEGITGGQIDQIVRSKIEEIGFSKYFITGLGHGVGLDIHEYPMLIPNSSDKIYQNSVFTIEPGVYLPEWGGIRIEDMVLFKDNQVSVLTKSKK....... 355
101 0.000e+00UniRef50_UPI0006843456 aminopeptidase P family protein n=1 Tax=Bacillus mannanilyticus TaxID=1418 RepID=UPI0006843456  ali  27  3MYQKRRSACLDLRGNEQNEAMLITNPKNIYYLTGFHERFLGLIWNNQEWTLCVPRLDQSAAQQAVRIISYTDQEPIQEKIPSFFASKDLTKIAVEKSFISYEQWLIEAFKQIHIEDMTPTLDQLRMSKTKDEFAILKRAGEKTDQILKAALSLFSTSMTELDLVAEIEYQAKKMGADGMSFGTTVLGQEKSALPHGHSASKKLEKG-TLLIDFGITLDGYCSDMTRTFHIGPW-EPKMKKIYETVLRAEQTAIKSAAEGVSFGELDSIARQIIADEGYGEYFIHRLGHGLGLEIHESPSIHGLNNERISEGMVFTIEPGIYVPGLGGVRIEDAVFIEASKAISLTQFPTSVDEMVI 366
102 0.000e+00UniRef50_A0A2A5YV69 Uncharacterized protein n=1 Tax=Acidimicrobiales bacterium MED-G01 TaxID=1986263 RepID=A0A2A5YV69_9ACTN  ali  30  9.HNSHLSDVRQAMSDHSIENFLTIDGVSIRWLSSFTGSAGKLLITGSSSHLLTDGRYADQAAREISGTAIELFVGDGKQQKEFIAARSSKTLTLEADRITWGAVEELKKEDVEVLPSNGLISDLRQVKDPSEIARIQAAASIADSALMQLLPDLGGQPTELEFARALDSAMFDLGAEALSFETICASGPNGAAPHARPSSRVIRARDLVVVDFGAVIDGYHSDMTRTYIVGDA-DQSSWDMINSVTEAQERGCEMVHPGVKACEVDDACRSHLSDRGLGEYFVHGTGHGVGLEIHEAPWINGKSSEVLEEAQVVTVEPGVYLPGVGGVRVEDTVLITSSGFRRLTAAPK....... 358
103 0.000e+00UniRef50_G0EIU5 PepP, Xaa-Pro aminopeptidase n=20 Tax=Brachyspira TaxID=29521 RepID=G0EIU5_BRAIP  ali  28  17.YDARLERLLKLTNEN----LLITKNENIFYLTGFKGSAGWLLISKGKKYLFVDSRYCEHASKVTHTTVILVAGTYHDALAEFCKENNIKEIYTAKNGLYLSDYENI---------VASMVNN--SIKSKADIDTIRNIKNRAEKAMTKMLAFVKEGVTEQELAAELEYQMRKEGGDKTAFDTILLFGERTSLPHGVPSERKLKLGDNILMDFGLSRDGYKSDITRTFFFGKGNNEEMSKIYNIVREAHHKGIEAIHSGVSGKEVDNAAREIIKNNGYGQYFGHGLGHSVGLEIHESPRLSPLVDHVLEGGCVVTVEPGIYVPNLGGVRIENMAIVTKNGGVSINDTPT--DLIVL 371
104 0.000e+00UniRef50_A0A1E4B6B3 Uncharacterized protein n=3 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A1E4B6B3_9BACT  ali  32  5.RERRLATLLERLVAGHLDAVLVTSLPNIRYLTGFSGSNALLLVTGRDAHLVTDFRYQTQAATESVCNVRVETSNLWSGLWSLMGGLGVQSVGFESAHLPHRDFQRLMERGWHWRPVTDLVEGLRAQKDAEEVAHIRTAGAMAIRALHETLERVRIGMTELEVCGILEHALRDAGSEAHPFAPIVASGPRSALPHARASGRAIAPGEFLLLDFGASTGGYCSDVTRTVILGRA-DERQRAIHEAVREANRVAREGIRAGMRGREGDALARSVLESRGLGELFGHGLGHGIGLEVHEAPRLSRLAEEVLPEGSVVTIEPGVYVPEWGGVRIEDDVHLGADGADLLTD--FTRELLVL 361
105 0.000e+00UniRef50_A0A1B3WU52 Uncharacterized protein n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A1B3WU52_9CHLR  ali  29  1MHSERIQRIAAQAKAAGLDAVALTPSPNFIWATGLSERPCVLIIRSDGVFVIAAGFEIPSIQEVPAILPFPFQDTPAEAFAEAGKRIGLKTIGIEPRHFRFHEFSFLTEAGIRPVGAAELFAGLRLRKTADELAKMKKAARIAERALEDTLPIIKPGVREIEIADTLIGNLIRNGSQELPFDPIIGSGPNSADPHAAVSKREVRPGEFVLIDWGARYDGYCSDLTRTFAVGEA-SEEMRTVHETVLAANRTAAAFARPGVRAGDVDGAARSVIRAAGYGDFFTHRLGHGLGMECHEDPYMFAENDLTLEPGTVFTDEPGIYLPGRFGVRIEDDLVVTDSGCEALTS--FPRELRIL 367
106 0.000e+00UniRef50_A0A0R1JTX0 Proline dipeptidase n=8 Tax=Lactobacillales TaxID=186826 RepID=A0A0R1JTX0_9LACO  ali  31  1............MKQRDLDALYLVDPANITYLTGFTGDESTLLVSPDNVVLLTDGRFIEQAKTELADEVHRWQHGLTEDAVALINASSAKRVGFEAGLMDYLTGQAFVTGQAATTPVSGLVEELRAVKDASEIAKITEAAKIVDATFYHMLDVIRPGMTERAVAAELDFTMAKFGSTKPSFGTIVASGLRSTFAHGEASDKVIEAGDMVTLDFGATYQGYVSDTTRTIAVG-TPDPRMEEFYAYVVAAEKAGLATIRDGVTSAQLDAAIRQVFLDHDVNQYLIHGLGHSIGLVVHEAPYITPGDKTIFRANMVQTIEPGLYLPGVGGMRVEDDIVVQAGQGIQITSSPKS-ELIKL 346
107 0.000e+00UniRef50_Q72JR5 Xaa-pro aminopeptidase n=71 Tax=Deinococci TaxID=188787 RepID=Q72JR5_THET2  ali  35  4.........KDLLEPLGLDALLVTRPENVRYLSGFHPEDAQVLVTGEGAFLLTDPRYPE-AERESRIPAKVLRREEREALLKTLK----GRVGFEAEHLPYAALERLRLVPAEWVPTKGVVEKLRLRKTPEEVERIRKAQALAEEALAHVLPLLRPGVEEREIALEVEFFLKRRGAEGAAFPPIVASGERGALPHARASEKRLKAGELVTLDLGARLEGYHSDMTRTFALGR-PKEELRRAYKAVXXXXXXXXXXXXPGKPGKEVDAVARKVLEAHGLDRYFVHSLGHGVGLAVHEGPSLSPYGEEVLEPGMVVTVEPGVYLPGLGGVRLEELVLLTESGVELLSRFPRD...... 340
108 0.000e+00UniRef50_R7L5Y7 Peptidase M24 n=23 Tax=Clostridium TaxID=1485 RepID=R7L5Y7_9CLOT  ali  30  1MN-SKIKWLRDKIRLSNMDGIIISNPVNIKYLTGIN-AEGTLLVTRKENYYITDSRYIEYAKSVITINIIVYREDYENFF------LFCDKVGFEENYVTYFMYKMQRYKINNLEETENIIEKQRMIKDEEEIGYIEKACKITDACFSHLLNFIKIGMTEKEIAFEIEKFFIQNGADGVAFETIVASGKNSSKPHAVPTSKKIEAGDAITIDMGCKYKGYCSDMTRTIFAGYIP-VKIREIYDLVLKNQIQALKEMYDGANAK---IAARNVKNDFKLHNYLVHSLGHGVGLDIHETPFISDIRDWTLKENMVVTDEPGIYLTGTYGVRIEDTVLITKSGCITLTKS--DKNYIIV 353
109 0.000e+00UniRef50_A0A2H6CQV3 Uncharacterized protein n=1 Tax=Tetragenococcus halophilus subsp. halophilus TaxID=1513897 RepID=A0A2H6CQV3_TETHA  ali  29  13................GLDALLLTSKANKFYFGGYSDRGYVLLLKQREPIYFVDYRSASDIGDEYQKIVLQKDDNPVDVVIKYIKTTNIKYLGLEGDHLSYNQFIQEHLKSLQIESVDADI--LRYIKSDEEIETIRKACQIADESYLSFLKKIKIGMTENEAAMILVQEMKTRGARKESFETIVASGKHSASPHAKTSDKVIEYGDFVTVDFGARFQNYCSDTTRTFVMGEVLDERMRDIYHIVLKAFMNAAKTVQPGVSMEAIDTAARDTIIQAGYRQNFVHHLGHSLGIECHESPRLAQGDKSIIQKNMVFTNEPGVYIEGLGGVRIEDTFYVNETGLQSLNT--TPKELMIV 352
110 0.000e+00UniRef50_A0A1L4C1L7 Peptidase M24 family protein n=9 Tax=Firmicutes TaxID=1239 RepID=A0A1L4C1L7_9LACT  ali  28  1MNPA-LQRLKQKIQDQKLDLIYIDNPNLIGYFTDFHERLLALFIIDNEEFLFTPFLEESDAKNVSTVSDIIDEENPWKIIQTKLESYGFQKIGIMESNLTVDRYKQLLANASETVDISSTLQSIQLIKSEAEFNKMTIAGKMADKALEIGANALKVGISEQAVVAEIEYQLKKLGISEMSFQTMVLFGDHAGSPHGTPGSRKLKENELVLFDLGVVAEGYTSDVTRTFAFGEV-SSEIASIYEVVLKAQEKAQAAVKPGITTGELDNIARTVIEEAGYGDYFTHRLGHGLGKTVHEFPSLSKGSTMEIKEGMCFSLEPGIYIENKVGIRIEDCVYVTADGCIPFTTTRKTL..... 360
111 0.000e+00UniRef50_A0A0P9K4V6 Putative peptidase n=6 Tax=Pseudoalteromonas TaxID=53246 RepID=A0A0P9K4V6_9GAMM  ali  28  5.FLSRQATFRSLLTSSQLDSALIFGYENIRYLSGFSGHAAYLVINQNSGYLVTDYRYAEQATNESQGFEVICRDRDNETLGHCFNRLQGAKLGFEADHINVGAWQAIELSAAQLTPIQGVVERMRSVKDDWEVKQIELAAAIADQALNETLPYFKTGASERDIALELEYRMQKLGSNGMSFDTILLFGERTSLPHGMPGDRKLAVGDFITLDFGAVINGYRSDMTRSYIYGEA-SEKQQLVYQTVADAQAAAMAEVVAGAAATNALKASHRVIENAGFAEYAGEGLGHGVGLFLHEFPIIKPNCDYHLEAGNVITIEPGIYIPNFGGVRLEDDILVIENGFKLLTHAPKP...... 356
112 0.000e+00UniRef50_A0A139DRW6 Uncharacterized protein n=1 Tax=Candidatus Adiutrix intracellularis TaxID=1705730 RepID=A0A139DRW6_9DELT  ali  32  18............MEEGAVEVLLLTSPANRRYFSGFNESSGALLITPHSLCLLTDFRYVEAAREAPLFETIIYREGLASELPGLPALKKAGRLYFEPEFLSQGNFSRIALPQIQLEPVPFDPAGPRAEKWPEEIRLVTKALAITEAAVGALWDRMEVGVTEHEAAFFIETEFCRLGAEGPAFETILASGLNGAIPHAIPGAKKIKKGETVIIDCGARYQGYCADLTRTLILG-SPKKWQREIYFVVREAQILALAALAPGRPAREVDKVARDFIARQGYGDFFGHSLGHGVGLVIHEAPFLSPRSAWILKPGQIVTVEPGIYLPGRGGVRLEQMVLITENGAQILNH.......... 360
113 0.000e+00UniRef50_A0A0G1U145 Xaa-Pro aminopeptidase n=6 Tax=Candidatus Gottesmanbacteria TaxID=1752720 RepID=A0A0G1U145_9BACT  ali  33  7.................LDALLITNQTNIRYLTGFREREAYLLLASNQCYLFTNSLYREQAKNAKCFVEISRENPIGKELKRVLQKSSSKALLLEEADLTVAEYTKLKLKGVKLIPTQNRIEELRMIKRTDEIENIRAAAKLTDACFTFILSKLTPGVEEGEIAWEIESFFRKRGAT-LAFSPIVAFGKNSSQPHYSPSNSRLQKQDVALFDFGARVNGYCSDMTRVVFIGK-PKDEWRRTYQTVLEAQQAALEYLQAGLSGGKADRIARAVIQKAGLPPY-PHSLGHAVGLDIHEAPRLTVKKNQILKPNMVVTVEPGVYVEGQYGIRIEDLILLKKDSIEVLSKSP--KELIIL 382
114 0.000e+00UniRef50_A0A2V2EAR4 Uncharacterized protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2EAR4_9FIRM  ali  32  1MNK--IKLLQNLLQKN--EAALIESPKNRRYFTGMNTSNGMILATTDRAWFFTDFRYITAAKSKKTFEVLLFDGTHADTLKKHLPE-GINKILFEGEFVNYAAANKFAVPDVNFEMSDDKINKIRAQKSEDELEYMRQAQKIADSAFIHILDYVKNGITEKQIAFELEVEMRKNGSGEMPFSIICASGANTALPHAVPSDKIVEDGDFITVDYGATVNDYCSDMTRTFAVGNI-SEKQKKIYELVLEAQIAAIKAAKAGVIGSEMHKIASDIFEREGLAEYFGHGLGHSLGIQVHEDPRFSPTCNEVIPENVVMSVEPGIYLPGEFGVRIEDCIVLKPDGCEDL--ASSAKNLIIL 356
115 0.000e+00UniRef50_Q180U0 Putative peptidase, M24 family n=44 Tax=Clostridiales TaxID=186802 RepID=Q180U0_PEPD6  ali  32  1MNNT-MERLVSLIYKRGVDALLIKAKNTKRYIGALSGSGVYVLVTKDKNYQILDGRYIDEADKKTTGFIIVSQGSYIPTIIELLKELNIKKLAIENQAMSIQEYLSLKNEGFEINLITNELWKLRAIKSKEEIELIKKACEITDEVFDEVISEIKKDMTELEVSALIQYYALKKGASGMSFETIVVSGERGAMPHGRPTNKKLKVNEAITIDFGVVYQGYQSDMTRTISIGKPP-KIIKEIYDVVLEAQLSAIESIKEGTRASDVDKVARKIIDKHGFGEYFNHGLGHGIGLGDGEVPTLNPNSEDILVEGMVMSCEPGIYIPNVGGVRIEDDIVIIDGKGVPLN--KTSKEFIIL 354
116 0.000e+00UniRef50_A0A2E6ZXR4 Xaa-Pro dipeptidase n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E6ZXR4_9BACT  ali  30  17.HDRRQADLRRRLDEAGLPALLVTHLPNVFYLSGFAGSAGALLVTVDAVRFIVDNRYATVARESEAISVVDVESSYEATYRDLLRASGVSKVGVEAAHICLAQYDALAEEGPELVSSRDLVEAGRLVKDASELQVLTEAGARISAVMEDQITRLRFGTTELEVAANIDHAIRKAGFERPAFDTIVASGSHTALPHARPGSRVLKKGDLVLLDFGGVYRGYCVDLTRVASLG-APSDEARSWHGAVREAHQSALDTVRVGATTAAIDHAARSTLESKGLGEAFGHGTGHGLGIEVHEAPRIGRRRDVPLEPGMVFTVEPGVYLPEHGGVRLEDDVVVTTDGYRLLTNV--SLDLREV 387
117 0.000e+00UniRef50_F6DGY0 Peptidase M24 n=7 Tax=Thermaceae TaxID=188786 RepID=F6DGY0_THETG  ali  34  4.........KDLLEPLGLDALLVTRPENVRYLSGFHPEDAQVLVTGEGAFLLTDPRYPE-AERESRIPAKVLRREEREALLKTLK----GRVGFEAEHLPYAALERLRLVPAEWVPTKGVVEKLRLRKTPEEVERIRKAQALAEEALAHILPLLRPGVEEREIALEVEFFLKRRGAEGAAFPPIVASGERGALPHARASEKRLKAGELVTLDLGARLEGYHSDMTRTFALGR-PKEELRRAYKAVXXXXXXXXXXXXPGKTGKEVDAVARKVLEAHGLDRYFVHSLGHGVGLAVHEGPSLSPYGEDVLEPGMVVTVEPGVYLPGLGGVRLEELVLLTESGVELLSRFPRD...... 340
118 0.000e+00UniRef50_A0A2H0JZM4 Peptidase M24 n=1 Tax=Bacteroidetes bacterium CG12_big_fil_rev_8_21_14_0_65_60_17 TaxID=1973924 RepID=A0A2H0JZM4_9BACT  ali  26  3.YSARLQRLESAIEASPLGAMVLNAGPSLPYMTGLHERPVVACFSPGSPTLVLPALETQKVQHLPFGDVYTYSESLPSWHTAFEAALGGVRIGVEDGVLRFLEYMQKAAPSAQFVSGEEIMASLRMRKDITERTLMKEAVRMAEEALRSTLPHVKPGVTEREISSRLIARMLDEGSGGLPFQPIIAFGPNSANPHAVPTDYAAREGDLILFDWGANNRGYFSDLTRTFVLGE-PDDVIRRIYQTVEKANAAGRAAGKPGVTAGSLDAATRDVIDQAGFGPQFVHRTGHGIGLDVHEPPYIRSGNDVLLEPGMTYTIEPGIYVPEHGGVRIEDDMIVTEDGCESLTTYP--RELTIL 367
119 0.000e+00UniRef50_B9Y8G6 Creatinase n=8 Tax=Firmicutes TaxID=1239 RepID=B9Y8G6_9FIRM  ali  27  1MNE-RVERLQKKMQEEGLGACVISDHSAVEYFIGFSERLIALIVTTEGPKLVLNELFPLAPQTDFELVRYNDTEDGVQIVSRFLN----GKVGIDKFWAGFLIRLMALRPDLEMVD-GNLVDRIRSVKDPVEQARMRQASLNNDKVMARVRELIQAGKSEKQLEQEINAAFRELADSDPSFETIVAFAENCADPHAVPSDKILEEGMSVIVDMGCKFEGYCSDMTRTYFIGKNT---MEDVYDTVLRANLAGIAAVKPGVRFCDIDRACRQVIEEAGYGSYFIHRTGHGIGLSVHEPFDVSAVDEIVVEEGMCFSIEPGIYLPGVGGVRIEDLVLVTKDGCEVLNHDPKD...... 347
120 0.000e+00UniRef50_A0A2E7R1Q1 Uncharacterized protein n=3 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7R1Q1_9CHLR  ali  28  8..RERLDKVRAEICDQELDCLIVSSPNNRYWISGFSGTSGTIVITESSQYIFADSRYWEQVRECPDFELVQVNGADTVFHMTRLRDLLIGKAGYESNHVTVDQISEWRESAPRLIAASGILEDLRLVKDDFEIDALSRAVKLGDSALEYALKEIRTGWTEKDVAWTIQQYALNNGASDMSFPTIVASGSNGALPHWRASDSQLISNSGLVIDMGVILDSYASDLTRTIWFSRHVSDKFLRIYDIVLMAQEMAIERIEVGMLASEAHSIAVEVIREAGYGEYFNHGLGHGVGLEVHEAPRLGPGHSTRLEEGQVMTIEPGIYIPGWGGVRIEDQCVLRDGRLWSLTXASKTLN.... 370
121 0.000e+00UniRef50_A0A2H0L206 Uncharacterized protein n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A2H0L206_9BACT  ali  29  20....................LLVTNKTNIKYISDFEGTNGYLALVRDRGVLFTDSRYHLIAKACAQIKLIDITGGFGKAWTDFVQREHVRSVGLDARDVSWDMLQKFSGRGVKLIDIGNALDRERMIKNKDELAHIQKAQHITDKILRELRSGLKVGQTELDIAWKIQMMAHDFGAENISFPAIVGINEHSASPHHHPTSKKLRRGDLILIDMGVQYKGYASDMTRVLFT-KKPTPEQAEIYELVRRAQQAAIDGLHAGMTGETADALARDIIKEAGHGEHFGHSLGHGVGMDVHELPNLSSAYTEKLPAGAVVTVEPGVYLPGKFGVRLEDMVLVQTKGVKNLTKSPKQLKDCVI 365
122 0.000e+00UniRef50_G7V8K5 Peptidase M24 n=5 Tax=Synergistaceae TaxID=649777 RepID=G7V8K5_THELD  ali  29  5.FNNKLASAALEIKKAGCDALLMGPSADLEYLFGLSERFNGVFLLATGEVFVVSKLYLEEFKRATKIYEWADEEWFFEALERAFKEWGFGKIAVNDGVAAMDAVEIANRHGVHLVNGWQMLEPLRLIKSQEEIAKLKKAGEITDRALEALLSFIRPGRKEKEIRRKLLELMDDLGATSASFPPIVARGEHASMPHYTGGDGVIRERDTLLIDFGCRFEGYCSDMTRTLFIGE-PDPEIRKLYEIVRRAQEEGEKHVRPGVTAEFVDEVARKVIVKAGYGMYFNNRVGHGIGIAIHEAPYIMRGNRTPLQKGMTFSVEPGIYIPGKVGIRIENCVFVTDEGCQSFTS--FPKELVIL 368
123 0.000e+00UniRef50_X1U287 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1U287_9ZZZZ  ali  33  6.HEMRITTLKKSLEEHRLDAYLVTNLKNIYYFTGFLDIAGALLVPLDGAVLFVPPLSYEAAREKARNCIVEEGVKPFNRICKELTDRQIDVVGFDD--LPISRYLQLTKASTSFSHIPSLVGNLRRVKDEQEINLMKKAAELTDVGALAGMEYVQAGVREYEVAAEIEYAMRRHGSEGAAFETVVASGPRSSHPHGVSTDRTITRGDAVVLDLGAVYRGYRSDITRTVIVG-TPSSNQADVLNLLMKAKEAAFHAIREGVKAKTVDKRARTIIAEKGFDRYFIHGLGHGVGLDIHESPTLSPESEDILVAGNVVTDEPGIYLPG-FGARIEDTVLVHKKAGEKMTK.......... 355
124 0.000e+00UniRef50_A0A1V4SHU9 Aminopeptidase YpdF n=20 Tax=Clostridia TaxID=186801 RepID=A0A1V4SHU9_CLOHU  ali  35  25...................AALITKRESYMYLSGFTGTSANLLITSKKAYLLTDFRYMEQARQAPLFQIVQHKPDINETIGELIHSEQARSIGFEDHAVSYSAGRALRFKDMEFKGMGLAVDDMRSIKDEQEIEIIAKAVKIADDALMQVLPLIRPGITELDVAAELEYKMKKLGAAGPSFETIVASGLRSSMPHGVASDKKLELGDAITIDFGALYNHYCSDITRTVFLGQ-PDKRLIDIYNIVLEAQLTSERGAVRGRTGREVDRIARDIIYSKGYEGKFGHGLGHGVGLEIHESPRLSMSGEKALENRMAVTVEPGIYVEGLGGVRIEDTIIIRDDKPQVLTQAP--KEIIIL 361
125 0.000e+00UniRef50_A0A220U4W9 Peptidase M24 family protein n=5 Tax=Bacillaceae TaxID=186817 RepID=A0A220U4W9_9BACI  ali  27  3...NRIDTLLTEMKASNIDSMLVTSKANVYYLSNYHERVIAVYISNDDPILVLPNMEKEDALAAGWIIGYHDHEDPWALFQSKLNKNDPQSIGIEYDQMTIERYNAVTLPNTAIKDAKETLANLRVIKSKKEYTILKQAADLADFGIETGIGAINEGVREIDIIATIEYELKKQGIQGMSFSTMALSGAKTASPHGNPGTKKIEKGDMVLFDLGVIYDGYCSDITRTVAY-KTITENQKKIYQTVLEAEQKSIDVSRVGTAVGKVDLAARKYIEAAGYGDYFTHRIGHGIGIETHEYPSMHSNNELSLKEGMCYTVEPGIYVPHTGGVRIEDMVYMTEKGPELLTKSP--KELRII 364
126 0.000e+00UniRef50_A0A1F5CV54 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_16_48_13 TaxID=1797381 RepID=A0A1F5CV54_9ARCH  ali  38  2....RIENLRKAFS-SDLDHFIVTNPKNLFYLTGFQGS-GVLMITPDSAVLYVYSIEFEHAKSKARGCEXXXXXXXXXXXXXXXXXXGAKRVGIDDLPISQYLLFKRRSRGMEILLKVDLIWKLRKRKDSVELKNMKKAAEIATHGFEAALEAIRPGATEKEVAAEIEYRMRRHGSEGLAFDSIVASGFNSILPHVGPTERKIRDDDFVIVDIGSIYEGYCTDITRTYVAG-NPSVRQRRMYDAVLRAHDRAIECIQEGVMAKVVDHRARQILSRRGYGEFFVHSLGHGVGLEVHEPPRLSPNSSEELQSGYVVTVEPGVYIPGYGGVRIEDTVAVVRGGSERLSEAP........ 346
127 0.000e+00UniRef50_A5V256 Peptidase M24 n=16 Tax=Bacteria TaxID=2 RepID=A5V256_ROSS1  ali  27  4....RITRIQEAMRRYGFDALAIVPGSNLRYLSGITLHAGLLALTPGQPALVVPALEHARIAETTRFYPWSDAEGPEQALARATRDVGLGVIGIEHTVMRVFELRALALPGAQTADVTPLLMDMRMVKDAEELHAIRQAVRVIEDTLRQTIAQVRAGMRERDIADLWERAIRAAGCL-PAFETTVASGPNSANPHHTSGDRVLQEGDLVVFDGGAVYQGYVSDITRTFAVGRL-SDEALRIHHLVQAANTAGIAAAQPGATGESIDTAARQIIEHGGYGAYFIHRTGHGIGLDIHEPPFIVAGNQAPLPVGATFTVEPGIYIRGLGGVRIEDDVVITADGAESLTTFPRD...... 362
128 0.000e+00UniRef50_D7WLY5 Peptidase M24 n=47 Tax=Bacillales TaxID=1385 RepID=D7WLY5_9BACI  ali  27  5.YETRRAIFKSKLEE---DIAFITSPANIFYYTGFHERFMALIFNSKEEILYVPALDLEAAVQVTHIVPISDEQMPFEVVKSTIGNLG-QTAGVEAKALNLSRYLELSTLDVQVKDIQQLVNRQRLHKTRDELNQLKVAIDIIEQVMTEGIKKIHIGMTELDLVAELEYLMRKFGADGQSFASIILSGGNAALPHGQPSMRKIEHGDFVLIDMGVIKDGYCSDITRTFVIGEA-TEKQREIYETVLASTLAGIKAAKANIPLKQVDLAARAVIEKKGYGDYFNNRVGHGLGIEVHEEPSVHAGNNDLITTGMVFTIEPGIYIPHYGGVRIEDNVYINELGAEVLTT--FPRELQIL 363
129 0.000e+00UniRef50_A0A1G1KUV3 Uncharacterized protein n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1KUV3_9BACT  ali  31  1MSNPRINKILNVFEQKKIDALLVTKDVNIQYLTYTPSSESWLLICPKKVFYITDFRYVLEAEKLKGISVKRYENSIHETLFQIAKSMHVRRIGFDERHMTLATFKVLKKKEIRLVEGNNIVEDLREVKERVEIESIIKALKIHKQAHEFLKKAVKPGISEKALFFKLEEFVRSKGVT-FSFAPIIASGPNSCHPHAKVTERKIRRDDSVLIDMGIDLKGYKSDLTRMFFLGKI-SPLVQEVYHFVKAAQLEAIGKIKSGIPVGEIDQTARNYLEKQKLEKYFGHALGHGVGLEIHESPRLSQKSTAVLKEGMIITVEPAVYIPDKFGIRIEDMVLVTKEGCEVLS........... 347
130 0.000e+00UniRef50_A0A0M0GDA1 Uncharacterized protein n=4 Tax=Bacillales TaxID=1385 RepID=A0A0M0GDA1_SPOGL  ali  28  1MNEK-IAALEKFLKLRNWKGGLITSRQNIFYLTGFHERFVGIFVFPGRSPLIVPEMELLEAGWRYEYICYKDSDNVWRMITEHLKENMITEFAVEETFISLKYVRMLQLPNIQLQNLDEALSEMRIRKSPEEIKKLRIAAQYADNAIQTGIDALYEGVSELEVLGEIEYKLKKAGLRDMSFSTMVLFGSNSSNPHGVPGENKLQPGDTVIFDLGVKYQGYCSDITRTFVFKELRD-EVKEIYDLVLKANMAALQECKAGNKMRKIDEAARKVISDGGFAEYFPHRIGHGLGIEVHEEPSLHAENEDFLREGMVLTVEPGIYIPGVGGVRIEDDVVIGEEGIEILTKFQKSMQIV.. 364
131 0.000e+00UniRef50_A0A2E3LWF3 X-Pro aminopeptidase n=1 Tax=Waddliaceae bacterium TaxID=2026802 RepID=A0A2E3LWF3_9BACT  ali  37  4..ESRIKSAQRLLKNFDTDAMLIENPIDLFYLTQENLSAGSLLITSSSAELYVDGRYYETCKSNCSLAVHLSNTD---SLNKRIAELSLKKLSIDSTYTSVQRYTELKQTNCNICTIPGPILEIRSIKDHDEIQALQKAADLGSEGYRYLLTQIREGISERQLALKLEMFWLEQGADGLAFSPIIAFGKNSSKPHYHPSPEVLEKGQNILIDIGVQLNGYHSDMTRVVFF-DQPDPYLEKIYHIVREAQEKALSNCYEGVSVRELDSSARDFIADQGYGDRFTHGLGHGVGLEVHEYPSLRENKHKKLKKNMVLTLEPGIYLPDLGGVRIEDTVVVGQESCTNLSSP--SKELHII 356
132 0.000e+00UniRef50_A0A1V4RCQ1 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium 4484_171 TaxID=1956173 RepID=A0A1V4RCQ1_9BACT  ali  32  1MN-NRVLLALKNIEKEGLDALLLSNPVNISYLTGFRPAEGYLLINSKRLVYFTNFIYAQEARKLRMWKVNISRSNIFANIVKETIALHIKNIGFEEKNISYLEYKKIKKEHIKFLPSYGIIEKMRSVKKKDEIALIKKAVDITSSGIEFIKEIMNPNMTEKYLQTETERFLKLKGDDTLAFPPVVAFGKNTSIVHHIPSQKKLSNNKIILIDLGARYYGYCADLTRTVFLDKMPLS-IKRIYGIVQRSAELAIKKIREGVKINEVDKAARDFIDKKGFGKYFGHGLGHGVGMSVHEEPYLNPFNSNILKKGMVVTIEPAIYLPSKFGIRIENMILVKTNRAEVLS........... 347
133 0.000e+00UniRef50_R7FZU9 Xaa-Pro dipeptidase n=1 Tax=Acidiphilium sp. CAG:727 TaxID=1262689 RepID=R7FZU9_9PROT  ali  31  9................KYDIALITDEKERLYYLGFHSTAGYAVVTRTSVSFVVDNRYFKAAEKNKGVKVILGAD--YSILTKIAEEINAKTIGIDFTKVTISEYENLKKLGYDYADISSELTAMAAIKSDEELKYIKKACDIAEKSWLNVLPFIKEGITEKQLAAELEYNFRKLGAGGTSFDTIVAFGKNAAVPHHETGDTKLKKNQCVLMDFGCLYKGYCSDMTRTMFFGE-PDEEFERIYLAVLLAHKTAAANIRAGITGKEADKYARDVLESLGYGRYFTHSLGHGIGVNIHEFPTLSPRGEVALENGMVFSDEPGIYLNGKFGVRIEDSCYLKDGKFH--TFMKDDKSLVVI 346
134 0.000e+00UniRef50_A0A2H5YWT0 Putative dipeptidase PepE n=9 Tax=Bacteria TaxID=2 RepID=A0A2H5YWT0_9BACT  ali  34  8....RLARLRTALGSHQIDAALVGPSADFRYLTGHSERLTVLVVPREGCTLLVPELESPKFTDFPFGRLWRDGDDPIDLLARRLLDLDARTIGVNDEFRAFLLPLQERLTGRRFARISPLIQELRIVKSPAELSLLREAIARVDAAWARFCAEGRVGRTERQVARQLSEFLLEEGLDEVAF-CIVASGPNAASPHHEPGDRIIQDGDPVVIDIGGPYQGYYADMTRTPVAGTIRDPDFAVAYEAVLEAQQAAFAAMRPGVPCEEIDRIARDVLATHGLAEAFTHRLGHGLGLSVHEPPYLVRGNRAPLRPGMVVTDEPGVYLAGRWGVRIEDVVVITEEGTERLTRSPHDL..... 362
135 0.000e+00UniRef50_N9VIE3 Uncharacterized protein n=4 Tax=Clostridiaceae TaxID=31979 RepID=N9VIE3_9CLOT  ali  28  6....RVQKILGSMRQDGIDSLLVTQGTDIRYVSGFSGEAGVAVISESRNYLITDGRFTSQAEQETEFEIVLIKSGLYETAGRLLDEIGAREIRIDIGQISHADYLELESHHGTIQNMKPYISDARMVKDEEELVLIRRACDITEQSFLSLLNQIRPGQSEKEIRNILENEFRRRGSLDVAFETIVASGPNGANPHASLTDRTIQQGDMVTIDFGCKYEAYCSDITRTFSLGK-PSDEMMKIYNTVKAAKEAAESTLREGVSARDVDLAVEAVIGGAGY--HLPHGPGHGFGLDIHENPFLSSRNEYRMERNVVHTLEPGIYVQGICGVRIEDDYLITGDGAECLT-PNITRDLIIL 360
136 0.000e+00UniRef50_D0MJW8 Peptidase M24 n=9 Tax=Bacteria TaxID=2 RepID=D0MJW8_RHOM4  ali  27  6.HAKRLARLQQLLQEADIDAVALNASPTLTYLTGLSERPVVGIFPAGKPALVLPELETGKASLPVALEAFPYGENPDDAFAQALRFCGLTRLGVEPQWFRFLELRLLAAPEVRVTSAEPVIMRLRSQKDAAEVAATRRALDVAWRALEATLPVIRPGVTERDVAAELTLQLLRAGSDALPFSPIVAFGPESANPHAVPGDRPLTPPTLILIDWGARVEGYCADLTRMFAFG-PLDDELDRIVQIVLEANEAARARVAPSVPAGEVDRAARQVIEQAGYGPYFIHRTGHGLGLEIHEPPYIRGDNSELLAPGMLFTIEPGIYLTGHGGARVEDDVLVTETGAETLSDYPRTL..... 368
137 0.000e+00UniRef50_A0A1G6PW43 Xaa-Pro aminopeptidase n=1 Tax=Geotoga petraea TaxID=28234 RepID=A0A1G6PW43_9BACT  ali  30  6........IQKFMKDNDLEAMLLFNTESIFYLTGFSGNDGALIITPNCAKILVDSRYTEEVKEILTDEVKTGTRTIYETIEEELNSLKIQNIGIEYSKIYHRDYDKFKNKNWNIVNIDEQLESMRNIKTVEEIETMKKAIKISEDAFVEMLNYVKPGITEKYLAAVLEFEMKKRGAEKPGFDTIVGSGFRGALPHGIASEKKLEEGDMIVIDFGARYKGYNADLTRTIGV-KSITDEVRNVYSTVLNANKEAIKAVKAGESGFDIDKIAREIIKEAGYGEYFGHGLGHGLGIEVHENISVSPRSKHTLKAGNVVTIEPGIYLDGKFGVRIEDDILVLKNGYENLNSL--SKDLIIV 358
138 0.000e+00UniRef50_R7BIJ6 Xaa-Pro aminopeptidase n=8 Tax=Firmicutes TaxID=1239 RepID=R7BIJ6_9FIRM  ali  30  9MYIN-IEKVAKLVNDKKCDAIILFNESNMHYICSFSPSEGVIIVTKGSAYHIVDSRYTEIAQQKTGVKVIEIKTSFSDTAKEIIEKENIKKLLYENETISLLQYKTQKFSGCEFVELNHELMLLRNKKEPFEIELMKEANNIAEKSFLELLNEVKAGKTEKELASLFDYIMAKNGSEKVSFDTILLTGTHTSMPHGTPSDRKVQAGDFVLFDFGATYKGYHSDMTRTIAIDHA-TDEMEEAYELVLKAQLEGIKALSAGQKCADVYQKAYDVLDKKDMAKYFRHSLGHGVGLDIHEGYNASPRSKDTYEIGNVTSIEPGIYIPNKFGIRIEDLLYISPRGRENLS--KITKKLIIL 366
139 0.000e+00UniRef50_A0A150J611 Xaa-Pro dipeptidase n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A150J611_9EURY  ali  31  1MMKNRIDRLFEYIAKKNVDCVLISPDINFFYFSGLFEGSFLLLYPDGGSKLFTSTMEREAAEKSGGDFEVYVFSSREERINLLKDNIKGENLGLSFSSITYLEVDKLKETKGNLIDITKEISFTRAIKDSDEINQIKKASEITSKTFSQIPEMLRNGMTEKELSLEIEFSLRKNGASSLSYDTIAAFGPNSSLPHYESGDSKLKPSDFVLLDFAGKYNRYCTDMTRTFFFKEA-SSEQKKVYETVLEAQLLGLDALKPGVIARDVHNAVSKFIDDTEYKGKFIHSLGHGVGLETHDALGLSPISDYTIEENMVLTIEPGIYIPDFGGVRIEDTVVVRKGKPQILT--PFTKELLII 364
140 0.000e+00UniRef50_A0A142XTS0 Putative peptidase n=2 Tax=Gemmata TaxID=113 RepID=A0A142XTS0_9BACT  ali  32  1MNQQRRSALGQTLKANGLDAFLVTAAPNVTYLSSFTGDCSFYAALPKNNVIIGDTRFEEQIKEECDIVIRPHNKTTIEAAAETLTKSGAKAVGVEGNRITLGELEAFKAPKITFVPVDGVVEKQRAIKDPGEVEKIRESVRVAERGFRMFVATLREADSEKDMVDALEGYVRRAGARSTSFPPIVAVGERGALPHAQPTARQLGEGSKLLVDWGADLL-YKSDITRTLPFGTSPSRRFEKLYAVVLAAQNAAMAVIRHGVKAKDVDAAARKVIANAKFDKYFTHGVGHGIGLEIHEAPRIRANSEDVLEAGMVVTIEPGIYIPGWGGIRIEDDVLITHDGCKLLTTLSR....... 374
141 0.000e+00UniRef50_A0A101EYE1 Peptidase M24 n=1 Tax=Acetothermia bacterium 64_32 TaxID=1635286 RepID=A0A101EYE1_9BACT  ali  34  3.YGKRRDRLKRRVSREGLDAFVLSDRPNLRYLTGFTGTFG-LLVLGEEELFATDSRYLERAGREVGGLPVEVRGRWFDWFCGRLKDLGLRRFAIGAHTTSVHIFKKLEGKGFEPVPVDGWVESLRRVKEPEEVDRIGAAARLTDQGLRWVLGRLRPGMTEREVALELEMWYRTHGAEDVAFDLMVAFGENSSMPHYTPGTRELREGDLLLFDIGVKVDGYCADLTRVVALGR-PAPQARVIYELVLAANRAGIEALQAGVPGVEADRAARAVIEGAGHGEHFGHGLGHGVGLEVHEAPRLSPTSEDTLEAGMVVTVEPGVYLPGEFGVRIEDLVVVRPDGCELLSAFPKE-ELLVL 360
142 0.000e+00UniRef50_A0A2H9HZX2 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon B24-2 TaxID=2041147 RepID=A0A2H9HZX2_9ARCH  ali  32  5.YKRRRESLAKIMDSEDLDLFLLSESADILYFTGFSGALKAFISKNGELTVYVSPVNLEEARREGEIKLVRHSEDLNREIATFILESKAKTIGFKGLKAADYLDLKESIGTSELKPKSDLVWRLRSVKDSYEIRAIKEASKLTSIGMEAAMNYIKPGVREYEIAAELEYAMRRNGADGTAFETIVASGERTALPHGGCTERRIRLGDLIMIDVGARYRNYCIDITRTFVVG-TPTERQKELFEVVKLAQEHALKVLRAGIAAYKPDEEARSVLKRSGLEEKFVHGLGHGVGLEIHEPPLLKPGNKSPLRKGNVVTVEPGVYIPGLGGVRIEDTVQILELGTEKLTSFPID...... 355
143 0.000e+00UniRef50_A0A061P1N9 Proline dipeptidase n=3 Tax=Geomicrobium TaxID=767528 RepID=A0A061P1N9_9BACL  ali  31  2..QTRLQQLETFAQQQNLDAILVTSTANVFYLTGFYERFLGLLLFSDGPMIICPNMEMNLARAAGWITGYDDTENPFDKFPSL------TTLAIEEEHVTVARLRKLTNRNIETTSIDNELLGMRLQKNEEEIELLQKAAHYADRAVELGVAALKEGVTELEIIQAIESGLKQEGISKMSFEPVVLFGKNAADPHGSPGTTPLKRGDAVLMDLGVYYEGYASDITRTVFFGE-PSKEHQEVYETVLAANVAGINACIVDAPIQDTDDAARSLITQAGYGEYFTHRLGHGLGIEVHEEPSMHGMNSQLLQEGMALTVEPGIYLLENIGVRIEDDLIVTNNGPLVLTQYPKSLQIV.. 357
144 0.000e+00UniRef50_A0A1F6ECV2 Uncharacterized protein n=1 Tax=Candidatus Kaiserbacteria bacterium RIFCSPLOWO2_01_FULL_51_21 TaxID=1798508 RepID=A0A1F6ECV2_9BAC  ali  27  4....RIEKIRQILAKEKLAAFVVFNHENLFYLTHFSGSSGVLVVTKKQAFLFVDGRYKERARQEALHSRIVRRESSGEVIARALRLGKVRRVGYEGKRVSVLLEREWRKVPAKMIPTDFLVERMRQCKDKREIAALSHACKVTSAIFTEISKRIHAGMRECDIAAEIDHRLRKAGATAPSFPTIVAGGQNSALPHHKTGNRRVRAGEPVVIDFGGVFESYCSDLTRTIFVGKKPSKKLMEIYDIVLAANKKAFRDVKPGMSWKNYDAIARDYIAKSGYGKEFLHGLGHSLGLEAHD-PY-NYKN-DPITTGTVFTNEPGVYLLGLGGVRIEDDLVMTKSGPKRLTNTP........ 357
145 0.000e+00UniRef50_A0A1F9XAJ8 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFOXYB2_FULL_48_7 TaxID=1797967 RepID=A0A1F9XAJ8_9BACT  ali  30  8.......KIQGKVKAGKIDCLLVTSPMDLLYLTGVDIQGGYAVITAGKAFIITSKMLCKQISDANAGFEVIESKKFSLTLKSILKAVGIKNLSVDPGKITWEIKQKLSIGKNRIKPVSGFFESLRQVKDENEIRLIKESCAIAAKVFNAVKKEVKPGITEIQIGNRIMELLYKNGVE-PSFTPIVASGPRASYPHHVNSANKLNKNDLIIIDMGAKYKGYCSDLTRTIILGKINT-FNRRIFSLVKRAQAKGIAAARPGVKSISVDKTVRACIKNAGYGSNFLHSTGHGIGLEVHESPSISAAGKVVLKPGMVITVEPGVYIENNFGVRIEDTVLITKNGREVLTSDAK....... 352
146 0.000e+00UniRef50_A0A179D619 Aminopeptidase n=3 Tax=Thermodesulfobacteriaceae TaxID=188711 RepID=A0A179D619_9BACT  ali  33  1MYEIRLNKIKQWLKRHKFDGILISSPENRRYLSGYTESAGFLLITTSEAFILTDPRYQEEAQNLSLFEPVIYRKGLARALSSLAERLKIKGLLYEENYLSCGRLKALKLPKVEFSGVSGVIEKWREVKDQEEMRLLEKARELALEIFRILSKEIQPGRTEKEIAWRITELSHRLG-EGPSFPPIVASGPNAARPHAEPEDKPLRSGEVVIVDLGVKYRGYCSDLTRTFFLGRVP-ERLREAHHLVKEAQRLAQPHMKPGLKIREADRKVRAFFQKAGVLQNYLHSLGHGLGLAVHEAPAVSFRSRRKFKVGQVVTLEPGLYFPGLGGVREEEMVFIR................... 344
147 0.000e+00UniRef50_A0A142Y400 Putative peptidase n=1 Tax=Pirellula sp. SH-Sr6A TaxID=1632865 RepID=A0A142Y400_9PLAN  ali  26  8....RQQRLFRELRHQSIERLLITSPFNVTYLTGFTGEDSFLYVEGETLTVWSDARYEEQIGEECPLEIRKPTELLVDAIPRWLGKKKVHALHVETGMTSYAQWERLQMGAQSLTPCNGIVERLRECKDDVELAAIERAIQIAERAFLAMRSMLADDWTEKKVADTLETNIRQLGGTTSAFKSIVGVGPRAALPHGRPSSKTISEDPFVLVDWGAKEDLYLSDITRVILTGK-PSSKLQKVYQTVLHAQMAAIHAIRPGVLMSEIDAIARGVIEQAGFGKRFTHSLGHGFGLQIHETVRLARGQDRPLEPNMVVTVEPGIYLPGVLGVRIEDDILVTKDGHRVLSHLPKEWDEI.. 361
148 0.000e+00UniRef50_A0A1M6PCS8 Xaa-Pro dipeptidase n=20 Tax=Bacteria TaxID=2 RepID=A0A1M6PCS8_9BACT  ali  29  6.YTKRLHRLQHLLQDSSLDAVVLNASPTLTYLTGLSERPVIGIFPAGKPALVLPELEAGKLATLPTVCEYREHPDTWPAVAQALRCCGLTQVGIEPQWFRVLELQLLAAPELRVASAETLVMRLRSQKDDAEIAATRNALEVAWQALEATLPAIRPGVTEREIASELTLQLLRAGSDDLPFAPIVAFGPESANPHAIPGNRPLTPPALILIDWGARVEGYCADLTRMFAYGTL-DDELLRIVQLVLEANEAARARVGPGVPAGEVDQAARQVIEQAGYGAYFIHRTGHGLGLEIHEPPYIRNDNREPLAPGMLFTIEPGIYLPGRGGARIEDNVLVTPTGAETLSNYPRTL..... 368
149 0.000e+00UniRef50_UPI0009EE38FF aminopeptidase P family protein n=2 Tax=Bacillus TaxID=55087 RepID=UPI0009EE38FF  ali  28  1MFKKRLTNLQGYIRKNGLDGGLITSRNNIYYLSGFHERFTGLFIFAEDPVLVLPEMEVEMLLKAGWIYEYSDSEDVWGKMKRHLGNKIGGGMGIEENYISFRYIKMIQLTDGELTNLDPKLSEMREIKDTDEVNSLRIAAKYADYAVQIAVDSLYEGVTELEVLGRVEYQLKKRGIREMSFTPMVLFGENASNPHGVTGENKLKAGDTVIFDLGVKYNGYSSDITRTVVYKEA-SEEMDRMYNTVLKANKAALKECKVGNSIRRIDEAARKVIEEAGYANYFPHRIGHGLGIDVHEEPSLHSNNNELLKAGMVLTIEPGIYIPGLGGVRIEDDVLITEVEPYLLTG--FTRDLQVI 365
150 0.000e+00UniRef50_A0A1G1N8D9 Uncharacterized protein n=7 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1N8D9_9BACT  ali  33  5.....ISKLTALFDRKDIDAFLVTQDVNIAYLTNFPASESWLLVGRRKSFYVTDFRYLHEAKKGKEVTVVRYSKSMATALFQLARQHKMRRIGFDERHISLAGFKRLKIQGVALAAVNNLVEGLRQIKQPKEIQSVRQALAIHAQALKYLKNYIKPGASERDLLRHLEDFVKSKKV-GFSFAPIIASGPNSALPHAKVTDRKILKNDIVLVDMGIDVNGYKSDLTRMFFLGKIP-PLITRANDSVKTAQLKAIAKIQPKARACKIDEEARNYLEKKRLGKYFGHSLGHGVGLEIHEDPRISQTSTAVVQENMIFTVEPAVYIPGQFGIRIEDMVLVTKQGCEVLS........... 347
151 0.000e+00UniRef50_U7D4W7 Peptidase M24 n=1 Tax=Chitinivibrio alkaliphilus ACht1 TaxID=1313304 RepID=U7D4W7_9BACT  ali  29  3...NRIRDVRSYLNQKDLTGILLTESISIRYIADFISSNAALLIFHETVYLLTDFRYAEKAQELCTHTGWTVTNSLFAPLSKVLS--PSMRIGIESESLTLDSFMQKHLSGVEFFHCKRDIHLISAQKQRDELTYISTAAAMADRALNKLLPHLTPGIDEYSAARLLEKLCLEEGSEGPSFPTIMLFGKHSSLPHGTPSSKKLQEGDTILIDFGCTYHGYCSDMTRTFFSTKI-SPHMEEIYRTVSHAQEMGKKAVRAGVSAATIDATCRSIIEDAGYGPHFQHGTGHGVGLRIHEYPALNKKSDAVLKPGMVITVEPGIYLPHTGGVRIEDLLIVTEEGYDLLSHSSRSL..... 353
152 0.000e+00UniRef50_D4JS09 Xaa-Pro aminopeptidase n=9 Tax=root TaxID=1 RepID=D4JS09_9FIRM  ali  33  8.....IAKLADELSDER-HAALITSDISRRYFCGFTSSAGIILVTKEASYLLIDFRYFDKAKERVSDCEVILLENAKTQLMNLLIKHGITTVSVESDAMTVTELEKYKA-NYTFVGLSEMIGKMRIIKTPEEIEKIVKAQRIAERAFSRLLRDIKPGQTEKHVAALLEYYMAEYGSDGKSFDTIAASGVNSASPHAVPTDKKLENGDFLTLDFGATYDGYHSDMTRTIAIGKV-TDDMKKMYDAVLFANLDAMKAIRADISGKVADSVARSTLDAWGFGKYFGHGLGHGVGLEIHEAPSASPSSQYTLKEGMILTVEPGAYISGKYGVRTEDMVVVTNDGCRNLTN--TTKDLIII 359
153 0.000e+00UniRef50_A0A0P6YQ78 Uncharacterized protein n=1 Tax=Ardenticatena maritima TaxID=872965 RepID=A0A0P6YQ78_9CHLR  ali  27  1MSTHRFHRLQTAIANADFDLVALVPGANLTYAANVSERLHMLCIPAEGPVVIAPALEAPAWDGLPRVFTWRDETGPSAILRDVVSLYGWGSWAIEFNNMRYAEAIRRAAPNAVFSPAEPLLTRLRMCKDADELASLREAIRITETALQRAIEAVAPGVSERHIANVLRMAFFELGSEGLAFEPLVVAGPRSAHPHAHPGDRAIQPGDVVIIDCGGVSHGYHGDITRCLALAPVPDIIQR-IYDVCRQAADAGRAAVRPGVPAEAVDRAARRVIEEAGFGAYFIHRTGHGLGLEIHEPPYIVEGNQEPLEPGMVFTVEPGIYIPDVGGVRVEDVVAVTENGADVLTT--FPRDLITI 363
154 0.000e+00UniRef50_A0A1V5VIH8 Putative peptidase n=1 Tax=Elusimicrobia bacterium ADurb.Bin231 TaxID=1852873 RepID=A0A1V5VIH8_9BACT  ali  32  8.FDERIKQMRRSMKARGLDGYFTSSEQNIFYLTGYKDDNSMLLITRKNILLGVSGMNLSLAKKFLAGRSAVKIE-LLNSFYKFVSTSDLKKLGY-GAGLVLEKYRYLKKKGLHLVYNPGLIEELRSIKDDYEISQIRISCDISKRAAKFAFSLLKNGITEKQLTDEIELFFRRNGALKSAFDLIAASGKNSAYPHHQVSERKIGANEIVVLDIGCMYRGYCSDLTRTFLLGKIK-KYYKTIYNIVSEARSVALRTIKPGVAARDLDAVARGVIKAAGYEKYFLHSLGHGVGTEVHEYPYLSPKSSASLKQGMVLAVEPGIYLPDKFGMRIEDTVIVTEKGCEVLT........... 349
155 0.000e+00UniRef50_A0A1F9AHY5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_61_14 TaxID=1797834 RepID=A0A1F9AHY5_9DELT  ali  31  8.......ALRNLLQKLKLNGVIVSGLPNVRYLSGYTGSDATLWLSARVRLLFTDSRYTTQARAEAPDFQVIEYRRKAEEICQALKKRGVERAGFESGRLTHALYRRRHLRGVKLTPLRQELERLRAKKSDSELQKIQRAGEIARQALTRVMPMLKPGVREREVALALEHLMKQLGAEQVPFPAIVASGRRGALPHGVASNKKLKAGELVTLDFGCSYRGYNSDQTLTLCLGE-PSAKQKRIYEVVRQAQARAIAAIRPGASPRAVDARARDYIREQGFGEYFGHGLGHGVGLEVHEEPYLNSQAKGRLEAGMVVTVEPGIYIPGWGGVRIEDMVAVTATGARVLTQSSGPL..... 352
156 0.000e+00UniRef50_A0A1G0SGE0 Uncharacterized protein n=1 Tax=Ignavibacteria bacterium RIFCSPLOWO2_12_FULL_56_21 TaxID=1798438 RepID=A0A1G0SGE0_9BACT  ali  32  1MTKQRIDAVRRACASRRLQALVVAHLPQIRYLTGFTGSNALYCITKNASWLLTDGRYAEQVKDEVRGRAVIVKGRLFDACAQLIRLPRNARIGYDPASVSVAGFSQWKLPGRRWIALDGIVEAGMAVKDELEVAVLREAIAISEKVFREILRILRPGVRESDVAAEITYRHRLLGAEADAFEPIVASGVRGALPHGRASDKKIRSGELVTIDFGCRVRGYHSDITRTVAVGR-PSYRLRAMYDAVLDAQTVAIDAVRAGVRGSDVDAAARRALRSHSLLRYFRHSLGHGLGLEVHEWPRLSPLSKDDLQTGNVVTVEPGVYVPGVGGVRIEDDVLVRPNGGLVLTSLP--KKLICL 356
157 0.000e+00UniRef50_A0A1G2X3G5 Uncharacterized protein n=4 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G2X3G5_9BACT  ali  33  18...................GFLITHEINIRYVTGFTGSESVLLITSDNDYLFTDFRYVEQAQQITWVRIVERKVSLIKTICEKLRRLNVKKLYVESSYLTFYQYDEIKRKGIHIIPTQGIVEKYRKLKTPEEIKKIQIAINIAESAYQSTRNKIRAGVSEKYLADILEFEIRKHGAEKSSFEIICATGSRASLPHAHTTDRKIQEKDVILLDWGACYQFYNSDLTRICFIDRI-SQNFKKIYQIVLDAQNFAIDSIRPGRIAKEVDYAARNCIEKKGFGKFFGHGLGHGIGLEVHESPSINKRSSEILEEGMVFTIEPGIYISGWGGIRIEDIVLVTSEGCNVLTNVQKKLSEIVI 356
158 0.000e+00UniRef50_UPI000A0780D8 aminopeptidase P family protein n=5 Tax=Alicyclobacillus TaxID=29330 RepID=UPI000A0780D8  ali  29  7.YRDRIRRLDAVLQQIHLDGVVITSPASLYYFTGVWERPTALIIRPKEPVWIVHEMFANEVSSADVKKVWKDGVSPYPLIGEAVGIN--ARLAIDGNWAARHVIKLMATRPTEPVVADAVISALRERKDADELSKLERASAMADEVVGKLKTMLRPGMTELEATEMLEQLWEEAGSEGLSFPIIVAAGANGAAPHHEPDHSKIEEGSTVIVDTGGIYQRYVSDTTRTFVVGE-PTEEIRKVYECVLRAQQIGIETAKPGVRLGDVDAAVRQYITDQGYGPYFTHRTGHGVGLDIHEEPFVVAGNEAVLETGMVMSVEPGIYLPGKFGVRIEDLVVIEEDXARSLNQSPKALEDVII 366
159 0.000e+00UniRef50_A0A2H5Y5G2 Putative peptidase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5Y5G2_9BACT  ali  30  16............MAEESLEAVFITYLPNVRYLSGFTGSAAVLCITPRQAWILTDFRYWEQARQAPDFTLYRLSRRFVEVLPEFLKEIGPRRVAFESAHLTVDQWMREATPDVEWVPIKDWIEAMRAVKDEEELARIREAARIADATMAYLRRRLRPGMTEREAAWLAEQYLRTHGGDDVAFDVIVASGPNAAMAHHHPGDRRLKVGEPIIVDLGARVDSYHSDSTRTFVLGRMP-RRFRELYAIVLRAQEVAIRNMRAGMPGKEIDALARAVIEEAGYRDAFGHGLGHGVGLEIHEKPSAGPIAEDPVPAGAVLTVEPGIYISGWGGIRVEDMVVIDTDGVEVLTHASRD...... 358
160 0.000e+00UniRef50_A0A1G5HRF0 Xaa-Pro aminopeptidase n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A1G5HRF0_9DELT  ali  33  5.YRKRLDTLQDTLSRNGFDACLIMQEENRRYLSGFTESAGALLIGPKGLILATDSRFELHAHEAPLFDVHVYKTGLDKDLPELLDRVGASRVAFEETRVSVGRFNAFAAATAELVAHEDMTAPMRAIKSADEIQTMREALAIAEAAFSAVKANLTPGLTEKAIAWEMEKEMRSRGADGLSFPTIVASGPNAALPHAVPGDRKVAPGEPLLIDWGSRYNGYCSDSTRTVVLG-SPCDTFKRVFDTLFEAQARAIDAICDGASGKTVDAVARGFIEQT-FPDGFGHGLGHGVGLEIHEAPRLSYLKDHTLKAGMVVTVEPGIYLPEWGGIRLENMVLVTENGAEVLNT.......... 361
161 0.000e+00UniRef50_A0A1G9ZVR6 Xaa-Pro dipeptidase n=1 Tax=Tenuibacillus multivorans TaxID=237069 RepID=A0A1G9ZVR6_9BACI  ali  27  2..EARLNNLTQALKKHSIDSVFMTSKENVFYFTNLHERLIGAYMDQKGNILIAPALEKEDVKNAGWLITYFDHENPWDKLSSFIKDIGPQSMAIEKEDLNVLNYETLKFPKTEMVNGQHFLNELRLIKDHHEMKILKEAAQYADFGIETALKHIQAGKTELDIIAEIEYAMKKEGIRDMSFGTTVLTGKKSAAPHGNPDLTPIQKSDFVLMDLGVVHKGYCSDITRTVVFGEA-SEQQKGIYHTVLQAEQKAIEACQVGTRLGDIDQVARQVIKDAGYGEYFPHRIGHGLGINVHEFPSLASNNDSVLQEGMSFTVEPGIYVPEVGGVRIEDDVFITGDGPTTLTEFI--KELIEL 363
162 0.000e+00UniRef50_E7RHW7 Peptidase M24 n=1 Tax=Planococcus donghaensis MPA1U2 TaxID=933115 RepID=E7RHW7_9BACL  ali  31  6......DRFHQLMDQLELEGILLTSFENIRYLTGFSGSNALVYVTRQDTFLWTDQRYEIQSQQQSPQCKIDISREAIKQFAKKIKETLTGKVGFESDSLTVSEFDKSAAGSVEWIPLGNEILQIRAVKTSEEIVLLKEAIRRADCAFSKVLPYVKEGISEVELKVELEYLMAKEGHEGAAFGTIVAFGERAALPHAIPTARKLKRGEMALIDFGLNYEGYMSDMTRTIKFGPIANEE-STIFDLTLNALEASIDAVASGVKLSDLDEIHRSLFRKAGVEKYSLRGLGHGVGLQIHEYPRVVEKGPGALEENMVFTIEPGLYFPDRYGVRIEDIVLVDSSGCEVLTQTPR....... 350
163 0.000e+00UniRef50_A0A2E2UPZ0 Aminopeptidase n=1 Tax=Trueperaceae bacterium TaxID=2026798 RepID=A0A2E2UPZ0_9DEIN  ali  30  3..........KEVQKEGAEALLVTNPANIRYLSGFTSEDAIVLILPRRAVLVTDGRYIAQAAEESSLE-VKITRPWLEWV---IKELDGKTLAIESEHMAIATFDELRTHEVEPVRVSGLIEKQRLNKNDSELEFLKQAAEITDAAFSHILGFIEPGRQEIEIALELESFIRLAGAT-TSFEIIVASGPRTAMPHGLASQRVMESGELVTLDFGAKVSGYHADMTRTVSLGK-PSNSHRAIYEEVLKTQLASLEAIASGVSCAHLDQLARSQFRQAGLADQFSHSLGHGVGLEIHEAPFLSANSSDMLDSGMVVTVEPGVYFPGDVGVRIEDLVAITNSGAEILSKSE--KNLLEL 342
164 0.000e+00UniRef50_A0A1F7AEL2 Uncharacterized protein n=1 Tax=Candidatus Peregrinibacteria bacterium RIFCSPLOWO2_02_FULL_48_14 TaxID=1801900 RepID=A0A1F7AEL2_9  ali  34  3.....................LVTHLQNLRYLIGFTGTSGFMLMEGKKNWFFTDFRYKGFAEELVPFRFVEVNKNFEQELEKRAK----GRIEFESRHMAVDELKAWKKRKNSFVPMKHPIEELRLIKDRDEIKKLKKSQEINEETLKRVLKLLRPGITELEIAWRIKVIGHDLGAEDISFEPIVAFGPHSAVPHHQNSATKLKPNNVVLIDMGMKFQGYCSDMTRTF-LPKKPTTEQIKIYEKVLRAQTLAIEALKAGVKCAKLDEIARKSMEKD--AHSFGHSLGHGIGLDVHEAPNLSSHSKDILKKGMVVTVEPGIYLPGKFGVRIEDMGLVTKTGYDNFTQFEK....... 330
165 0.000e+00UniRef50_A0A1F9VIW2 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFOXYA12_FULL_49_49 TaxID=1797954 RepID=A0A1F9VIW2_9BACT  ali  31  1MRLDRLKIVQSMLKS---GCYLVNSAPDLFYITGVNLDGYWLCVTKSGYEIFAPPLAAEHLQRVLPGARINNCEELFLTFSAYLKKNGFKKVFVNPSRVSLALARKLRKAGAELLDC-DFAGQARLVKDNSELENIKKACKITLNAFKYARQLAKPGITETEISFKIEEYFAKNLA-RAAFLPIVAFGPNTANPHHLSSERKLAGNDIVLIDIGCSVNGYCSDLTRTFFLGKINAQK-KQVYNLVKNAYSRAVKSVKPGASASQVDKTARRVISRKGYGRQFIHSTGHGVGLEIHEAPRLSKSDKTVLRPNMVVTVEPGVYLSGEFGVRIEDSVLVTKNGRKVLTQ.......... 341
166 0.000e+00UniRef50_A0A1R4IEJ6 Proline dipeptidase n=6 Tax=Lactobacillales TaxID=186826 RepID=A0A1R4IEJ6_9LACT  ali  28  1MNQA-LERLKQTIHEHNLDLLYIDDPSLIGYFTDFHERLLALFVLKDRAFLFTPFLEENDARAVPDILSYKDEENPWEIIQTKLISFNYQKIGIMENNLTVDRYNQLLSDNPKTLDISNIIQSIQLIKSKTEFNKMVIAGKMADKALEIGINTLKVGISEQEVVAEIEFQLKKLGISEMSFQTMVLFGDHAGSPHGTPGARKLKDNELVLFDLGVVAEGYTSDVTRTFAFGEI-SSEAASIYDVVLKAQEKAQAAVKPGITTGELDNIARTVIEEAGYGDYFTHRLGHGLGKTVHEYPSLSKGSTMEIKEGMCFSLEPGIYIENKIGVRIEDCVYVTSDGCIPFTHTPKKLTSII. 364
167 0.000e+00UniRef50_A0A1J4W0X2 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium CG1_02_49_10 TaxID=1805289 RepID=A0A1J4W0X2_9BACT  ali  27  8..RSRLSKVRALFKKSGIDALLVASPPNVFYLSGFKGTDSYLLITGDEGYIITDRRFIREAGSLEAFKTELRERRIEDTAIALAGRIKVSSLGFSENELSVYAHKRLQSHKVRLVACGNPVLEMRATKDAGEISTIKKAVRITKSVLRNASEFIKPGLSERGASLKLLNKLIEAGVDDKAFDIIVASGPNSARPHAIVTKRVMKNRDSVIIDIGARYHGYSSDLTRAFHLGRINS-KLKDAYSIVKEAQALAIDSIRPGSRASDIDDIARAFISKNGYGKNFLHGLGHGVGIDVHEAPGISAHSKDVLTPGMIFTVEPAIYIDGIGGVRLEEMVLVNDKDCEVL............ 351
168 0.000e+00UniRef50_A0A259UW20 Aminopeptidase YpdF n=10 Tax=Firmicutes TaxID=1239 RepID=A0A259UW20_9FIRM  ali  30  3......KQLLAYMEKAGLDGFFIAARENVRYISGFTGADSYLLLTREKCYFITDLRYTEQAGECPAYEQYVWGKTIGDALNYLAEKHNLKAIGFEGGTISYDQYHDFKNVRAELVPATGVIEKMRSIKTPQEIEYLRAACEIACRAFSRIVKDIRVGVTEKELAAKLSMYMVVEGADTQPYGNILISGARTSLLHGIPSNKAVEYGDLVLMDFGCQFNGYMSDMTRTVVVGK-PSAKQREVYELEKRMLEDSLAAMKAGVPLRDVYKESVRAIEGTEYYGYHYTGIGHGIGLFVHEIPFMSPNSDEVLAAGNVRTIEPGIYIPNWGGIRIEDQILITADGYENM--ISTTHDLIEL 354
169 0.000e+00UniRef50_A0A2M8NVX5 Aminopeptidase P family protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2M8NVX5_9CHLR  ali  27  9.YSARHAKLIGI---TGVDAVALVPGANLTYFTGLDFRPTVAIFSDAGLAFIVPELEVPRIAQKTYLEVWSDKDGFMGAFEQATHKLKLTSLGVDGLTMRVFERDAFAEARVAIHNVGKQLLNIRAIKTEDEVDLMRQACRMSETALHRLMTIVKAGMTEREIAETLTRYLFEAGCDSLAFDTHVLIGENSALPHGTISSRVLGADEYLLIDYGGRYNGYPADITRTFCLG-TPSEKMREIYQIVLEANLAGIAASKAGVPCGDVDKAARDVITQAGYGEYFIHRTGHGLGLEVHELPQIASDVTDVLEVGMVFTVEPGIYIPGFGGVRIEDNVYITENGAEVLTHFPK....... 363
170 0.000e+00UniRef50_A0A2K8NR84 Xaa-Pro dipeptidase n=2 Tax=Entomoplasma freundtii TaxID=74700 RepID=A0A2K8NR84_9MOLU  ali  32  14.......KIRQLILDNNIDAILLTSKQNRYWATGFLNSSGYLYVDLKRAILFVDGRYKTDVINKAKDCEVFIVKNVFEDINQEINKFGIQSLGIESEYLTFIEMLQEKVQVPIIKPVS--VRSLRMVKTKLELAKLAKAAEIGDKALIEVLRNFKLGKTEDELENEIFASFIKQKADKI-FPRVVLSGERGCLPHGKPTDKVIHEGELLTIDFGCVYDGYCSDMTRTVAIGEV-SEELRKIYQIVKEAQAAGIRNAYPGITGAELHKIVWNVIDGYGYADYFVHQTGHGIGLEVHEAPRVASYDNTILEENMVVTIEPGIYIPGVGGVRIEDMVQVTKDGGKCLTKLNN--ELINI 359
171 0.000e+00UniRef50_A0A2E2N5X6 Aminopeptidase n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E2N5X6_9BACT  ali  30  14.YVERLKRLRASMRALDVDHLLVSNPVDVGYLTGFLGGDSYLLVGPRKPLILSDRRYEEDLEAIRDTATVKMRDGMWALVAELVSKLKLERLGVQPEHMTLAALRKAKVGSKSITTASGVVGSLRAVKDEGEIAAIRKAARVQEAAMLATRAELRPGMSEIEICAMLEEAMKSRGSSRPAFDTIVGAHANASRPHYHPAAAKTKNGKGLLIDWGASVDGYRSDMTRCFCFGKWP-RELREIYGIVLDAHEAAAAALRPGARCADIDAVARDHIAKSGYGDNFGHSLGHGLGMDVHERPSLSRHADAELEEGHVVTIEPGIYLPGVGGVRIEDDYAITARGAKNLCSLPKDID.... 376
172 0.000e+00UniRef50_F2LV84 Peptidase M24 n=6 Tax=Desulfurellaceae TaxID=117942 RepID=F2LV84_HIPMA  ali  33  1MRENRLNKLKEKMEEASIDAVVLFSDSDIKYFCDINVEGVFVLI-KDEVKLFVSSLYFQKAQEKLKEDAVL--SNSLDNIIEYLQSNKIKNIGLDFAKTTVKQLKAFE--GFNIIDFSNQTLTIRAIKEKEEINNIKRAALIARNALLKVYPTIKTGITEKELADELAYQLRKNGAEKEAFDTIVASGPNAAYPHHKPTDRKIKEGEFVVIDFGASIDGYNSDTTYTFLIGEK-TDELKELFNAVFYAQLFATEMIAPGTTAKQIDARAREELAKRNLDKYFIHSTGHGVGLDVHEFPFLNPTNDMVIQPNMIFTIEPGIYIPNKLGIRLEHMVLVHENDTEVLAFAPF....... 344
173 0.000e+00UniRef50_A0A0C7QNY9 Xaa-Pro dipeptidase n=27 Tax=Clostridia TaxID=186801 RepID=A0A0C7QNY9_PAESO  ali  26  17..................DAIFLTKRSNVNYISKFTDEAAFVLACKDKFYLITDGRFTELAKECVGFEVVNWHRNLIKAVSHICNENGVKKLGFERSNITFDRYESLKLSNVDLIGTDGLIESLRYVKDETEASYIKKACEIGDKALEELVPHIKVGVSEKELCARLEFYLKMNGADEIGFETILISGAKTSLPHGKPDNKLIEDGDFVTIDFGAKYNGYISDMTRTFIVG-NPSEKQLEIYNLVKEAQLVGLSKIKAGILAFEPDQAIREVIKK--YEEFYYPGIGHGIGMDLHEEPFLGNYGTKVIEKGCIITMEPGLYIPGFGGVRIEDSVIVKDDGIEILT--KFPKELMIL 355
174 0.000e+00UniRef50_C0QQ42 Xaa-Pro dipeptidase (X-Pro dipeptidase) (Prolinedipeptidase) (Prolidase) (Imidodipeptidase) n=5 Tax=Hydrogenothermaceae TaxID=224027  ali  26  4.....LDKIHNKIRKEGLDSFFFTGSADIFYMTYFSSTNAFVLLTDRDRFFITDGRYYEAAKELKDWNVILLGENHIDHLKEILKDLGGKKIGFQEDKVTVSFFKKLTEDRSAFVGYEGFLNDIRMVKTEKEIEIIKEAVKKTDIIFSKIVQEIKDLKTELDVRRRIIDLIFQMKGTGESFPSIVASGEHSAIPHYETSDHRVKWNSPLLIDMGMRYKGYCSDFTRTLFLGNV-DPELKKVYEIVKEAHLSAVEKVKAGLPVKEIDLAARDVIQKSGYGDYFIHSTGHGVGIEIHEAPRISKNSEEIIRENTVFTIEPGIYLPGKGGVRLENIVVCRKDKAEVLTTTALDILLV.. 358
175 0.000e+00UniRef50_A0A2H6FCG6 Putative peptidase n=1 Tax=bacterium BMS3Abin07 TaxID=2005715 RepID=A0A2H6FCG6_9BACT  ali  28  7........IRNELSGKRLDGILISDIVNIRYLTGFTGSTAMLFVGLKRVIFFTDFRYKYECEDFLEYEEVIVKTEFLRDVKKILISAGVRKLGFEYG-AQYRVFEKLR-KSFRLRALKGLVENIRMHKDEAEIVNIKLAARRAEDAFDRTRKWIRAGITERKIALTLETNLKKAGCKRIPFDIIVASGKNSALPHACVTDKKIQRGDFVIIDWGGEANGYVSDITRTFLINNGNISEKKKIYNTVLAANRRAIDSIRNDIPCREIDRAAREYIIDKGYGNYFGHATGHGVGLDVHERPSVSSASKDKMSDGLVFTIEPGIYISGIGGVRIEDMIMLERGRKKCLTTLPKSLEIL.. 351
176 0.000e+00UniRef50_A0A2E9XBW4 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2E9XBW4_9ACTN  ali  33  12...QRVKRLRTLLKDSKIDGLMINDMVNIFYLTGFTGSSARLFINEHEAKIYTDKRYEEQAEISSKVFDVDIGSGPQQELVLVTDMKSCRSVGFESDSLSWTEARKELLDDKKVIPTVGIVEGLRTVKDDAEIERIKAAATIADAALAAVKQELANNPTEVEFARLLDQTMFNQGADALSFETICASGPNSALPHARPSGRTIKTGDLVVLDFGAVIDGYHSDMSRTYCIGDPSSESQL-LLDAVAKAQDAGVVAVRPSAECAAIDAACRNKLADCGLEELFVHGTGHGVGLLIHEAPWLNSRNETKLQAGHVVTVEPGVYRPGFGGVRIEDTILVTQEGGRLLTLAPKD...... 361
177 0.000e+00UniRef50_A0A0G0LD08 Peptidase M24 n=4 Tax=Candidatus Woesebacteria TaxID=1752722 RepID=A0A0G0LD08_9BACT  ali  28  1MYQTRLKKLQNLLKAKNLSGLLVTNPYNIFYLTGFSEREVTALIDKTGLTLFSPRLYQEEVKSLSNIQIIKARHELVESSKSFFAK--VSRIGIEAKNLTLFEYIKLKKEDTKLIVTEDIIENLRVIKDNNEIEYVKQAVKITDLAFQAIKKAIKPGLTETQIAKKLIEEMEKYGADGLAFEPIVASGKNSALPHYSTTNNIITQG-IILIDAGASYKGYKGDLTRTFYLG-IPDSKFVKTYELLLSVQEIILKNIKPGMTGEETWKLTNALMDKE--SKYFLHGLGHGVGLEIHEAPYLRKGMQKKLSPGMTITIEPGLYYPGWGGIRIEDYIIVNESGCHVLSKTPKRLEDIII 361
178 0.000e+00UniRef50_D9QRW8 Peptidase M24 n=5 Tax=Halanaerobiales TaxID=53433 RepID=D9QRW8_ACEAZ  ali  30  2..EERITALREKLTELDLDGIMINNLQNKYYLSGFTGTAGTVIITDQEAVLITDFRYIEQAENQAIDFKIIEHGNPXXXXXXXXXXXXXXXXXXXQESYQQYQQYQKKLGSLELVPTKDVVKELRIIKDESELNTIQEAVKIADDAFLHITEYIEPEMTEKEVSLELEYFMKQKGASAKAFDFIVASGKRGAMPHGVATDKEIAAGELVTFDLGSVYQQYNSDLTRNIIVGSEPTEKQQEVYETVLEAQLAAIKAIEPGKTGTEIDKVARDVITKAGYGDNFGHGLGHGVGLEVHEGPRLAQGKDEELRPGMVVTVEPGIYLSGWGGIRIEDIVVVTEEGCNVITEAP--KELI.. 354
179 0.000e+00UniRef50_A0A1G8JWT5 Aminopeptidase P family protein n=10 Tax=Aerococcaceae TaxID=186827 RepID=A0A1G8JWT5_9LACT  ali  28  1MYQQRLQKLVAKMKQDDITNHIVSDPLSIYYFTGYKERLFALNISSDNQHFIVNALFPEDIKENFQIEVFKDGEPIMKRVAHHL---GQGPIGIDKFWASFLIELMNLAPHLSYVDGSYLVDELRAVKSPQEIQWMKESSELNDQAMEQIVKLLEKGLPEAEMVEKLGKIYQQLGTDGFSFEPIIAYGANGANPHHETNDDTPQLGDSVVIDMGAYYKNYASDMTRTVFYGE-PSEEALKVYDTVKRANEAAIKAVKPGVPYSEIDKAARQIIEEAGYGEYFTHRTGHFIGLDVHEAGDVSEHNPELTEVGHIFSIEPGIYLPGKLGVRIEDLVVVTEDGCDVLNR--FTKEPLII 361
180 0.000e+00UniRef50_K4LV03 Creatinase/prolidase n=2 Tax=Thermacetogenium phaeum TaxID=85874 RepID=K4LV03_THEPS  ali  31  26......................VAKPENTRYLSGFTG-EALLLVTGEVGYLFSDGRYEEQAREAPGWEFVRFKRSFTEVLRDLCRELGLRELGFEKDYLTYQQWEQLKDGSGVLRPVAGLIEGLRLIKDDYEVGLIREAGMITAAAFRYVLGEMYEGQEEQEIAGILELYMRQQGGGPPAFEIIVASGERGALPHGTASGKKVRRGEFITLDFGARFQGYAADLTRTVAM-RSLSTKQREVYELVREAQERALKVIRAGVTAAAVDAAARSFLEEAGYGGYFNHSLGHGVGLAVHEEPRLAPGQDQELKPGMVVTVEPGIYISGWGGVRIEDTVLVKQNGCEILT--PVTKDLIVI 357
181 0.000e+00UniRef50_K9EQ32 Uncharacterized protein n=1 Tax=Alloiococcus otitis ATCC 51267 TaxID=883081 RepID=K9EQ32_9LACT  ali  29  4.....LDKLQAQLKDQDIDLALITRPQLIDYFTGYMERILALFVSPTKHILFAPYLDAQDAKDQVSCPVYKDEEDPWQVIKDLLSQFSPNRVGVEDSQLTLDKYKALSLRDSEFIDIGSLLDGLKLIKSKEEKDRLLEAGDLADKALQVGLNALKVGISEVEVVAKIDYEMKKLGVSKMSFPTMVLFGDHAGSPHGVPGSRKLQAGEFVLFDLGVLYQGYASDMSRTVFFGEPEDDQDKAVYQTVLKAQETAMEAAKPGMTAGDLDKLARQVIDQAGYGQYFIHRLGHGIGQTAHESPSISSSNTSNLQAGMAFSIEPGIYIPGQVGVRIEDCVYLNEDGAISLTQSPKNLQFL.. 364
182 0.000e+00UniRef50_A0A0G1TX90 Xaa-Pro dipeptidase n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1TX90_9BACT  ali  31  1MIQSRLARVRRLMHTERADAFFVFNNEETRYLSGFSGSASVLAVTRRICFLMTDGRYFEQALEAPGVILVRLGEQPVEWISNLAKKEHWKRVLVDGIVTSAADFLKKRLRGVNISVAPGFLQQIRTVKETDEVKNIGRAAKIAAGAFHKFLKTIKIGETEKLLAARLDFFMKECGAERIAFDTIVASGANGARPHAQPTDKKIKKGEFITFDFGAVYHGYACDITRTAALGRI-SPALRSLYEAVRAAQRAGCLAARAGITGAALDEVCRAVLREHGYEDYFLHSTGHGLGMEVHELPIVSRANSKKLPAGSVITCEPGVYVAGLGGVRIEDDLALTKTGAKNLTRMITT-DLITI 363
183 0.000e+00UniRef50_A0A2R6MUZ7 Aminopeptidase P family protein n=1 Tax=Halobacteriales archaeon SW_7_71_33 TaxID=1919205 RepID=A0A2R6MUZ7_9EURY  ali  26  132.HDRRLRECKRRLAEADTDAVVLFPGSNLQYLTGFDEDPGLLFVTPETHALLCPELYEEQVLAETHLRVWSDADDPRAATAATAEAVGVARVLVDERWTRFALDLRAVMPDAKLALATELLGDLRIRKDDDELDRLRAVAEVTDEVSRAVRELDPTGWTERELAREIEARLLEGGCTGPSFETIVGSGPNGARPHHSHGDRTIEPGDPVVLDFGGRLAGYPSDQTRTVVWGDDPPERFREVHRVVREAQRRAVETVEPGVPAAAVDRAAREVVADAGYGERFVHRTGHGVGLDVHEPPYVTGENDRELEPGMVFSVEPGVYLADAFGVRIEDLVVVTEDGHERLNDSSRDWQ.... 497
184 0.000e+00UniRef50_A0A1J0LSY2 Proline dipeptidase n=2 Tax=Thermus TaxID=270 RepID=A0A1J0LSY2_THEBO  ali  33  1.....MQDLRNLLEPLGLDALYITRPENVRYLSGFHPEDAQVLLSHEGAFLLTDPRYPEAERESAKVLRREEKEGLFQGLR--------GRVGFEAEHLPYAALERLRLSPAEWVPTKGVVERLRLKKTPEEVAAIRKAQALAEEALAHALSLLKPGTAEREVAFELEFFLRRRGAEGVAFPPIVASGVRGALPHAGASEKPLRAGELVTLDLGAKVAGYHSDMTRTFALGQV-EGELKTAFQAVLAALERALEALRPGRTGKEVDALAREELGRYGLDRYFVHSLGHGVGLAVHEGPSLSPYTEDVLEPGMVVTVEPGVYLPGLGGVRIEELVLITEDGFELLSRFPR....... 340
185 0.000e+00UniRef50_A0A094PHJ0 Uncharacterized protein n=2 Tax=actinobacterium acAcidi TaxID=1504320 RepID=A0A094PHJ0_9ACTN  ali  28  2....RAKRLFETL-DLGASGCLLTDLADIRWLTGFSGSHAWLVVHNQTMHLLTDGRYVDQAQHQAEVEIVECRTQSAMQIAVASLTSGASFVQFQDTQVSYQLFQSLSEIKATLVPLHGSIKFLRRFKDETEIELIETACRIADQALDKCRPLLSEGQTESDVRDELDYTMRKLGADGPSYDIIVATGPNAARPHHHPTMTKIGNGHTVIIDVGALVAGYHSDMTRSFVIGPM-NDEQSRYYEAVHEAQQAGVAACRPGVLASDIDSACREVLADAGLAQYFTHGTGHGVGLVIHEEPFINSSSTAILQPGDVVTVEPGLYRGGFGGFRVEDLVVITEHGCRILNSSPKPLQLTI. 363
186 0.000e+00UniRef50_A0A257A8D8 Uncharacterized protein n=1 Tax=Desulfurococcales archaeon ex4484_217_1 TaxID=2012518 RepID=A0A257A8D8_9CREN  ali  34  1MYAKRLSRIRDILFSKNLNCLLLTDTSNIFYISGFKGYEGFLLIPKDEPTLFVPKLEYDRANEESRIH-VEYYENYKKALVEKIEHTMCRKIGICYKHVPHHILIRNKISNVKVIDISEDIANIRMIKDYEEIERIKRAVEIAEKGLEEALNIVGEGISELKVAAKVEYTMKIMGSEETPFTTIVASGPHAALPHAVTSDKIIRNSEVVIVDLGATFKGYVSDLTRTISVGKVR-EEIKDMFRAVLEAQKAAIKAIKPGIKAADVDNEARKVLKEYGYEKYFIHGTGHGIGIDVHEPPALRRESDTKLRKGMVVTVEPGVYVKNLAGIRIEDDVVVTDT................. 341
187 0.000e+00UniRef50_A0A1Q7C8K6 Uncharacterized protein n=11 Tax=Bacteria TaxID=2 RepID=A0A1Q7C8K6_9ACTN  ali  29  11.....LADIREWMANRHLSAAYITHPVSIAYVTGFYERLMALVVRPDGGTLIVPAIERQKAAAQAEVVAWRDGEDPYALVSTALG--GSSEIAVEKGHLSLRAAEVIRTGASELVDVGEEIRRFRLIKHEDEIDKLLRAAAITDAAGDEVFSRMRAGQSEVDVALMIGSVIGKLGGT-LSFETLVQSGPNSALPHGKPSSRNLEPGDFVLLDFGAAFQGYKADTTRMAVVGD-PSARHVEIHDLVLAAHDAAIATVRPGVTTGDVDAAARRVIEAGGYGERFFHRVGHGIGLEGHEDPSLDPGSRMILESGMVFTIEPGIYIPGFGGVRIEDDVVVEDGGCRVLTKADRSLRVI.. 364
188 0.000e+00UniRef50_G7V616 Peptidase M24 n=1 Tax=Thermovirga lienii (strain ATCC BAA-1197 / DSM 17291 / Cas60314) TaxID=580340 RepID=G7V616_THELD  ali  27  9..NKRLDKLREKTLKKASDAVFIYNWQSCYYFSGFTGSSGAVVVTQRDAFFITDARYTTQAAFEVPFDVVDRKGSLIDGAIELMKKLSVKRLGVQEDKMSVSLYFSLA-KEFEMFDVSQDVSSIRREKTKEEVDLIKKACDLAACALKDTVASMKDVRTEKEFDALLEYNLAKIGADGGWQDFIVASGARSALPHGRASDKAFSVGEWITVDFGARYKGYVSDITRNVFLGDIP-EEWKDRHEILLEAQRAAAQVLRPGARCADVDAAARNVIEKAGYGSAFTHGTGHGIGLDVHEAPTLSPSSKDVLVVGDVVTIEPGIYIEGVGGMRVEDNYVITPQGAECISSA......... 359
189 0.000e+00UniRef50_A0A2H5WVN4 Aminopeptidase YpdF n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5WVN4_9BACT  ali  31  15.YAARRVRLQQMLFERAPDAALITQIANVSYLTGFTGSSAWLVLLPDRAHLITSGIYATQIGMEVPDTVYSPGEESGAILAGLLQSWGVRTLGIESNSLQFVKGLRKHLRKARIAPLKGVVEKMRLVKDAYELAQIRAAVAIADAAFEHVQRMLQPGVAEWDIAMEIDFYIRRQGAY-PAFETLVVSGERSALPHGKPTERKLERGDFVTLDFGARYQGYCSDLTRTVVVGYA-SQEHRRLYHAVLDALERSLGAIRPGKTGRAIDKVARRTLEKYGLADYFRHSLGHSLGINVHDGVGLAPREKTKLQPGMVLTVEPGVYLPGFGGVRIEEDVLVTETGCEVLSRSPRTL..... 370
190 0.000e+00UniRef50_A0A285N4I7 Xaa-Pro aminopeptidase/Xaa-Pro dipeptidase n=2 Tax=Hydrogenothermaceae TaxID=224027 RepID=A0A285N4I7_9AQUI  ali  28  2....KVDKIQEKIVKESLSSFFVSSQPNIFYLSRFKSSNAFILLTPDKKIFITDSRYYEGAKELKGWELIKDNKNQMEHLREILNEYGGERIGFEEDRTTIFFYKKLVNKKGELIGYAGFFDEFRISKTEEEIQIIKEAVFKTDKVFKQIVDYIPKAKNELDLRREIINSIFIEGGTGESFPAIVASGKNSAIPHHETSYQKIEKNSPVLIDMGMVYRGYCSDFTRVVFYGKV-DPEIEKIYEIVKEAHLKAVEKVKAGVPVREIDEAARSVIKKYGYGDYFIHSTGHGVGIEIHEPPRVSEKSEEILQENTVITIEPGIYIPEKGGVRLENIVVVRKNSCEILTETPLDK..... 359
191 0.000e+00UniRef50_A0A1H0CBN4 Xaa-Pro aminopeptidase. Metallo peptidase. MEROPS family M24B n=12 Tax=Bacillales TaxID=1385 RepID=A0A1H0CBN4_9BACI  ali  29  3....RIEVLQEEMMKNNWDVLMVQTQPNVFYLSGFHERLLGMVIFKDAAPLICPNMEVNQIKEQGMIIGYTDSENPWAKVESYIDDNNLSTIALESS-ISWSRLEEWKKPDAHFSEADSLLLKQRVIKSPEEITYLEEAAALADEGIQTGIDSLKEGITEMEVIAAIEYALKRKGVREMSFSPMVLFGEKAGDPHGNPGARKLKKGDGVLFDLGVMWKGYASDITRTVFFDHV-NEEQQQIYDTVLAALHNALDLVKPGQKIGTLDTAARETITEAGYGEFFPHRIGHGLGIEVHEFPSMNAENTDLLQAGMTFTIEPGIYVPDKSGVRIEDDILVTEDGARSLTSYP--KELTII 362
192 0.000e+00UniRef50_A0A0G0JTP3 Xaa-Pro aminopeptidase n=2 Tax=Candidatus Daviesbacteria TaxID=1752718 RepID=A0A0G0JTP3_9BACT  ali  30  2.....LDKIKNSLKTRKVDAVLVSSHANITHLTGYSEREAYLFITEDAQYLLTDGRYTEAVKKVAHFELIEVSSTLSEALKNLAEKHGVVILGIEEDSLTVSEFKVIKKIAKKVKSFR--VSEHRTIKTLDEIEKIERACDLADKTFEFILGKIKPGKTEKELAFEMENFMRQNGAV-PSFETIVAFGPNAAIPHHHTGDDILQENNLILMDFGCKVDNYCSDITRVVFLGKA-SIEQKKVYSIVNEAHNKAVEYLKSSVDSQKVDEIARKYIDSKGFPPY-SHGLGHGVGIEVHEFPRLSMKSKDKLLPGMVFSIEPGIYLPGQFGVRIEDLYVLEENGIRALTKSP--KEII.. 355
193 0.000e+00UniRef50_A0A0B3W046 Peptidase M24 n=5 Tax=Clostridiales TaxID=186802 RepID=A0A0B3W046_9FIRM  ali  33  3...NRVEKIRDLIKERDVDALIIKGKNNKRYIGALTGSGVYVLITKEKKYQILDGRYTDEADKKTSGFIVVSQGSYIPNIIELLEELNIKNIAIESQAMSIQEYISLEKAGFDISLITNELGKVRAVKSKEEIELIKKACEITDEVFSQVISEIKEGMTELEVSALLQYYALKKGASGMAFEPIIASGARGAMPHGRPTNKKLKKNEAITIDFGVVYQGYQSDMTRTISIGEPP-KIIREIYDIVLKAQLSSIESIKEGVKASDVDKVARQIIQDHGFGDYFNHGLGHGMGLGDGEVPTLNKRSDDILAEGMVMSCEPGIYIPDVGGVRIEDDIVIIDGKGVSLN--KTSKDFIIL 354
194 0.000e+00UniRef50_Q67R80 Putative Xaa-Pro dipeptidase n=1 Tax=Symbiobacterium thermophilum (strain T / IAM 14863) TaxID=292459 RepID=Q67R80_SYMTH  ali  31  55...RRFEAVRQFLRERGMAAGLVTGPISMRYLTGWSNRFAGLVIPADGPALLVPALEVEEVRSASALRLWQDGEDPFAALSGMLRAAGAGRIALEQADLPVGQLRRIAAPSVLLADLSPALSAQRESKDEDEIALLQQAADMLNPALDAALAAIRPGVTEREIARVLEEAMLAAGADGVAFETHVLFGPASALPHGSTGARTLEPGHVVLMDFGAQLRGYRSDITRTVCCGAWPD-ELARVYDVVLAANQAAIAAVKPGVPLGDVDRAARQVIEEAGYGAYFIHRTGHGLGLEIHEEPYVVAGNEKVLRPGHVITIEPGVYLPGVGGVRIEDDVVVTEDGCRVLTSWTKER..... 417
195 0.000e+00UniRef50_A0A2H5YJV1 Aminopeptidase YpdF n=11 Tax=Bacteria TaxID=2 RepID=A0A2H5YJV1_9BACT  ali  32  1MNR-RVQRLMDSMGAAGLDALLVGSPANRRYLSGFTGSVGWLLVTMDAAFIAVDFRYYEQARQAPDFVLFKANGAIESWFAKLVEEAGLKRLGYEPHAMTVATWQSLQKAVQELVAAPALVEELRAIKEPEELEALERAVALADEAFLAVARRLEPGWTEAQVAWEIEKYAREHGAESLSFPTIVAAGEWAAMPHAYPRERPIREGEPIVIDMGVRVDGYCSDLTRTIVLGR-PDDRLRQVFDIVLAAQLTAEELVRPGMKGEEAHMLAHNVIAEAGYGEQFGHGLGHGVGLLVHEAPRLAKRSQDELKPGMTFTIEPGIYIPGWGGVRIEDIVVLEESGARVLSRAPK....... 367
196 0.000e+00UniRef50_UPI000D3E0E51 aminopeptidase P family protein n=1 Tax=Euzebya sp. DSW09 TaxID=2052804 RepID=UPI000D3E0E51  ali  30  12....RVGRLQAAMAEAGIDTLLVTELPSVRWLTGFSGSAGRALVRASGPVLVTDDRYTLRAKEAPAAEIVIDRT--WGWLGDADID---GPLAVQAEVLPWAVVRELALEHVELVPTEGLLAGVRAVKDAHEIAALRRACAITVEAFEAALGWIAPGLTEREIARRLLDDMTRRGAEASAFDPIVAAGPNGAVPHHSPSDRPVGRGELLTMDFGARVDGYHADMTRTVAVGAVASD-LGDLYDLVRRAQQAGVEAVRDGIGAKELDAVCREVITDAGHGADFRHGTGHGVGLMIHEEPFLGIQATGTLRDRMAITVEPGVYVPGLGGVRIEDVVLVGHTDGERLTTA--SHDLIVL 359
197 0.000e+00UniRef50_A0A2N6FJX9 Integrase n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6FJX9_9DELT  ali  30  1MINKRVAKAEAILHDHGLAAMIFTDLNNIRYLSGFTGTDGVLILTKDSLSFLTDSRYTTQAREQTECRVIEYKDKLDGISDFLANQPDKGRIGFEGSILTFQVYLEKAGPEFEFVPVKDTT-SLRAVKDRDEIGKMRSAADISARALDSILGLLQPGITESEVALELEIAARRLGSERKAFDFIVASGVRGALPHGVASSKRIDRGDVVTIDFGSCFEGYYSDETVNFAIGTIST-EMQKIHNIVKKAHDLAIKSIKPGVLLSDIDKIARDFISEKGYGVNFGHGLGHGVGLDVHESPRVSPLATMRAEEGMVFTVEPGIYIPDLGGIRIEDMVVVTAAGCDCLTRLPKELRLL.. 355
198 0.000e+00UniRef50_A0A1I4RBZ3 Xaa-Pro aminopeptidase n=1 Tax=Thermodesulforhabdus norvegica TaxID=39841 RepID=A0A1I4RBZ3_9DELT  ali  32  1MKEARIEKVRKWMASAGLDAFIVTEPENRYYLSGFSEISGFLLITETELAILTDARYGEQAEEAPDFDVLLYGEGACETVARVLAESGAKRCAFEDHHLSVETFLKEMGKSVEFVPARRCVEGMRAVKDEEEIELIRESLQLTESVMEEVLHLLGKGLSERDIAWFTERRMRETGAEALAFPPIVASGPRSALPHASPTHRIPGLGEPVVIDIGARKNRYCSDMTRTFFLGQIPRKWIER-YKIVREAQMAAQEAIKPGIMTDQVDRIARKIIEDAGYGDLFGHGLGHGVGLAVHELPRLRKSSSTMLEPNMIVTVEPGIYFKGEGGIRLENMVRVTEGGFEILNR----KSLFIL 366
199 0.000e+00UniRef50_A0A2N6DXZ4 Uncharacterized protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6DXZ4_9DELT  ali  30  1MFLPRRALVDEILESEGLDGIVFSHPPNLRFLTGFSGSTGCLLVTSSGVGFLTDSRYTTQARDQMVDVEVREAKILHKSVVEWLTELGCRRVGFEEETLSCSEMRRLREADIVWVPFERSLQMLRCRKDKEEIATLEHAATIAEAAFTEVLPRLRPGTIERDFATDLEFAIRRNGGEEKSFDFIVASGPRGALPHGIAADRVMQEGDLVTIDFGVRYAGYHHDETVTVALGEV-SDTLRSIHDIVLRAHDLAIDAVRPGARIPDVDAVARDYIAQCDYGDFFGHGLGHGLGLEVHEWPSLSARTDSPLQEGMVITIEPGIYLPDVGGVRIEDMILVTASGARVLTKIDK....... 350
200 0.000e+00UniRef50_A0A081BFX5 Xaa-Pro aminopeptidase n=2 Tax=Lactobacillus TaxID=1578 RepID=A0A081BFX5_9LACO  ali  29  2..ESRVEKLRQLFNQYRIDAYLVANPFNLKYLLGIDTGDGYGLITENEVLYITDDRYGFELGREFPNLKTLLTRDYLGALSEAVENLGVTVLGFEPS-IAYETYDQLELMPSDIVPLGGLIEGLREIKDADEIKAIETAGKMTIAGLDDVIDQLQPGMTETEVANQLMINMLKRGVTGTSFDTIVASGYRTAYPHVVPSDKAIQPGELVTIDCGFYFNGYTSDVTRTFVFGEA-TAKQQEIIRIVDEARQSVIDAVRPGVTGAELDKVGRSIIDQAGYGEAFVHGMGHGIGLDIHEGPNIGRRFEEPLQPGQIITVEPGIYLEGFGGVRIEDDVLVTASGKTVLTR.......... 346
201 0.000e+00UniRef50_D2B6P5 Proline dipeptidase, putative n=8 Tax=Streptosporangiaceae TaxID=2004 RepID=D2B6P5_STRRD  ali  32  8.HARRRESLAALLPAHEADAILVTRGVNVRYLTGLASSNAAVLVRADRATLATDSRYAETARRSCSDIEVVEERDVAGCLVVMAD-----RVAVEAHHMPVADYFRL---GEDLLRLSGLVESVRRVKDEAEIDLLRDACAITDQAFADVLPMLRPGVTERDIARALESRMIELGAEKPAFDSIVASGPNGSIPHHSPSGRPLERGDLVTMDFGALHEGYHADMTRTVAIGE-PASWQRELYDLVRAAQRAGRHAVRPGAAPHEVDAAAREVIAQAGYGDYFGHGLGHGVGLEIHEVPFLSPLKPEPLEDRVPVTVEPGVYLPGRGGVRIEDTLVTRDDGPELLTR--TTKELLVL 358
202 0.000e+00UniRef50_A0A1I6MN51 Xaa-Pro aminopeptidase n=2 Tax=Granulicella pectinivorans TaxID=474950 RepID=A0A1I6MN51_9BACT  ali  31  6.YKARQKKAVRRVGKL-AEALLVTHLPDVRYLSGFTGSNAALVLVGAKAMLFTDGRYTAQAQAEAVGTKVTIAKSAVVAACEWMEAAGVTRCGFDGTQTTVAALTRMEAGLSKFVDVGALVARLREVKDEDEIAILRRAALLGCGLFDHMLGFIEGGMTEMAVAAELEYRARLAGSEAMSFETIVASGERSALPHGRATLAKIPKRGFVTLDFGVVVDGYSSDMTRTVHMGRARGPGERDVYDLVLEAQESAVRAVKPGASAGDVDEAARSVLRRAGLDGFFSHSTGHGVGLEIHEGPRLAAKQTQTLEAGMVVTIEPGVYLPGSFGLRIEDMVLVSAVGGEVLTPSPK....... 370
203 0.000e+00UniRef50_A0A1J5ND86 Putative peptidase n=43 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1J5ND86_9DELT  ali  30  6.FEKRREDLKSEMHARGLSAMLVSLAANRYYLSGFEESSGWIVVTPGDDYLFTDPRYLDAARQVWNLCIYAARK--HKEIAEFLKGRGVDALGFEPKALHLFDYDKLSE-NFDLTPTENIVESLRIIKDEDEIRRMDESMRLNHELFEYIEGELIPGRTEKEVAWLVEKFFREHGAQELAFSTIVGVGPNAALPHCIPGDTLLRENDMVLIDTGCRLLDYNSDQTRTFWVGDKPSDRFKKTMDQVRAAQQAAIDIIRPGLTCVEAYRAAYAVFEKDGVEALFTHGLGHGVGLETHEPPSLSRVGQGELEPGMVVTVEPGLYDPAWGGIRWEYQVLVTDDGCRVM............ 355
204 0.000e+00UniRef50_A0A0J7HQ90 Aminopeptidase n=1 Tax=Chitinispirillum alkaliphilum TaxID=1008392 RepID=A0A0J7HQ90_9BACT  ali  29  4....RIHLLKEQLEEHNCTHALITDCIDIEYISGFKSSNVILLVSESKSVLFSDFRYKSAASKNPEWEFMLIDKENFGFLSQHIPK--GSSVGIQTNVITVDQYRDLRKAGVKFVKFSQQINSLSLQKTQTEIKHMEKAARIADSAFSEVLNRIEEGMSEMQLAKILERLCDDFGSEGPSFETIVLFGKRAALPHGKPGKQKLKKGDFILFDFGCSVNGYKSDMSRTIVAGKA-SPKQKEIYHIVYTAQSMARKSVEAGKRCKSIDLSARKIITDAGYGETFGHATGHGIGLRVHENPRINSTNKLILQTNTVITIEPGIYVDTLGGVRIEDMVAVSNKGSKLLTHSP--RELTEL 356
205 0.000e+00UniRef50_A0A1V5ZZF9 Putative peptidase n=1 Tax=Firmicutes bacterium ADurb.Bin153 TaxID=1852883 RepID=A0A1V5ZZF9_9FIRM  ali  29  5MFTARLD-------GYGIDGMLVTKEQNRVYLSGFTGSAGALLITRAGYILVTDFRYTEQAGQQAQFKVVTHGAGFYKCVMEEAKKLGVTRLGFEAQELTVEQFTEAVAGGIALVATKGAVEKLRVVKDDGELEKIRKACRLTDRLFDHVLGTIRPGMSEKQLAMEMEIWMIKNGMSS-SFDTIVASGVRGALPHGRASEKLMQKGELVTIDFGGFFDRYTSDMTRTVCIGKA-DARQKEIYDIVLASQIAGVEAARAGLTGKEVDSKARVMIESKGYGQYFGHGLGHGVGLEVHEEPRFSVTDESVIEPGMVISVEPGIYIPGWGGVRIEDLVVITAADAEVL--YESPKHLIEL 353
206 0.000e+00UniRef50_A0A2E5E0T9 Aminopeptidase n=6 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E5E0T9_9BACT  ali  32  18..RARLEGLRARMVKSEVGGLLVSAENDIWYLTGFVGHSALLLVTAERAVIICDRRYEEQAWDACELFEVVARHKLGHEVKRLAGEEGLSRVGIESMTISFRDSLAASIEGLELFPTTGLVSHLRRCKRPEELALIERAIAIQEQALEESLAELRPGMTEFEFTSLLEYRLRMAGASGASFEPIVGSGPNSSVIHHMPSDRPIEDG-MLLIDWGARVEGYCSDLTRTMCFGPMPEP-MEQVYGIVLEALESAIEACRPGADCAAVDAVARDVITDAGYGDQFPHGLGHGVGMNVHEEPFFSNRSATLLEPGMIMTVEPGIYLPGIGGVRIEEDVLITETGHRVLASWPRSLE.... 372
207 0.000e+00UniRef50_A0A2N5ZLH5 Xaa-Pro dipeptidase n=1 Tax=bacterium BM706 TaxID=2053465 RepID=A0A2N5ZLH5_9BACT  ali  33  3.....................................DSTFILIEGNDIKIITNFIYFDHIKECPDGKLIMFSGDLYDHFSKR------RKYYFEAGHMTYSMFEKFKDRSISLLPGGEMIEKVRSCKSEDEIDKIRKAVKITDKTFRDVIKFIKPGKTEKEVSDFIESCQKKYGASKNSFDTIAAFGENASLPHAVVSDTVIKKGKMLKMDYGARYQDYCSDMTRTVFVGKA-DKRFKEIYGIVLSAQLKAIDAIKPGVKAADIDKVARDYISKKGFGDRFGHSLGHGLGIDVHENPAVSSRSDKKLEEGNVITVEPGIYIPGWGGIRIEDDVVVRKDGPEILTAS--TKKIIEI 318
208 0.000e+00UniRef50_A0A1F9VHU9 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFCSPLOWO2_12_FULL_59_9 TaxID=1797952 RepID=A0A1F9VHU9_9BACT  ali  32  7.....IRDFQNSLKEYGLDGYIVTHQSDLNYLTDFPQEGFALLVGRRKVWAMLPMLLKDHFQKSVPGCEILAAVSLLPALSKITQKHNLRRVGFDSEKELYARGKSLKDAGC--VETPSLLAHLRAVKSRRDLERVEKACAMTAAAFRLLKPNIKPGRSEISVARELESLMTQLGGEGVAFETIVASGPNGALPHHRSSEKIIGKDQAIVIDFGCVYKLYRSDMTRTVFTGK-PNGPYARIYGLVEKSQRAGMLKVRPGVAAGDVDEASRRVIARAGYGKYFIHSTGHGVGIDIHEPPRVAPKSREKLRPGMVVTVEPGIYLPGRFGVRIEDTLAVTSKGSRILTQ.......... 344
209 0.000e+00UniRef50_A0A1I0G7T7 Aminopeptidase P family protein n=1 Tax=[Clostridium] lavalense TaxID=460384 RepID=A0A1I0G7T7_9FIRM  ali  30  5.HRQRLDRLSQALKEEGLTQMIVSDPLAIWYFTGVDERLFALYARADGGHLILNKLFTVACTGLP--EVWTDTDDTVGILAQAVD--PSADMGIDKNWARFLLALMERNPGVRYVNSSGCVDRIRAVKDEDEQEKMRAASRINDACMEAAAAYLREGLTEKEVSEYVSKLYRDAGCEGLSFGTIVSFGAHAADPHHEPDNTALKKGDCIVIDMGCRKDRYCSDMTRTFFCGE-PEPEYAAIHDLVREANEKAEAMIRPGVRFCDIDRTAREHIEAGGYGPYFTHRLGHSIGLEDHEFGDVSSANTDTVKAGMTFSVEPGVYLPGRFGVRVEDLVLVTENGCEILNHVEK....... 354
210 0.000e+00UniRef50_A0A288QC72 Xaa-Pro aminopeptidase n=1 Tax=Weissella soli TaxID=155866 RepID=A0A288QC72_9LACT  ali  28  4....RIENVRRLFEKLDINGLIVTDGDNMKYLTGFYGGDGLVLIGAEKAALITDARYEDDMRKLPEDVQLLVTRDYWGVAMAAAKRYAITKLGFE-DTIPYFDYIDENFVGEDIAPVPGLVEAIREVKDEQELNALRKSAEVAVAGFEELLTVVHVGMTEREVANTLDAIMRRRGATKASFDTIVASGVNSSLPHAEATDKVIETGDLVTIDFGYYVDGYTSDVTRTIAFGEI-DKELKIIYDVTKQANEATLAATHAEMASAELDAVARDVIAQAGYDKQFTHGLGHGVGLAIHEGPYIGKTSEDLLHAGMLLTIEPGIYLTGKGGVRIEDDIIVTTDGMENLT-AGLTKELIVI 357
211 0.000e+00UniRef50_UPI00083323CA aminopeptidase P family protein n=3 Tax=Christensenella TaxID=990721 RepID=UPI00083323CA  ali  30  6.....IEAIRN---TDKADAYLLSSVQNVAYATDFSGDCSQLLITANGAYFFTDFRYTEQARKEVENAEVIETGGGDRLINEYLSGNAIRTLGIEKDDVTVKVFEGYQEPYYSYVDIAGDLLLLRMVKTGEELAKIRKAAKANETALSELLPFIKPGVSELDIRAELEYRMQRQGMD-LAFPTIVAAGLNSALPHATPTGYKLCEGDLLTIDFGCRYQGYCSDMTRTFGIGNI-DGQRKKIYDIVKHAQESAAMAAVPGADTLAVDAVARDIITDSGYGKHYDHGTGHGVGRFIHELPVLNPRSSSILEENMVYTVEPGIYVPGTGGVRIEDM-HIGGQG----SVYTFTKDLILL 351
212 0.000e+00UniRef50_I4C9V6 Xaa-Pro aminopeptidase n=1 Tax=Desulfomonile tiedjei (strain ATCC 49306 / DSM 6799 / DCB-1) TaxID=706587 RepID=I4C9V6_DESTA  ali  28  6..........SKLNQLRVDAILLNSSENLRYLTGFTGSDATVLITPSEGHLLTDGRYKTQAKEETTGLEIHIVRSRLDSAARLIKARGIKRLGIEAGRMTFGRELTRRVRDLLLVPLSRVVETLRIRKTPAEKDKIKTAAKIASNACRDVLKGALVGRKEADVAADLELLFRRGGAEGTAFETIVASGPRAALPHGAASDKVIQPGELIVVDYGCRFQGYSSDETVTCIVGKA-SKRQKEIHKTVYDAHMRALEAVREGVSVRELDRIARQSIDHAGYGKYFLHGLGHGVGMETHEAPYLSPRGKGVLQEGMVFTIEPGIYIEDYGGVRLESLVYLGGSGPEILSEMP--KDLI.. 354
213 0.000e+00UniRef50_A0A0P6Y1F8 Peptidase M24 n=1 Tax=Thermanaerothrix daxensis TaxID=869279 RepID=A0A0P6Y1F8_9CHLR  ali  30  5.....LEHLYNRLQQMGLDALVLIPGPNFFYLTHLQERPICLLIPGESPRLVLPAFEVQSLEKSPDLQAVPYPDDPTAAFAQAVRPLQGKRIGVEPTRLRFLELLQKALPNATFLSAEEALAALRLQKSEAEVASLRKAVEIAQVALQATLPAIRPGTSEREIASELYIQLLRAGSETPPFAPIIASGPNAANPHVTPEDRVLQLGDVVLVDWGATWNGYCADLTRVFGLGNIP-PDLKVAHEIVLAANQAARARVRPGLPAGEIDRAARSVIERAGYGAYFTHRTGHGLGLEAHEPPYIYADNTLPLATGMVFTIEPGLYFPAMGGIRIEDNVVVTETGC--LTLSDFPRDLI.. 364
214 0.000e+00UniRef50_A0A0F9Z3F5 Peptidase M24, Xaa-Pro aminopeptidase n=1 Tax=Candidatus Peregrinibacteria bacterium GW2011_GWF2_33_10 TaxID=1619065 RepID=A0A0F9  ali  31  5....................ILITNPINVRYLTSFCGSFGQILITKKKIYLLTDPRYFDYAKDQSKITIICAKKSTYKTLQHLLKKHQIQKLYFEPNHLTVAELTKLKLPTTHLLPSQNSIENLRCQKTKEEISLLQKSQQINENILQIIVKNLKNGLTEKAIAWQIKELAFQNKCEDLAFEPIVAFGKNSAIPHHHNTDKKFSKGDIILIDMGVKYQGYCSDMTRTFFT-KKPSQIEQNIYSIVLEAQEKTINEAKVGFNCTKLDAIARNSIKKHGYKKYFTHGSGHGIGLNIHEYPSLSEKSLDIAPINAVITIEPGIYLSNQFGIRIEDMILLTENGVTSLTKFPKKIKEICI 360
215 0.000e+00UniRef50_A0A2W5XPE2 Xaa-Pro dipeptidase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W5XPE2_9CHLR  ali  30  16...ERLARLRKRMAELELDAVIISRPANSRYLSGFRGYSGTLFVTAFEQLLLVDFRYLEQAATQVTWRVVRTAAPMAIVIANLLADHGVLRLGLEAESLVHARWAALAAPGTELHAIDAELAELRIVKEPAEVAAIEAACQLGDQALVYLLDRIRPGVTERALAAELERFFIDNHAEGTAFDPIVLVGPRAAMPHGAPGSTPVEAGSVLLLDYGCQVDGYRSDMTRTLFVGEV-SEQVRRLHEIVREAQRRAIEAVRPGVSGASVDAVARQLIEESGHAEHFGHGVGHGIGLETHEAPRL-LTFEAPLREGMVFSVEPGIYLAGVAGIRIEDIVVVEAHGARRLTASRR....... 372
216 0.000e+00UniRef50_A0A2M7EAW9 Xaa-Pro dipeptidase (Fragment) n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2M7EAW9_9BACT  ali  30  3....RLNRVQEKVKKKKLDGFLITNLKNIYYLSSCSGSGIKVLLTGKSALFFSGLLYDEEAKEKV--------KEPFRILSKIKPKKGLRTLGIEENSLSLKDYRQLQLPKIKLVPCQDFVEEFRAIKEQEEIELLKKAAMATKKAFSSLAKELKPGISELKIAGEICSQLRKNGAEGESFPPIVASGARSSFPHANPSEKLIKENEPILLDFGGSFKGYQSDFTRTLFLGKI-GEKENRLNKLLKKAQDLAIVRIQPGVMASEVDQAARDFLKTAGYGKYFIHNLGHGIGLDIHELPFISLETKKRLKPGMVFTVEPGIYIPGWGGIRREDTVVVTETGCEKL............ 337
217 0.000e+00UniRef50_A0A221MA75 Peptidase M24 family protein n=4 Tax=Bacillales TaxID=1385 RepID=A0A221MA75_9BACI  ali  29  5.YRTRLNALQDYLSQNNVDIAMITTPANVFYYTGFHERFMALIMDKKQCILFVPTLDKEIADSESFVKTIVDEEDPFAKLKENLQG-NIVRFGLEMKTVSMFQHRHLAFPEAAYDDIQPFINAQRLEKSRSEIVYVQKAVDIIEKVLAEGIKKVKIGMTELELSAELEYLMKKFGAEGPSFSTIVLSGEKAALPHGTPGNRSFQNGDFLLIDMGVVIDGYCSDITRTFIIGEA-TDKQKEIYDIVLKSNQAGIHAVKAGVPLKTFDIEARNIIKKSGYGDYFNNRVGHGLGIEVHEEPSIHENNDQTAKKGLLFTIEPGIYIPGYGGVRIEDEVYINEKGAEILTS--FSKDLQIL 368
218 0.000e+00UniRef50_A0A1J4YRU2 Uncharacterized protein n=3 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1J4YRU2_9BACT  ali  32  1MFTENQNKVIKHLSAKNIDAFLVTYWADIFYLTGIELGEYFILVTKKGLTAISSPLLYDQLKHLLPDFNIIKTTNPIKTLREVFRENKIKSVGIDTRTINAELLSKLRNKSVKWKEKPGYISRIRQVKSEKEVALIKKSCEITRKVLSSIKKYLKPGMREKTVVDKIVELFSRYG-TVPSFTPQVASGINASYPHHIASDKVIEKNDVVIIDLGCRYKGYCSDMTRTFFMGR-PDKLLRKIYNVVKEAQKQARRKVKSGVRADSVDRVARGIIKKYGFGKYFIHSTGHGVGIEVHEQPRLFAKDKTILKTNMVVTVEPGIYIPNSGGVRIEDTVLVRE.................. 339
219 0.000e+00UniRef50_A0A2M7KL03 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7KL03_9BACT  ali  31  1MSETRLDKLRTEMESRRLDGLLLSDLTNVRYLTGFTGTAGLVLLTRKDAHFFTDFRYETQAAKQVRGRVHLSRNGLGPTAAVAANRRRLKRVGYEADYVSVHSHRELKSRRASLHATRGLVEELRLCKDEGELAAIEQAVALADDACASAASLMRPGLTEIEVSLELERHMRLNGAQKASFDFVIASGKRSALPHGVASPKKLEPGDLVVMDLGCLYEGYCSDLTRTFCLGE-PTPRQQRVYATVRDAQLLALEGLREGLTCKRADSLARTYLEGRRLGKRFGHGLGHGVGLAIHEGPRLSAKSRETLRAGMVVTVEPGVYFPGWGGVRIEDMAVITATGSRILTQSAKP...... 351
220 0.000e+00UniRef50_A0A1F5H0H1 Uncharacterized protein n=2 Tax=Candidatus Curtissbacteria TaxID=1752717 RepID=A0A1F5H0H1_9BACT  ali  31  1MY-NRLVKFQKALKKQNLDGFIVTNPVNIFYLTGFKEREGILVFSP-KATLITAKLYQAEALKLRKIKIADERNKILDAISKVLKGKALAKVGFEEQDLKYLEFKEFKLKNTRLVPCKNLVEDLRIIKSPEEIKSIEKAQLISQKAFQYLLKTIKIGSTEAEIADKLSKIIKDLGGQGLAFESIIAAGTNSALPHYKTGNRKIKNGQVLLFDFGAKYQHYCADLSRTVFVGKVNTQKH-KVFQLVQKAQKKAIDSISQGIKTADVYQAAYKVFKDSKVNQYFLHGLGHGVGLEIHEAPRLKPNNDAKLLENMVFSVEPGLYFPAWGGVRIEDLVVIKNGRAKVL............ 370
221 0.000e+00UniRef50_A0A2G4IGP0 Xaa-Pro dipeptidase n=3 Tax=unclassified Gemmatimonadetes TaxID=234665 RepID=A0A2G4IGP0_9BACT  ali  32  9.REGRIARLRAGLLSAGLDALLISSRANTRYLTGFSGSSSLLVVSQAATVLITDFRYRAQVEAGAVVDLEIEGTSLWSRLWTVLPRLGVSSVGFESQHMLHVDAQRVVESGARWKPTANLVESLRQQKDAGELECIKAAVAIAEMALERTVPEIAAGRTELEVAARLEMWLRELGSEAHPFETIIASGERSALPHAHASRRELQDGDLIIVDFGAVSGGYCSDITRTFVLGRA-NAAQHDAYDIVREANATASAAVRAGMRGRDADAIARDYIERHGLGAEFGHSLGHGIGLEVHEAPRLAKTIDAPLTVGAVVTIEPGVYRDGWGGIRIEDDVWIGPDGPVVLT--AFPRQLMEL 365
222 0.000e+00UniRef50_A0A173LMI9 Putative peptidase YqhT n=17 Tax=Dietzia TaxID=37914 RepID=A0A173LMI9_9ACTN  ali  28  8.FAARRARVLEHLAKENFDGLLITDLNNVRYLTGFSGSAGTAFLATDGQTFFTDSRYAEQVKELDPGVEVEITSNYAGSVVSAALGTRGGLVGIDDANLTVAQLAGLRAHGIEFHSAGGHVEQARRIKDDVEVEIIARACTVADEAWTALVEQITAGRTERQVAADLEWHMRQAGSDGVSFDTIVGSGPNGALPHYHAGDRELASGDLVVVDFGAYVFGYASDCTRTVGIGTLGD-WQREIYEVTLAAQRAGTSAVIDGTTCKDADSAAREVISDAGFGEYFGHSLGHGVGLDVHESPGLSQSSSSTLLRGDVVTVEPGIYLPGRGGVRIEDTMVVTDGAPRVLTT--TSKELLEL 373
223 0.000e+00UniRef50_UPI000556024E aminopeptidase P family protein n=2 Tax=Hippea TaxID=84404 RepID=UPI000556024E  ali  31  1MNQERLNKLIEKMDEFNIDGVVLFNEADIRYFSNFK-SGGVLIVLKDQVKLFTNRLVYEEARQLLGDR-VELGSDLDD-IAKFLKSNGVLRVGFDFLRSTYAQIK--AFDEFEIVDFTNQTLMLRMIKDRDEINAIRKAAVVARNAFLKVYPYLKPGLTEKEIADELACQLKKHGAEKEAFDTIVATGPNAAYPHHQPTDRKIEEGDFVVIDFGAKVDGYHSDTTYTFLMGKKTDEK-RELFNAVFYAQLYSTEMIAPSRTASEVYKRAKSELAKFGLDKYFIHSLGHGIGLEVHEFPFLNEKNDMVIQPNMVFTIEPGIYIPGKLGIRLEHMVLVKENDTEVIAFTPF....... 344
224 0.000e+00UniRef50_G4Q886 Peptidase M24 n=4 Tax=Acidaminococcus TaxID=904 RepID=G4Q886_ACIIR  ali  30  7........LRTFLQEEGVQGIFIKGDSSIRYFTGFTGGESLLYVDALRAVLITDSRYILQAQQQPECEILEHQHGLFSVVDQVRPAW---RLALDGDYFSYATALQKALPKASFKNVNLVF--LRAVKSPEEQRKMFKAAAIADDAFHELIPHIKVGRRESELAAELEYNMRKRGAQKTSFDTIVASGVRSALPHGVASNKVIEEGDFVTFDFGCIYDGYCSDMTRTVVMGKA-APWQKEIYEIVLAANELGEEVLFPGKTGIEVDQAVRDFIASKGYGAYFGHGLGHGVGLDIHEKPNLNKGNPDPIPVGAIVTVEPGIYLPGKGGVRIEDTVIVTEWGCERLTLVE--KELMEI 349
225 0.000e+00UniRef50_A0A2E4RLA6 Uncharacterized protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A2E4RLA6_9ACTN  ali  32  9....RSERLLAALDERGLDQMIVSNRSNIRWLSGFTGSAGVLMVSARGHVLITDGRYTDQAREQLDDIEVRTCRTLSEQRLVLAEIASGRTVGAEATVMSHDEW-AACSADNELSPVDGILGQLRRAKDEVEIALIARAAEIATEALYSMGHLLVPGVSEREIRDELEFKMRKLGADGPSYETIVASGPNAALPHARPTTRQLADGDTVVIDVGALADGYHSDMTRSFVIGD-PNDEQQHWYQLVRESQMAGLASVAAGVNVRDVDRACRAVFEGADCADLFVHGTGHGVGLDIHEEPFLGASGDVELVTGDVVTVEPGLYRVGTGGIRIEDLVVVTPEGHRNLTTHPKD...... 358
226 0.000e+00UniRef50_A0A1V5UA04 Xaa-Pro dipeptidase n=3 Tax=root TaxID=1 RepID=A0A1V5UA04_9BACT  ali  34  4.NQLRVGELQNSLRAEKMDAFLISKMENIRYLSGFSGSTGYMLVDGKSAYIFVDFRYVQQVKKETSIEIIQTSRSQAGEVCEFIKKKKYKKIGVEGGHLSFGVFEGLIAKTQKLIATGGFIEKARMVKSKDEIALIKKAVELADVTFYEMVSKGRENKSESEVAAKLEYYMKCGGAQSPSFESIVAFGPNSAYPHYKPSADVIKAGDFLKLDFGAKLNGYCSDMTRTIFIGK-PSQKHIDVYKIVLEAQLTALSKARPGMRGSEIDKLARDVIAKYGYKDNFGHGLGHGVGLEIHEGPTVSSLGEVVVAENMVFTVEPGVYIPGFGGVRIEDIVVMGKTGCKILTKSP--KEILII 370
227 0.000e+00UniRef50_UPI0004215BBA aminopeptidase P family protein n=1 Tax=Shimazuella kribbensis TaxID=139808 RepID=UPI0004215BBA  ali  27  1MN-TRIDQLTDWMRLHKVDAAFLTSSANVFYLTGFHERLLGVWVFPDEPFLVCPLLELDRVKASGWVYAHRDGENTWAWMKEIFSDASGLNVAVEEDHLTYGRASRMQLGISNLVAIDEQIRTMRMVKDKKELQILKEAAKFADKAIQYGIASLKVGCTELQVKNHIEQKLREDGITHMAFETMVLFGERTALPHGEASNVELRDGDFVLFDLGVVVEEYRSDITRTVIFGSA-SKEQQKIYETVLGANEQAIDLLKQKKTFGELDQVARNHIARAGYGAYFTHRLGHGLGLEAHEYPSVSENNELPLQTGVVFTVEPGVYVPHIGGVRIEDMVYITEEGCEILTS--FPKNLQVV 365
228 0.000e+00UniRef50_A0A285UTN7 Xaa-Pro dipeptidase n=1 Tax=Salinicoccus kekensis TaxID=714307 RepID=A0A285UTN7_9STAP  ali  28  5.YHSRLNQFISAASDKNTGLIIITDPVNIFYFTGFHERYMSLIISAGESYLFVPALDRDAAAEKAHIIPISDEEDPFDILGQHLGA-SVHTIGVEMNVMTVAHQNGIQSNEAAFVDIQSEINALRVYKSREEVEGLKKAVALIEKVLDKGLETVERGMTEADLVAEFEYLMKKYGASGPSFSTMVLSGEKAALPHGKPDDTKLEDGDFLLIDFGVTYDRYCSDITRTFVIGEA-DEKQKEIYDIVRRSTQAGVDAVKAGVPLKEFDIAARNVIEEAGYGEYFNNRVGHGLGIEVHEAPSIHHLNEDIAKPGMVFTIEPGIYIPGYGGVRIEEEVYINEDGAEVLTNYPRDLREISL 369
229 0.000e+00UniRef50_UPI000497D811 aminopeptidase P family protein n=1 Tax=Lachnoclostridium phytofermentans TaxID=66219 RepID=UPI000497D811  ali  31  1MN--RVDKLREYMREKEIDLAIIESEVNRFYFTEVRCNMGTLLITEKEALLILDPRFSESAKKVAINCEVVESKDRDIFLYEFMRKNKGKRVATEEEYITVKRRNELEYGVIDSLSLDNKIKQMRRRKDSKEVEYLRKAQSIADETFLHMLEFIEPGRTENDLKMELGITMVKLGSENYSMNFLVAAGENSGFPHGGVKNRRIEKGDFVTMDFGGCIHGYSSDMTRTVAVGEL-TEEKKQVYQVVKEAQEKAMRKLAPNVPCVMIDSIARDVIGSYGYQDYFGHGLGHSLGLEIHENPRCNETSKDKLEPYDIMTIEPGIYLPNRFGVRIEDMVVITEDGYKNLTKSE--RDLIIL 355
230 0.000e+00UniRef50_G8P1S7 Peptidase M24 n=31 Tax=Bacteria TaxID=2 RepID=G8P1S7_GRAMM  ali  33  5.............ATAGMDALLVTHPPDVRYLTGFTGSNGALALSGGRACLFTDGRYKTQAKEVTGLRVVVEQKPATTLAAEWLAASGAKRCGFDATQTTVAGLERLKLHRAFFAPVEGLVARLREVKDADELVLVRRAADLGCSLFEGVLEHVVAGATEAEVAAALEFKARMGGAEAMSFETIIASGERSALPHGRATTAKLPRRGFCTMDFGVLLDGYCSDMTRTVHLGKA-SQREWDVYHSVLEAQQAAVAAVVPGISCGEVDEAARSVLRRAKLDKFFSHSTGHGVGLEIHEGPRLAAKQEQVLETGMVVTIEPGVYLPGEFGIRIEDMVLVTQTGGEVLT-AASPKAWIEL 352
231 0.000e+00UniRef50_A7HJW6 Peptidase M24 n=30 Tax=Thermotogales TaxID=2419 RepID=A7HJW6_FERNB  ali  28  1MN-TRLEEVKAKIFEKNVDAILVSNTVTTRYLSGFTGSFSALLITPKRHLIVTDSRYWTQVKEESTFELVKYIKTFLDTIAELINSMELQKLAIEKDRISAGYFEDLREKKIEFEDVSSLLLEVRSRKTEEEIEKIKVAVEIAQEAFKKMLEIAKPGMKEYELAAYLEYQMKLFGADDRAFDTIIASGYRGALPHGKASEKVIEKGEAIVVDWGARYKGYNSDLTRVFSIGE-PSDKVKEVHKIVYDAQQKALDSIKAGITGKEVDSIARNHIAESGYGEYFGHGLGHGLGLEVHENPSLSYRNEKPLEDGHIVTVEPGIYLEGEFGIRIEEDVVVRENGCEILSTLP--REIIII 360
232 0.000e+00UniRef50_A0A1F9XV70 Uncharacterized protein n=15 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9XV70_9BACT  ali  30  4.HEKRLKDLQHLLKKEKLDAMVVSRPLEQGFLTGYHMDGYLMLVSQTDVWAFMPKMFVDQFRSKVDFVSPSAPDNQLEAAILKIRENKFRKTVFEPETESYLRGQFWRKKG--LLEFKGLTAGLRAVKEGAEISILRKSCHIAAKAFKIVKPRIKSGRTEISVSRELEDIMQAMGAKGPSFNLIIGFGPDSALPHHETSDRPLKKNEAVLLDFGCVYNGYCSDITRTYFHGK-PGAEFKKVYAIVDAAQKAGVKKVKAGVKTAAVDKACREYISDAGFGQYFIHGTGHGVGLEIHESPTLNTKSRETLRAGMTVTVEPGIYLYGKFGVRIEDSVLVKSGGCEILTR.......... 345
233 0.000e+00UniRef50_A0A1H6RKV6 Xaa-Pro dipeptidase n=3 Tax=Alkalibacterium TaxID=99906 RepID=A0A1H6RKV6_9LACT  ali  26  4.....LNNVQHYMKSEHIDFLFFDDPLTVAYLTGFHERVTAAIIFEDVFWLLVPAMEAPSARAVARIISYKDEESPWALLKVALDTDAFQKIGIDEDSLLVSRYHSLQFPDASFVNSVSIIQNLRVLKQPYEIEILKEAGDLADKALEIGMASLKNGITEEEVVALIEYGIKKYGVKEMSFPTMVLFGDHAASPHGTPGKRQLKPNEWVLFDLGVVYNGYTSDMTRTVVYGKA-DEETKEIYTVVKEAQEKAQALVKPGISAASIDHAARNHIEKAGYGQYFTHRLGHGLGKSVHEFPDIAPGVELIIEESMCFSIEPGIYIEDFYGVRVEDCIYVTEDGAQPLTH--TSKELIEL 362
234 0.000e+00UniRef50_A0A101GCR0 Xaa-Pro aminopeptidase n=1 Tax=Atribacteria bacterium 34_128 TaxID=1635291 RepID=A0A101GCR0_9BACT  ali  27  1MNKDRLEKVKNKMIEKEINYLILSISENFLFLTGFDERMHLMIITQKGEYFILPEMSKEIFQKNIIILLWDETTNPSEFLRRIVKNNTDTKIAIDDKMWSHLLSIQEICPRAKFVKVSEVMLDLRLIKDDEEIKKLEKIADITEKVIEKIINEVTVGMTEKQLSTRIEFLFKELGADGISFLPLVASGANAAIPHHIPSNKKIQKGEFVIFDIGGILEGYRSDITRTICLGE-PTDEMKKVYEIVKKAHETACKEVSPGKKCFEIDKAARDVIENMNYGEYFTHRTGHGIGLDFHEPPFLLDNNERPIEPGMVFSIEPGIYLSEKFGARIEDIGVVTVNGFKILTN--FTRELII. 365
235 0.000e+00UniRef50_UPI0008395383 aminopeptidase P family protein n=1 Tax=Parachlamydia sp. C2 TaxID=1414722 RepID=UPI0008395383  ali  36  20..................EAILIEHPTHLFYLTGLTLSAGKLLISQQDACLIVDGRYYESCSSGQTLYPVSLLKD--ASIKDWLADHRIQSLTFDSENTSYQAFLKLSKPALSLIPAESPVKQMRLIKDEEEIRCLKQAAHLGYQGYEQVINLLRQGVKEAELAFELEFFWKKRGAQKLAFDSIIAFGVNSSMPHYRAGQTELQSGDHVLIDIGVVYQYYHSDMTRVSYFG-TPHPTIQTIYSIVEEAQQKAFDLCIPGTPIGKLDEAARSFITSKGYGEHFTHSLGHGIGLDIHEPPTLGPYANSPLQPGMVITIEPGIYLPGIGGVRLEDTILITDKGYENLTRQRR....... 356
236 0.000e+00UniRef50_A0A2B8TYK1 Peptidase M24 family protein n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A2B8TYK1_9BACI  ali  30  1MN-DRLQEVQTFLQKQGIPGGLVTSRHNIFYLSNFHERLIGIFVFPDEPIIITPAMEVPMIKEAGWILSYTDSDHPWVLVGHLIERNKMKKFAVEKHDISYFYIEKLQFGEVEFASLDSILTEMRLVKDANEIEILREAAAFADYGVKVGIEALKDGITELEVVGKIEFELKKKGIKEMSFSPIVLFGQNSSNPHGASGGNKLKKGDTALFDLGVKYKGYCSDITRTVMYGH-PNNELVRIYQTVLQANLEGLEASQPGTRIGDVDLFGRRVIQAAGYGDFFPHRIGHGLGIDIHEAPSINDVNDGLLKSGMVITIEPGIYHPNLGGIRIEDDVVITDSGYEVLT--KFPKELMIV 363
237 0.000e+00UniRef50_A0A1Q6XDM7 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1Q6XDM7_9ACTN  ali  31  1MN-ARAQKLVEKLEEP----LIVTTPANVRYLTGFVSSNVSVVVEPERVRLFTDFRYAGAARIVPDVEFVETRRETIAHMAEFLS----GTFAFESTNLTYRDYEQLRDGGLELIPRMGLVEGLRAVKGEDELEQIRRAAAITNQAYERIAEERFVGRTERELAWRMFEFFHELGAEEEAFDTIVAAGANGARPHADSGERVIEQGTTVVVDAGAVLDGYCSDCTRTFATGELPD-ELQRAYDVCLEAQLKGLEAARPGIEAKQTDAAARDVITEAGLGEAFGHGLGHGVGIDVHEAPHVAPTSTDTLVANNVLTIEPGIYLEGTGGIRIEDLVVITDGEPEVLTS--FPKELVTV 344
238 0.000e+00UniRef50_E8N5B9 Putative M24B family peptidase n=20 Tax=Bacteria TaxID=2 RepID=E8N5B9_ANATU  ali  28  1MYKKRYEKLQSLMQEHGYDILALNPGPSLFYLTGLSERPVVLLVPAGSPTLILPKLEKEKLSQQIPLQGVFFEDNPETWQASELLQLSHKRIGYEAVRLRALEFLMKSAPNADFLNAESIIATLRMKKDAEELNRMQKAVEIAQNALLATLPMIKPGKSEKEIASELTAQLLRHGSDEFPFYPIVSGGPNSANPHATPTERTLRTGDLLVIDWGASFEGYVADLTRTFAIGKI-DSELQKIAEVVLRANEEGKRVAHSQIPIGEVDKATRKIITDAGYGEFFTHRTGHGLGLEGHEPPYIFSENNLLIEEGMTFTIEPGIYLPGKGGVRIEDDVVITQEGCYSLSNL--SRELVML 367
239 0.000e+00UniRef50_R5EHQ7 Xaa-Pro aminopeptidase n=1 Tax=Clostridium sp. CAG:590 TaxID=1262825 RepID=R5EHQ7_9CLOT  ali  32  4.FATRREKLIKELMQEPVDAVLIKHPSNLYYYTGFTGGEAMFLITNDWPYVITDSRYYEQVEKECAGLTLVEKKGMAETIQELMVEDKKIHIVLEDD-MNLAQYMKLTQRNCSFSLGSKWIQMPRMVKDEEELAKIEQAEHIGDAAFSHVLDILKPGVSEREIALELEFFMKKQGALKLSFDTIVASGPNGSMPHAQVTDRLLQSGDFVTMDFGCVYQGYCSDMTRTVAIG-TPTDEMKKVYQIVLDANVRAMEQIAAGQKCSDIDAVARGYIAKQGYGTYFGHGLGHGVGLDIHEEPRFSPKCDVITTENMVITDEPGIYLPGQFGVRIEDLVVVKENGYRKLSQSE--KQLIIL 384
240 0.000e+00UniRef50_E6W7E2 Peptidase M24 n=2 Tax=Chrysiogenaceae TaxID=189770 RepID=E6W7E2_DESIS  ali  28  10..QARKEKLCQRYPLPDSEALLITKRSNLAYFNDFQGTSGSCLLWRQQLIFFTDPRYYSAACGQCYYDEIVCFEGAFDFLTDFLKSRPIRVLHVEPS-LTLEQWQLWKLSFLEIRPLVKPLAELRMIKDELELEEIRQSCAISINAFEQLRPLLAPGMREEEIAAELEYRSRRLGARKMSFDTIVAAGPSSAVPHHQTGSAVVEQGDALLLDWGAR-KRYCSDMTRTFFLGE-PDEELSRIYRTVLEAQLSAIEQLKPGVKLLDVDNAARSVIKSSGYAEFFGHGTGHSLGIDIHEFPGISPRSAEVAQPGMVLTIEPGIYLPGKGGVRIEDLIVVHADRLEILT-AAMPKD.... 359
241 0.000e+00UniRef50_A0A1G3PLE3 Uncharacterized protein n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3PLE3_9SPIR  ali  29  4.FELRLENVRKQLKAN--EALFVILPEDVGYLTGFTGDSAFCLITGAELYFITDGRFTQQYREETQVNEISPGNSLTKVLAELISGHTIQTLLLNPDDIKVSMMRKIEIPEIRFKYC-EVVREMRMIKDEVEIETIRRNIHITELGYHYILRNVEEGKTEIETAAMLEHYLRIQGAEKMSFDTICASGPRSALPHGRASMKKIEKNEIVLFDFGILKDGYCSDFTRCLYFAKILGSEFDKIHRIVLEALKAAQRAIRPGIPAKLVHMAAFDVIDRAGYGAFFTHSTGHGVGMEIHEAPRITTNSETVLSEGMVFTVEPGIYLPGKGGVRLEDVIAVRKDGAEVLTHTSYDL..... 356
242 0.000e+00UniRef50_A0A1M4UKT3 Xaa-Pro aminopeptidase n=5 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1M4UKT3_9DELT  ali  32  6.FGRRLAAVRRKVEALDLDGVLISLPENRYYLSGFTESSGFLVIGSSRQMLLTDFRYQEEAAHQARYDLVIYKEGWNQVLPDLFRDLEIRRLGVEAGHLTHKRFLEVQEAKAEAVGLEGLVEELRMVKEPEELDRIRAAVALTEQVFDRVWQDLRPGVTEKEVAWEIEAGIRRAGAEAVSFPPIVGSGPNGALPHAVPTDRKIAAEDAVVLDLGARLRLYCSDMTRT-WLGPRVPQKMREIYGIVREAQLAAMEAIRPGIDSHEVDRIARGIIERAGYGDAFGHGLGHGVGLAVHEKPGYGKKNSVILRENMVLTVEPGIYLPGLGGVRLENMVRVTASGCESLNR.......... 364
243 0.000e+00UniRef50_D8IID5 Possible Xaa-Pro dipeptidase n=79 Tax=Terrabacteria group TaxID=1783272 RepID=D8IID5_LACFC  ali  30  86..KTRIERLRAGFEKQYIDAFLVTDKTNLRYLTGFDLEDGGLLVTNTDAVIITDSRYQEALREFKSDEVVTITQDYWGDLNKICKGMKVSVLGFE-DTLSYRTFERLDLMEAAIVPFDRVVEKMRRVKDAGEVEKLRKATQLHDRGYNYLLSIAHPGMSERELALELDYWMKKNGASRASFPTILASGPNSAKPHATVSAHHLKEGDLVTLDFGYFVDGYTADMTRTFAVGQL-DQRLVELHHLIDAAQKNVISQLKVGMTGNEADMLGRKPLEDAGYGDYFNHGMGHGIGMAVHEFPSFGPTNRYKFRNNEVVTVEPGVYLPGVGGIRIENDVLVTHMGAEVLTKAPT....... 436
244 0.000e+00UniRef50_Q9S6S1 Xaa-Pro dipeptidase n=364 Tax=Bacteria TaxID=2 RepID=PEPQ_LACDE  ali  28  1MN---LDKLQNWLQENGMDVAYVSSPTTINYFTGFEERIFKLFAFKDEPFLFCPALNYEEAKASAWVVGYLDSEDPWGKIAEEIKQRDYQNWAVEKNGLTVAHYQALQFPDSDFKDLSDFIAHIRLFKTESELVKLRKAGEEADFAFQIGFEALRNGVTERAVVSQIEYQLKQKGVMQTSFDTIVQAGKNAANPHQGPSMNTVQPNELVLFDLGTMHEGYASDSSRTVAYGE-PTDKMREIYEVNRTAQQAAIDAAKPGMTASELDGVARKIITDAGYGEYFIHRLGHGIGMEVHEFPSIANGNDVVLEEGMCFSIEPGIYIPGFAGVRIEDCGVLTKEGFKPFTH--TSKELKVL 364
245 0.000e+00UniRef50_A0A0M2PN52 Metallopeptidase n=3 Tax=Bacillales TaxID=1385 RepID=A0A0M2PN52_9BACI  ali  28  2..EKRLMKLMNSLQEQDIEMCFIHSKENVFYLTNFHERLMGLFLFKEEPFFICPQMEAGQVKEAGWYEVVGYGDHPWERIRATLDKRDLKKLAVEKEEISFSEHLQQIINPEKIVSVEQILNEHRVIKDEKEAAILRQAADLADYGVQVGINALKQGISEMEVLATIEYELKKKGIREMSFSTMVLFGEKSGQPHGNPGLKTLSEGDFVLFDLGVVLDGYCSDITRTFVY-KSYEEKQKQIYDTVLQAQVAALQASKPGKRIGDLDLIAREIITNAGYGDNFPHRLGHGLGINVHEYPSMSHTNDAVLKEGMVFTIEPGIYVPSVGGVRIEDDVMITKDGFEVLT--KFTKKFTVI 365
246 0.000e+00UniRef50_UPI000C07E614 aminopeptidase P family protein n=1 Tax=Neglecta sp. Marseille-P3890 TaxID=2014781 RepID=UPI000C07E614  ali  30  17.....................LILSPVNRRYLTGFPSSAGAVLLTEEETYLLVDFRYFEAAQKAVKHCKVLRFDSLNEKITELLKKHVIKEVYFEQESLFLGQFKRLEKAAIDDATLDRELIKLRAVKTPGEIRKIEQAQEITDASFEHILPFIREGATEKEIALEIELFMRKQGADGVAFDLIVVSGVNSSLPHGVPSQKVIQNGDFVTMDTGALLDGYHSDMTRTVAVGSV-SPAQRDVYETVLQAHLAVVDNVKPGVQCSEMDKVARNII-DAKYPGTFGHGLGHGVGLDIHEEPRFSRLDSTICKPGMVITDEPGIYLPGEFGVRIEDMLLVTEDGCRSLTHSP--KELIIL 354
247 0.000e+00UniRef50_A0A1F5E292 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_13_52_12 TaxID=1797379 RepID=A0A1F5E292_9ARCH  ali  28  5.NRQRAEELMKRLGGDGFDALLLFPGPNIAYYTGLSERLAAALIPEGKPTFIVNQLEKELRGQTPWFKIWLEHEDPIAILAETIKDRCLAKIGIEEAPWGWVNRLQAALPKARLVDASDHIEHVRMVKTPEELEWIKTACHIADRALETGFSMLHTDMTEADLSDILTSEMKRLGGEQT--FPGVLFGDRAALPHGNPGERRLEPGEAVLVDMGCTVHGYWSDITRTVFYGE-PSPRHRKLYEIVLLANRTAFEAVKPGVTCESVDKAGRKVIEDAGYGEFFIHRLGHGVGLQVHEHPYIVMDNMIRLESGMVFSDEPGIYIVGEIGVRVEDTVACTQTGCESLT--KFNRNLLV. 364
248 0.000e+00UniRef50_A0A2U2S3P9 Uncharacterized protein n=1 Tax=Ardenticatenia bacterium TaxID=2099665 RepID=A0A2U2S3P9_9CHLR  ali  31  3.FAKRLRKLRQRMHAHELAALLVSEPYNRRYLSGFTGSAGVLLITHERQGIATDFRYYTQVRQCPDWELFQVGRDFEGQLAGLLRELGVGTVGYEAAHVSVETWRRWSAATATLVETVGLVEQLRQVKDEDELAAMRRAIAIAEQAWSQLLDVLRPGICEREVAWQLESSMRALGAEAVAFPLIVASGPNGALPHAAPSERPIQAGEPVVIDFGCVVDGYCSDLTRTVCLGQPSDARYEALWQLVQGAQQAALRGLRAGLSGAEGDRLAREVITAAGYGEYFGHGLGHGIGLAAHEAPRLNPTSSDELPAGAVVSVEPGIYLPDWGGVRIEDLVLLHPDGAEVLTRVP........ 355
249 0.000e+00UniRef50_A8F7D1 Peptidase M24 n=7 Tax=Thermotogaceae TaxID=188709 RepID=A8F7D1_PSELT  ali  28  1MNK--LERFFDKIEKAGVDVALISSKPSTYYLSNFTGSFSVLLINREKQFIITDSRYFEQAKQQTDFKLVEFRNSLIGTIHSVLQEFKAKTIGLEFQRISHSVFEKLSEIDAKFVPIDSMIDNLREVKDEREIELIKKAVEISERAFLKTIEIIKDGITEKDIAAELEYNMKKSGADGIAFETIVISGPRTSLPHGRPSNRKISLNEPILFDFGASFNGYCADITRTIFFGK-PDDEFRKVYQTVYDAQSLALQNGNSRMTGKQLDFIAREHISKNGYGQYFGHGLGHGIGIEIHESPRVSSSNENLLPAGSVVTIEPGIYLEGKFGVRIEEDVVVRSNALEKLTNLK--RELITI 359
250 0.000e+00UniRef50_UPI0004815F0D aminopeptidase P family protein n=1 Tax=Lachnospiraceae bacterium P6B14 TaxID=1410631 RepID=UPI0004815F0D  ali  29  2.....REEIDKLLSEAKVDMVLITDEANMRFLSGFTG-EGYLLITKDAGKVVTDSRYTIAAEECPGFEVIDWGEGYYKPAMDAVKDKQIKSVGYEDMYLTVAEFKQFEKKLAELKPLGAKADELRQIKDETEIGLIAEAEAIGDRAFSRVRKLGEVGKTEKQIAAKLEFYMKDEGGEKLSFDTIAASGTNGAKPHAVPTDKLLKKGELLTLDFGCVYKGYCSDMTRTIAIGK-PSTALTKIYNIVKNAQQVALDGIRPGMTGKDIDALARDVIAKEGYAKDFGHSLGHSVGLKIHEKPGFSKKEKTEIRPGMVVSVEPGIYVENLGGVRIEDLVAITDDGIRNLSRSV--KDLIVV 377
251 0.000e+00UniRef50_A0A0G0W8G1 Peptidase M24 n=1 Tax=candidate division CPR2 bacterium GW2011_GWC1_41_48 TaxID=1618344 RepID=A0A0G0W8G1_9BACT  ali  32  3.FTNRLNNLVDQLKRNDLDALIVTNLKNIYYLTGFRDPEAVLMVTKKELIIMADKRSAGSVKNVKETRFLEFPYPFHKALDKILSELGVKNVGFEADSLIYGEAKDLLGKKYNFIDASEIIKNLRTTKDPQEIEYLTKAAEVTDLAFQHIVKKINLGMTEKEISREIQAFLFKEG-DGVAFGPIVASGVGSAIPHYRPTDKKIKKGDMLLLDFGGAYKGYLGDMTRTIFLGK-PTERQKEVYNLVLKAQQEALKTIRPGIRASKPHETVLRFFGTENLAENFLHGTGHGVGLNIHEAPSLSPRGDSKIREGMVFSVEPGLYFENWGGVRIEDVVTVTKDGYRNLTRS--SKEMIII 367
252 0.000e+00UniRef50_A0A1Q3MLY8 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MLY8_9BACT  ali  29  4.....LDRLRIAMAEAGIPALIVSDLGSVNWLTGFTGTFGIAVVSGDAAQFITDSRYAIQAGEQVKDMPHSWFQSPDEYLAQKIKEMGIQRIGFEGASVTYANFERWKLAGIELYGAPDLVSDLRMVKNESEIDRVRAACGIADACFEHVQRLIQPGVTEYDINLDIEFFIRRQGAE-IAFPPIVVSGERSARPHGKASEKKLEVGDFLTMDFGAKVEGYCSDITRTVVVGEA-TDRHREIYNQVLKAEVECINAIKPGVRAADVDTLARTILDEKGLAQYFGHGLGHGLGALVHDAGRMNKTSQNVFEPGQIWTVEPGVYIPGFGGVRIEDDVLVTENGVEILTKSP--KDLLVL 355
253 0.000e+00UniRef50_UPI000462FA17 aminopeptidase P family protein n=1 Tax=Aminobacterium mobile TaxID=81467 RepID=UPI000462FA17  ali  30  8...NRTERLRQQMNSMGLDAVVLANWQSVYYISGFRGSSSGVVVTEKDAFLITDGRYLSQASEQSPYTLVTQGRTMLEAVCELLKDQKCHRIGVEKDIVSIRNFEKMSASLVEWYDTSSILPLLRRTKDSSEVDSIRKAGQIASDAYREVLGHVSLGMTEKEFEALLEYTVKKLGAEGGWHNFIVASGARSALPHGAPTDKAFQSGDWVTVDFGAMVNGYLSDITRNFCLG-APNEKAREIESLLLRAHREAALALKPGVSGRDIDAIARRIIVEEGYGEQFSHGLGHALGLEIHENPRLSPLSHDILQVGDVVTVEPGVYFPGVGGMRIEDDYLITETGAERIS........... 358
254 0.000e+00UniRef50_A0A1G5RYS3 Xaa-Pro dipeptidase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1G5RYS3_9FIRM  ali  28  1MNQTRLNAVTNQMRKQHMAQLIVSDPASIYYLTGEWERLLVLYLNLNGAILLLNALFPLALQTDSGLTLFKDTEDGVSILAELMADEGD--IGVDKNWARFLLPLMEKLPHASFINGSFTIDSIRMVKDQAEQHLMRKASALNDQAMQLLQEAVSHDATELELSAVLKEAYRSLGADDLSFTPIIAFGANAALPHHDTGSTRLKPGDAIICDIGCVKEDYCSDMTRTFFY-KTVSDKAREVYELVRKANLAAIEEVRPGARFCDIDAAARKIIEEGGYGPYFTHRTGHAIGLEVHEFGDVSSGNTARLEPGMIFSIEPGIYLDTEFGVRIEDLVLVTDTGCEVLNH--FTKDLVVI 359
255 0.000e+00UniRef50_A0A117LHX4 Peptidase M24 n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A117LHX4_9ACTN  ali  31  4..EGRIRKLRRRMEDERATAVLVSAPANLRYLTGFDGINGACLVTADVTRFYTDMRYADAAAEGGPWEVGVQRENLYVEVCDELHAMDVDSLAVESSVP----YGRFKFISEQFRGADHLVEDFRQIKEDEEVDRIAAAAAIADEAFRHMLGYIAPGKTESEIALELEFTMRRNGSEGMPFSPIVASGPNGAHPHAIPGPREVQPGDMIVLDFGARVGGYCSDMTRTVCVGK-PTDEQRRIYDAVLAANEAGIAAVRAGMPCVDVDKAGRDVLAQRGFGDYFTHGIGHGVGLDIHELPTISPRSTQSLRDGAVVTIEPGVYVEGVAGVRIEDLMVVDDGGHRRLTNAP--KELIEI 362
256 0.000e+00UniRef50_A0A0G0KJH8 Xaa-Pro aminopeptidase n=6 Tax=root TaxID=1 RepID=A0A0G0KJH8_9BACT  ali  30  7MFEDRVKKLKEQIAKENLDAVLVSSVSNIEYLTGYSEREAYIFIGKNFGYIITDGRYSEAIRTQVS-HLKLFERGHTKKTADLFKKHKIKNLGVEEDELTVSEHKELKKHFKNIKHFDA--GSLRSIKTQEEINTIKKACEIGDLAFNFILKKIQSGITEKEIAQELENFIKEKGAI-ISFPSIVAFGKNSSVPHHQTGDKRLTINDLILLDFGVKINGYCSDMTRTIFFGQV-TLKHKKMCDIVLEAQKKAIQFINSGIKAKDVDKVAREYIKSKGFPD-IPHSLGHGIGLEVHEHPSLSPKSKDILKEGMVFSIEPGIYIPDFGGVRIEDLFVLEKGVLRQITNS--SKEL... 361
257 0.000e+00UniRef50_A0A1W1HCK8 PepQ n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A1W1HCK8_9DELT  ali  30  31....................VIIFSDENRRYLSGFTESAGVLIITSTDLLLATDSRYDTQASQEATLYNVSYKENISKELPLLLKSVNSRKVGLETSRLTVEIYDKIKSPEIITSSADKFLKTLRIKKDNNEIEAIKKSLAISEQAFLKLRTIIHEDMTEKEAAWLLEKMIRENGADCLSFPTIVASGKNCALPHAIPGERKFNSNEPLLFDFGAKLKGYCSDTTRTIVIGE-PDSTFKEAYDTLFHAQKFAVEAIKPGIKCSEIDRVARDYIDNSKFTGRFGHSLGHGVGIAIHESPRLSKFDDTLLEAGMVVTVEPGIYIPEWGGIRLENMICVTDEGSEVLNKISYD-DYII. 377
258 0.000e+00UniRef50_A0A1F2YDL3 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_19FT_COMBO_70_19 TaxID=1797208 RepID=A0A1F2YDL3_9ACTN  ali  33  6....RRGRLAERLDVLEVDALVVTRLANVRYLSGFTGSNAQMVVAREAAVFLTDGRYEGQSSEVPDLERRIYLDERSGHLARALGDLGVHRAGFEREGLTYGEWQRLTEADAELVPTGSVVEELRRVKDAEEVTWLDRAQETADVAFEQVVGGLREGMNERELALDLELAMRAAGADDRGFETIVAFGERTAEPHHEPGEHALRRGDVVKLDFGALAGGYHSDMTRTVAFGEPP-PRLREIRDIVAAAQQAGIDAVRGGVALRDVDRAARNVVEEAGLGERFPHGLGHGVGLEIHEIPFLRWDSDDRLPAGAVVTIEPGVYVPGLGGVRIEDMVEVTPDGGRVL--ARSPRELLVL 361
259 0.000e+00UniRef50_Q14LZ1 Probable xaa-pro dipeptidase m24b protein n=11 Tax=Spiroplasma TaxID=2132 RepID=Q14LZ1_SPICI  ali  31  16..........QYLEKYQVDGILFHSTVNRFWLSEFASSEGYLLFTKTESILYLDGRYITAGKKQARNVTRVVEGGFFGMLQSDFLKNNVKTLAFESDYLTYLTYQTLTTSSVALKPVD--FSELRAIKTNAEIEALKQACAIGDIAINNVIKKIKVGMTERQVEQIIINSFIEAGADKPSFDTIIASGWRGALPHGRATDKIIANNELITIDFGCIYNGYCSDTTRTIGLG-TPSSKMLEIYDIVYEAQSLGMQAIKPGVTTAMIDKICRDYIISKGYGEYFTHSTGHGVGIEIHEFPRVSPFCDVLLEPGMVITVEPGIYIPDLGGVRIEDDILVTENGFHLLTEAK--RELILI 364
260 0.000e+00UniRef50_UPI0008322CC2 aminopeptidase P family protein n=1 Tax=Rubripirellula obstinata TaxID=406547 RepID=UPI0008322CC2  ali  31  8.YPARIERVRSRLVDNHCDGFLITDILNVRYLTGFTGSSGYLLVTDRDAVILSDGRYDVQARQCPSMTIRPPTQKITELAVEVIADLKLKTVAVEAADLTLAAMSELESPDTTWLESSGVVELFRQIKDEYEIGLIRSAADIAQRSLTKTLAGLNEQTTERQFALDLENAMRMDSADGVSFDIIAGFGETGGLPHYRPADRALANHQTVLIDWGACVSGYASDITRTFH-RDGASDRFRSAYEAVLEANLAAIDAIRPGASCASIDAVARDVLRKHGLADAFLHSLGHGIGLFIHEGPRLAEISTETLQPGMVVTVEPGVYFAGDFGIRIEDDVLVTPDGAEVMTSLPKGLD.... 367
261 0.000e+00UniRef50_A0A2V3VSP4 Xaa-Pro dipeptidase n=2 Tax=Pseudogracilibacillus auburnensis TaxID=1494959 RepID=A0A2V3VSP4_9BACI  ali  27  1MYQTRQRRLINHLQEQNMDVALITSPTNIYYYTGFHERFFALAIDKDKTMLFLPSLDEQAAKEKAEVTEIDDHENAFDKFRDSLGK--VDSFAFEKSHVTVMRFEQIAFNNTSFTNIEPFILSERLTKSTKEIDHVKKAIQITEEGLAHTIPKIALGLTELQIKAELEYQLTVLGSDGLAFDTLVLSGEKSALPHGTAGERPIQNGDFLLFDFGVNVNGYCSDLTRTFIIGEG-TEKQSDIYNTVLAANEKAISQVKVGDELLNIDRAARDFITLKGYGNYFTHRIGHGLGLEVHEKPSIHNENKELIQPGMLFTIEPGIYVPKIGGVRIEDNIYITEDGGEVLSSYPK....... 359
262 0.000e+00UniRef50_A0A1M4UD40 Xaa-Pro aminopeptidase n=4 Tax=Microbulbifer TaxID=48073 RepID=A0A1M4UD40_9GAMM  ali  30  1MTLHRIRNLREQFSTAGIDGLLVSSMSNIRYLTGFDERDATVLIGATEAFLLTDYRFGEQAREQCGEVQIIVRDRLGQLVRELAAQCDIRQLGYERDHFLHGRWLNLALDTIAVKPLRGLVEKLRRRKEPAELESMRRAAAIGDRALEQLLGLLQPGITEREAAVELECLLKRAGSEGLAFPTIFTSGARTSRPHGMPSDRVLSRGDLITIDFGAIVDGYRSDMTRTFVLGKA-DSKQREIYELVRRAQALGVESLRTGIPYSQPNATVNRFLAACPYAEYAGDSLGHGLGLDTHEQPYLSTGFEELLEEDHVVTVEPGIYIPGWGGVRIEDDVRLTGSGPELLNN--FSRELIEL 362
263 0.000e+00UniRef50_A0A1J5CNY8 Uncharacterized protein n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A1J5CNY8_9CHLR  ali  30  5...NRLQKLRYTIDEHGLDALLVSQPYNYRYLSGFAGSSGWLLISESEAILATDFRYVEQAKEEPRFRVIQIKGEMHNWLPQLVSDFGWHKLGFEANHITFTLYQKFSKLNLELIPTTALVERLRSIKESLELKLISRAAELTTAAFEYARSIIHAGMKEKEVAWEIEKFLRQNGSEGIPFEIIVASGPNSALPHARPGERMIQTGEPVLIDMGAKIDSYCSDFSRTLLM-PAPEPSFREIYNVVLAAQLSAIERIHSGMSAVQADQLARDVITKAGYGESFGHGLGHGVGLELHEAPTISPSSSDVFADGMVFTIEPGVYIAGWGGVRIEDMVVLEGGKARVVTKSKKD...... 367
264 0.000e+00UniRef50_A0A2H0YCG6 Xaa-Pro dipeptidase n=1 Tax=Parcubacteria group bacterium CG08_land_8_20_14_0_20_38_56 TaxID=2014322 RepID=A0A2H0YCG6_9BACT  ali  31  2..ERRINEVRKRFKDFGIAAFLVSDIVHIRYLTGLKLTEAKLLITKDNHYLITDARYEEQALKENAEAIIGGSKEQYKKLAELIKNLGGKT-GFEAEDLTFAELRRLKKELSNLSPVENLIENISSIKTREEIKKIRRVVEITDHIFEHILDLLKPGIRETELAAEISYLGKKHGAEDDAFGLVVLFGPNSSLPHGDPARRKLRKGDIIQLDFGYFYQGYCSDFSRVLVLGK-PTEEQKKIHKIVFEAQKRAIETVKPGMKWEELDKIARDFIEENGYK--FVHGLGHGIGIKIHTIPRLGDESKDVLKLNQVFTIEPGIYIPGWGGMRIEDDVLATKDGCEVLTKSP--RNLVII 365
265 0.000e+00UniRef50_A0A0C7P3E7 Xaa-Pro aminopeptidase n=3 Tax=Petrotogaceae TaxID=1643949 RepID=A0A0C7P3E7_9BACT  ali  32  1............MQDNNIFQAIITSTPSIFYFTGEWERLLALYINSGEVKLIINEMFKVKNVDKNILLTYSDSDNPIDLLADVLIDE--KTIGIDEKWAGFFLELLNLSKNYLFKNVSPLIASLRMVKDEEEIKHMKVSSEINDKTMEKVIKVVPEMLSERLLAKAVKNIFEREGADNISFEPIVAYGLNAADPHHVPDSTKIKDGDAVVIDIGCIKNHYCSDMTRTVFFG-NPVDTFKRIYDIVLEANLKAIDCIKPGIKACEIDKVAREVITKRGYGDYFIHRTGHGVGIEIHEMPYISSNSEVILEAGMIFSIEPGIYLPNVGGVRIEDLVLVTKNGCEILNNYSKSL..... 342
266 0.000e+00UniRef50_A0A0G2Z520 Peptidase M24 n=11 Tax=Thermotogae TaxID=200918 RepID=A0A0G2Z520_9BACT  ali  30  2...DRLLKLREKMEEKELDALLVFNRENSWYISGFSGSFAVLFITHRSEYIITDSRYFTQASLQTSFKLIPYNDNLKSLLRQLISEEKIRRLGFESERITHHYFNLLSDLGVELVISDDIIKALRMVKSQEEIEKIRKAVEVAEDSLLETLNMVRPGVTELEVAARLEYEMRKRGGI-PAFETIVVSGERSAIVHGSPSEKKLGDGEFLLIDYGAFVDGYCSDITRTFAIGD-PSEEMIEVYNIVYEAQKKAREVARAGIMGVELHSVAGQIISEAGYGEYFGHGLGHGLGMEVHENPVANQINHEPLPAGAVITIEPGIYLPGKFGIRIEDDVLLTEEGCIVLTSL--DRELKTL 360
267 0.000e+00UniRef50_A0A2J0LJ25 Uncharacterized protein n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2J0LJ25_9BACT  ali  33  17.YAERQKKLIGSIRAESADAFLVRKKENIAYLTGARGEDAVLFVSAGKNVLITDSRYEEEYKKNARKCSVKINKNLREIISETCAETGSKLIGFEADNFTYQAYLNLKLGNRKLIPLMQVVEGLRILKDNTEIRYIRQACEYGAKLMNYAIKITKPGISENTIKRMIEAHALKNNIDLAGFDIIVASGANASMPHAAASDKVIKRQEMVTIDLGAMYFSYNSDLTRTVFLGKI-SHKYLHAYNIVLSSQSIAIENLKPGVYAKDIDAVSRRYISDRGMGSFFIHSLGHGIGRETHESPAISQNSKIKLEEGMVVTIEPGIYIPGWGGIRIEDMVLITENGCEVLTK.......... 364
268 0.000e+00UniRef50_A0A1F8V3F6 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWF2_38_85 TaxID=1797683 RepID=A0A1F8V3F6_9FIRM  ali  27  2...KRLEQILNVAGEAGCDAVVFTDAINRRYASGYNAADGLLVITKQRSCMFVDFRYNDIQPENKMVEIIVTNSPMLEAANELLNSADVKKVAIDTATVTYDLFMRISNLTAECVATPGLCVPMRSIKSEYELEQIKKAQSITDAAFDYVLGKINPDMTENELAAELEYFIRRKGG-GIAFETIAVSGTQSAIPHGTPRDVRLTMNSFITMDFGATWNGYCSDMTRTVVLGKA-DDEMKKVYNTVLKAQKIGIEAAKAGIAGSVVDIAAREYIASCGYGDYFTHSYGHGVGLEIHEAPNFSRLSTKIIPENAVLTAEPGIYLPKKFGVRIEDLLIIKENGYENITNSR--KDLIEL 357
269 0.000e+00UniRef50_A0A2W4K0R2 Uncharacterized protein n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4K0R2_9BACT  ali  29  1MN-TRLKKLQQSLAKHKIDALLVGDNQNVLYLSGFGGTTGVLVISKKHAFIVTDARYYTRAAKDYKLVKVIRGKKFTDHINEALALAKLTRIGFEAAHVPVSIAEIWKELKGKLVATQHVVERFRQYKDAQEVELLRKACRITSKVYNEVAAIMRAGMTENEVAFELDMRLRRYGAISNSFTSIVAAGPNSAIPHHATGDRKLRAGEPVIMDFGGLFGGYCSDITRTAFVGKEPSKRIQEIYNIVLKANQAARRGLKPGITYKEFDKIARDYIAENGYGQYFTHGLGHSLGLVAHD-PF--DYEHDAFEVGTVVTDEPGIYIDGFGGVRIEDDLVVTKDGNERLTNAPYWK..... 360
270 0.000e+00UniRef50_R5VVW8 Xaa-Pro aminopeptidase n=2 Tax=Bacteria TaxID=2 RepID=R5VVW8_9DELT  ali  31  6..........KLFELAQVDAVLVISDKNRRYFTGFASTFGYLVLLKNKNVFITDPRYFEMAQKDDGVEVMQIANGIMSTVLSILKDNGVKTVGFEDTELTVAEFEGIKLSAFQLVPCGQSINFVRAFKDEQEISYIKKAQAATDAAFAQVLKVIKAGMTEKELAVELEYLLAKNGGEGLAFDTIIASGVNSSKPHAHPTDKVIENGDPVTMDFGARYHGYCADMTRTVFVGD-PSAELRKIYNVVLMAQCNGITNAYCGMGGRELDSYCREVIKANGYEQYFTHSTGHSLGIDIHEEPRASMLSKDILQANQLITCEPGIYIPNVGGVRIEDLLLITEDGIIDLTSS--DKNIIIL 355
271 0.000e+00UniRef50_A0A1W9MKJ0 Peptidase M24 n=9 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1W9MKJ0_9DELT  ali  35  25..................DALLVTQPENRRYLSGFRESAGSLLVPRGAPLLLTDSRFTLEAQEAPAFRVELYRHGRLALLRRLLADLGIRRLGVEGDYTLYATALKLQALDLELLPVSGLVEGLRAIKSEGEIERLRRAVHLNETVFQQALATIKPGMREDEVARLIENLMGEHGAEGPSFPTIVAGGENAAKPHAVPGARAIRADEPLLIDMGLILDGYCADMTRTVVLG-TPDKTFLSRQRLVRQAQLAACAVIRAGLSCREADLAARCVLDQAGLGQAFGHSLGHGVGLAVHEEPRLNSRNRRQLKAGMVVTVEPGVYLPGWGGIRLENMAVVREDGCEILN........... 363
272 0.000e+00UniRef50_A0A2J0KRT0 Peptidase M24 family protein n=1 Tax=Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_42_15 TaxID=1974741 RepID=A0A2J0KRT  ali  29  4....KIEKIRDILKEKKLDGFLVSNATNVSYLAESPITDSYLLLTKGKNILLTDFRYILEAQALKNFTTERIDVSFVDTIASVAGKLKLKRVGFEGRSISYSVYVKLKLKKTVLIDTCDIVEKMRAVKERSEVGLLRKAVKVTEETFFYIRKTLRSGMTEEELKKRIAIYIKSHNGAEEAFSTIVASGPNAAKPHANATTRKIGRGEPIIIDFGVKFSGYNSDLTRTFYLGKM-DSKFRKIYDIVLRAQEAAISFIRPGRIVSELDLAGRDVIKNAGFGKQFGHALGHGIGRDVHESPKIFKTAKGHLLMGMVLTVEPAVYIRGWGGVRIEDVVLVTKKGCEVLTDA......... 347
273 0.000e+00UniRef50_V6J172 Dipeptidase n=7 Tax=Sporolactobacillus TaxID=2077 RepID=V6J172_9BACL  ali  29  3...EKMKQIEEWLREQEGRFAYIADPTNVFYLTHFHERFGLFLFPEDEPFLICPELEAGQARASEFGHEVRDDQDPWDFVKKAIEARKANKVFIEPSTLPYNKALALKRIDIDFQTIENYLAAMRNVKDAAELAAMKKAGEIADYAVKLGIEAIKKGRTETAIIAEIEHELAKQGYSQMAFDTMVLAGENTAKPHGYPGNRQIREGDFVLFDLGVVIDGYCSDITRTVCF-KHASDEQFKIYETTLQANLAAIQAVREGLRIGDLDGVARDVITKAGYGEYFTHRLGHGLGLGEHEQPSMSADNDQLLKPGMVFTVEPGIYVPEVGGVRIEDDIYLSDNGPISLTHYP--KELQII 364
274 0.000e+00UniRef50_X0RMC1 Putative peptidase n=5 Tax=Bacillales TaxID=1385 RepID=X0RMC1_9BACI  ali  28  1MIKQRIQTLQQHLQNEKLDFAFIQEKANFFYLTGFHERLVAVIIPASEPFIIAPLMEQPLIKEAGWILTYLDTDNPWDILSNHLNQTSISKLAIEPSSLSYSQHLLNLNEHVELYDIEPSLSQARLIKTKEELDILQEAARFADLGVEIGVSALAKGKTELEVLATIEYELKKKGVTEMSFDTIVLSGANSANPHGNPGLNPIEEGSFVLFDLGVVWEGYCSDITRTVGFGNL-SEKQEEIYHTVLHAQEKAISASKVGTKLKVIDLAARSHIKQEGYGDYFPHRLGHGLGVDVHEWPSINETNELILQEAMVYTIEPGIYVPKYGGVRIEDDIAIQKGKALALTQYP--KELQII 365
275 0.000e+00UniRef50_A0A1S8N438 Putative peptidase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1S8N438_CLOSA  ali  29  1MKDQRVANVLKKMQTMNLSQMVVTSPAAIYYLTGKWERMIALYINADGNHFIINKLFPLQEDLGIEVIWFTDNDNAIEILSKVVKKDKV--LGVDKFWAAYLIGLMELNAVKGFVNSSSIIDELRMIKDEEEKELMRKSSQINDRVMQIFLRELKEGCTEKYYARLLQEIYENEGAQGFSFDPIIGYGANAADPHHENDDTKLKKGDSIVIDIGGVYNHYCSDMTRTVFFGEEPSKEDREVYEIVKTANLNAIAKVKDGVKFSEIDAAARNYIDDKGYGKYFTHRTGHSVGLEIHDKGDVSSINHEEVKEGMIFSIEPGIYLPGKIGVRIEDLVLVTKDGAEILNSV--SKEVTII 358
276 0.000e+00UniRef50_A0A2V2G9X7 Aminopeptidase P family protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2G9X7_9FIRM  ali  28  28.....WEKLKPFVKDKNAGGALILSSVNRRYATGFPSSAGFVAITPEKTVFITDFRYYGSACEAKKVTVVLQDKTLWETLAGLFE--GCDNILIEENYVTVSEYERLKFAGKKLCNASCAFEMLRAVKTDSELEKIVKAQAVTDKAFAHILSYISKGLTEKQVALELDYFMLSNGADGIAFDTIAVNAEKSAMPHGVPDNIPIKKG-FLTMDFGARFDGYCSDMTRTVSIGK-PTEKMRDVYDTVLNAQYKALEYISAGKTGKSIDGVAREYIASRGYDGCFGHSLGHSLGLEIHESPNFSPSNNSPIPEGAVISVEPGVYLDGEFGVRIEDIVSVKNGGCVNLTNSP--KELIIL 386
277 0.000e+00UniRef50_A0A220U8E2 Peptidase M24 family protein n=8 Tax=Bacillales TaxID=1385 RepID=A0A220U8E2_9BACI  ali  26  5.YEDRLQVLQSYLEQENIEVAMVTSPANVFYYTGFHERFMALVVDSNNISLFVPALDEESASNESSVRPVSDEENPFAKLKLELGEH-VGNFGLEMKAVNIFDYHNLRSAHASYVDVQPFINTQRMKKSGSEVESVRTAIDIIEKVLAEGIKKVEVGMSELELTAELEYLMRKFGADGPSFSTIVLSGEKAALPHGTPGNRTFKKGDFLLIDFGVIKDGYCSDITRTFIIGEA-SDKQKEIYNIVLQSNNAGINAIKSGIPVKTFDIEARNVIDEKGYGEYFNNRVGHGLGIEVHEEPSIHENNEQIAEPGLLFTIEPGIYIPEYGGVRIEDDVYLNDEGNEVLTS--FPKELQVI 367
278 0.000e+00UniRef50_A0A0S8DUJ8 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0S8DUJ8_9BACT  ali  27  3...KRARAIRRQLTKKRISCLIVTRPANVTYATGFLGDDSWAVVTHNQVYLLTDSRYTEQAQECPSCRIIERAGPMAEAVAELAPKLKVRTITVEKST-SVADFEQLKRAKARLRTSANIIETTRLVKDESEIVAVKSAASIATKALGQTLSYIKPGVSESELSGMLDFQIRKLGARN-SFETIVAFGANASRPHHQPGAKKLKKEDTILIDFGAKYRGYCSDITRCFTVG-TPTPFFKKVFDVVEQAQAAAIKKIRAGARLAEIDSAARETIAKTDLPVY-GHGTGHGFGLEIHESPFLKAGGKGKLEAGQVITIEPGVYIPGKLGVRIEDDILVTETGRRILTR.......... 344
279 0.000e+00UniRef50_A0A1H0DN15 Xaa-Pro aminopeptidase n=2 Tax=Acetanaerobacterium elongatum TaxID=258515 RepID=A0A1H0DN15_9FIRM  ali  30  2...SKLAELIRRLPD-GIDAALIVSRPNRRYYLGYDSDAGLLFVTREAAYFIIDFRYIETARARVKDAVVLLQDNLGEMLRSLCEQHHVKHVGVETGALTLREFARFQLLSVKLSDSNDLILRQRSVKTPEEIKLLKEAQRLTDETFSYILNRIAAGKTEKEVALDMEFYIRAQGAEAASFDFIVVAGKNSSLPHGIPGDNKLKKGDFVTMDFGALVDGYHADMTRTIAIGSV-SEEQQRVYDTVLKAQLAVLNVLKAGVKCDDMDRIAREIIYSAGYEGCFGHGLGHSVGVEIHEQPRFSATCTKQAAAGTVMTVEPGIYLEGRFGVRIEDTGVLTQERFDNF--AKSPKELLIL 356
280 0.000e+00UniRef50_D2RJN4 Peptidase M24 n=5 Tax=Acidaminococcus TaxID=904 RepID=D2RJN4_ACIFV  ali  29  4.....LERLRAFLEQEKVDGIFIKGDSSIRYFTGFTGGESLLYVDARRAVIITDSRYTLQVRQQPECELVEHLHGFWPEAAKLPQSDN---LALDGDYFSYTEALAAVLPHAAWKNVN--LVGLRAVKTPEEMQLIRRAVAISDEAFLQLLPHIRAGRKESELAAELEYNMRKLGSTKPSFETICASGKRSALPHGVASDKVVEEGDFITFDFGATYGGYCSDITRTVVVGKAA-PWQKEIYDIVLQANLLGEKTLKAGLTGIQVDGAVRDFIGSKGYGPNFGHGLGHGVGLDIHEKPVLNRANGQPLPAGAVVTIEPGIYLPDKGGVRIEDTVLVTETGCERLTSVP--KELKEL 349
281 0.000e+00UniRef50_A0A1F8GUX3 Uncharacterized protein n=1 Tax=Candidatus Yanofskybacteria bacterium RIFCSPLOWO2_01_FULL_49_25 TaxID=1802701 RepID=A0A1F8GUX3_9B  ali  28  13............LKRHRAGAFVLVNQPNTRYLSGFTGSESIVLITPHRRFIITDGRYLSQARDETKFEIIPTGKGYMGVFADLVKRLRIRSILIDPSRTSFIVRLREQVPNLLIRHESDMLQRVRMIKTPAEIVLIKKSVRIALRAFEHLMPHIREGATERELADRLEFFMKEAGAERIAFDTICVSGKNGAFPHGKPTSKKIRKGELVTLDFGAVYQGYNSDITRTLAVGKI-SDKLSDIYDAVQKAQALGIKKTRAGITGHEIDAVCRDYIAERGYGKYFLHGTGHGLGLEVHELPIIAQESHTPLPFGAIITIEPGIYIEGLGGVRIEDDIVITKSGSIVLSK.......... 354
282 0.000e+00UniRef50_A0A078L3F9 Putative peptidase n=2 Tax=Chlamydiaceae TaxID=809 RepID=A0A078L3F9_9CHLA  ali  35  1MFNDRIQRLRQLYMKNGLEGFYIDDPLNIYYLTGLSMSAGQLFITNEKVEVIVDSRYFDFAKAHSPFKVYLDNQYQWE---------SVQKIGFDSNLITFNRYLLLEFGQKNFIPIENALCLVRMIKDNEEIALLKEAANLGSLGFERVIHSLKEGITEEELALELEIFWKRNGAQGLGFNPIIAFGKNGAMPHYRPGKAKLEKGMSVLIDIGVLYKHYHSDMTRVVFYDSI-DPLISHLYDIVLEAQEKAIQSCKPGITIQELDQTARQFIEHEGFGPQFIHNLGHGLGLEIHECPFLKPFSHMVLKPGMVITIEPGIYIADKGGVRIEDTILITENGYENLTNTQKQTKLII. 350
283 0.000e+00UniRef50_A0A223K4P2 Putative peptidase n=4 Tax=Lactobacillales TaxID=186826 RepID=A0A223K4P2_LACSK  ali  26  2..EERLHTLRKKMKQNNLGAVIINNKANRYYLSGFTGTDGQILITQTEQYIIADSRYFEQLRQQSANFTIIDNRAMNTAMKRLLSKIGEQRIGIEADEMNVSEYLALSGADGELVPIYNLIEQQRMIKDEEERNKIQHAALIADETFNHIIKYIRPGMTEKQVANEIDQYGLKLGADAPAFETIVTSGIRSALPHGHASEKVIQNGELIILDFGFEWRHYYSDITRTIAVGPV-SKELRQIFDITLAAQKKAIQTCKKDVPLKSVDKVARDYIAKAGFGNNFLHGTGHGIGLTVHEYPLLNHDSDEQLQNHMTFTVEPGIYLEQKGG............................. 326
284 0.000e+00UniRef50_A0A0P9CIR4 Uncharacterized protein n=1 Tax=Alicyclobacillus ferrooxydans TaxID=471514 RepID=A0A0P9CIR4_9BACL  ali  32  1MNEA-TKNLLGKLPNPHI-AVLIEKPENRRYLSGFTGTAGVLVVTQGGCSLITDGRYADQARAQAEWNIVVNRGDVVPAIVDLLQRQQIREVWFDALFTSFDFHQRLTNAHVQLTPTYELVEGLRQIKSSDELGQIDQAFAITNRAFEYIFGELHEGLSEHEVAWMLERFMREAGAEKIKENHVIASGPRSALPHGRATDRIIQKGDLLTMDIGAVVNGYYADMTRTVVIGK-PDERQREVYHLVLEAQLMALEMMRPGTVCGNADDTIRQFFAAHGYSDNFAHTLGHAVGLEIHEKPGLRGGDTTELREGHVITVEPGLYFPGWGGVRIEDPVVITASGYRNL--ATVTKELLSL 356
285 0.000e+00UniRef50_A0A1Q7L2Y4 Uncharacterized protein n=28 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7L2Y4_9BACT  ali  30  5.FQHRRRVLASVLPQSRIDSLLITRPANWFYLTGFTGEAGALVVSLKGTTLITDGRFMVQHEETSSVRIRRQKESLFESVGGFLKDLRVRSIGFDPTHLTVSQLQKAAGSQLRWVPVTGIVESLRMRKDSGELAQMRKAAILAGEIVKFASGLLKQGVCECEVGAEIEYQMRKRGASGPSFETIVAFGKRAALPHARPTGKRLRKNELVVLDLGVILGHYCSDITRTVFLGRAP-KRIRVWYKAVLEAQAEAIAAAKNGVACGDVDAAARQVLAKYNLDHLFVHSTGHGLGLEVHEDPRVAKGQKRRLEPGNVITIEPGVYAEGIGGIRIEDDVAVHASRTEVLTRAP--RDLIEL 360
286 0.000e+00UniRef50_A0A1F6IMT3 Uncharacterized protein n=1 Tax=Candidatus Levybacteria bacterium RIFCSPHIGHO2_01_FULL_42_15 TaxID=1798599 RepID=A0A1F6IMT3_9BACT  ali  33  1MNK-RIERIQKELKKRSLDAILISSSSHIAYLTGYGEREAFMFISLQNALLFTDRRYLGALAHVKPLKEISLKNPLSKHVGGILRSLNAQRVGIEKEHVTVEEYENLNLSSVAIP--HSILADLRQIKTKEEIALLQKACDLTDKAYARLLSYVKPGISEKELAAKLEYWIKKQGAD-VAFPPIIAFGKNSATPHHKTGDQRLAIKDHVLIDFGVRYQLYCSDMTRVVFVGK-PSDEQKRMYQTVHDAGQKALDFLSSDVQASRVDDVARRYIISKGY-PSIPHSLGHGVGIEVHESPRISPVSKDILKQGMVFTIEPGIYDRKLGGVRIEDVVVLEKKGPSIITHSPKS--LTIL 359
287 0.000e+00UniRef50_A0A1F5Q9R0 Uncharacterized protein n=4 Tax=Candidatus Doudnabacteria TaxID=1817799 RepID=A0A1F5Q9R0_9BACT  ali  33  3...NRIKNLQDYLRQNALDAFLVLTKLNRQYVSGFTGSMGVVFVTRKSAELYVDDRYTIRAKRESDLKV-----------KKIEELKLAGRIGIE-DRITVRELASLKKHKAKWIVATNVVEDLRAVKSAKEIQCIKKAQRIVDACFAQIKKYARVGMTEIEISQQLERTAIQHGADGMAFESIVAFGANAAAPHHLSGKQKIKRNNFLLLDFGVLVKGYHSDFTRTLFIG-SPSKKQAQIYNTVLVAQKRGIEKARLGNKASVVDKTARQYIDEAG----FTHNTGHGVGLEIHELPNFSPKSDDILLSDMIVTVEPGIYIEGWGGVRIEDMVLIKNKDNEVLSKSPKDIKSMII 354
288 0.000e+00UniRef50_Q4L749 Uncharacterized peptidase SH1217 n=37 Tax=Bacteria TaxID=2 RepID=Y1217_STAHJ  ali  31  2...SKIEKITKQLQHEQADAAWITTPLNVFYFTGYHERLFALLITANGQTLYCPKMEVEEVKNSPFIIGYLDTENPFE-----IDPLSFNKLLIESEHLTVKRQRELTFGVQHYGDIDQTIKELRNIKNESEIENIREAAKLADKCIEIGTEFLKVGVTEREVVNHIENEIKKFGVSEMSFDTMVLFGDHAASPHGTPGERKLVKDEYVLFDLGVIYNHYCSDMTRTVKFG-TPSEEAQTIYNIVLEAETNAIEAIRAGVPLQDIDKIARDIISDAGYGDYFPHRLGHGLGLEEHEYQDVSSTNSNLLEAGMVITIEPGIYVPNVAGVRIEDDILVTENGYEILTHYDK....... 351
289 0.000e+00UniRef50_A0A2H5Y1U5 Aminopeptidase YpdF n=1 Tax=bacterium HR21 TaxID=2035416 RepID=A0A2H5Y1U5_9BACT  ali  30  31..................DGIWVTAVPHIRYLTGFSGSAAQMLVVPEAVHFLTDDRYEEQVRQELFGLTVHVTREPLLCVSTQGLLTGVRRLAFQPSYATVWEARRRWRP-CQLVPLSGVVEELFVAKFPAEVELLRRAAQIASQVYEAVLPEVREGMSERELAAEISYRARCLGSEGDAFEIIVASGERGALPHGRASNRRLRRNELVTVDFGCVVGGYVSDMTRTFVLGRA-SAEQRRVYQVVLEAQERAIEALHVGMRAQDADAVARRRIAEAGYGEFFRHSLGHGIGRSVHEPPALSPRAPRRLRAGAVVTVEPGIYLPGRFGVRIEDDVHLTPEGARVLTTAP--RELL.. 369
290 0.000e+00UniRef50_A0A191HV42 Uncharacterized protein n=1 Tax=endosymbiont `TC1` of Trimyema compressum TaxID=243899 RepID=A0A191HV42_9FIRM  ali  28  1MEITRIKLFQKQLIKENIESFLISNPLNCNYLGGLEDAEGFLLVLADKSYFLTDFRYVEALNTLSGIEVVDCKGSVREILVELLKAQKVSSLAFEESII-YSLYQRLEDFQIDFFMGPQICETLRMVKTEDELALIRKSAEINDAILKHTIGKIKVGMTELDLKNELEFALRKEGATSSSFDLIVISGKRTSLPHGIASKKKIVYNESILFDIGVTYKGYASDMTRMVYLGD-PSEAFLKIYNIVKTSQAIGLKTIKSGLKAHVVDDSVRDYISKAGYGKAFGHSTGHGVGLYIHERPNISIKSDNVLKPNMVFTVEPGIYLENKFGIRIEDLVVLGDDSVEVLS--KTSKDLCII 357
291 0.000e+00UniRef50_UPI00065E5D49 aminopeptidase P family protein n=1 Tax=Rubeoparvulum massiliense TaxID=1631346 RepID=UPI00065E5D49  ali  26  1MFEQRLHDLLSKLKSLNCQDVLIVNPMHVYYFTGFHERFMGLFLNKKGLYLIVPALEVEHAHQVCQIPAYTDAEGPLAAIHGWFQNTGELNLGVEKDVLTLSRCQLLEEAHQQLVDVAESIAQLRLLKSADEIKKLAAAAQLVDQVLEAGIKRVLRGMSERQLVAEIDYLAKGMGADAMAFTTMVLVGANAALPHGIPGSTPIEDGQFLLIDMGVRLNGYNSDITRTFMIGKA-NEKQKQVYHIVRQAEEQAIAAVRVGTTLAALDGVARETIRAAGYGDYFTHRLGHGLGMETHEYPSVHGLNHSPVVEGMVFTIEPGIYLPGWGGVRIEDDVVVQQSGAQVLTQ--FPKDLIEL 365
292 0.000e+00UniRef50_A0A1I5YP78 Xaa-Pro dipeptidase n=11 Tax=Bacillales TaxID=1385 RepID=A0A1I5YP78_9BACI  ali  27  1MNQT--EKIQSYLQTHQIDAAFITTPDNVFYFTGFHERLLGVAIFKEAPFIICPKMEIPDAKAAGWIIGHQDTDNAWDILVQKMNESNIQSLAVEKSHMTVERLEALRLSNLQISRIDEKINDLRVIKSEAELVNMRKAAELADYAIEVGCKEIAEGKTEIEILNAIELAVKEKGAAQMSFDTMVLSGPKTASPHGTPGDRKIQKGDFILFDLGVVYNGYCSDITRTVAFGE-PSPDKREIYETVRRAEEAAVAAVKPGVTAMALDKTARDIITEAGYGEYFTHRLGHGLGISVHEFPSITGVNDMKLEKGMVFTIEPGIYHPDITGVRIEDDVVVTESGVEVLT--KFPKELQIL 363
293 0.000e+00UniRef50_A0A143WZT8 Xaa-Pro dipeptidase n=10 Tax=Firmicutes TaxID=1239 RepID=A0A143WZT8_9FIRM  ali  29  1MNNERLTTLQTALKKAKMDVLLISDPHSIEYLLGKMERMLVLAVFQKQPVFFLNHLF--NVPEDFGFEKVWDTDDYTGMLASYLDQASV--IGVDKNWARFLLPIMANVPQAHFVNGSYLVDEMRMVKDEAERQLMREASLINDQAMADMRQAFEEGITENEMAAKLLEFYKAHGGEGYSFDPIVGYGPNGADGHHGCDQTPLKPGDSIVVDMGCMYQGYCSDMTRTFFY-KSVTPKQREVYDLVLQANLAAEAIIKPGVRLCDIDKAARDVITKAGYGPMFNHRTGHFIGKEVHEYGDVSSAFDMPVRAGMIFSIEPGIYIEGEFGVRIEDLVLVTEDGCEILNHYP--KDLIVI 357
294 0.000e+00UniRef50_A0A1L3GK42 Integrase n=5 Tax=Desulfuromonadaceae TaxID=213421 RepID=A0A1L3GK42_PELAE  ali  30  1MVKNRTQKLRQLLQRFELDAALLTGPANLRYYSGFTGTDGALLVNGKTSVFLTDSRYTSQARQQVTADRMVEYQSKTGGIADLLGELLITSLGFDADNLSCALFEELRSKECNWQSLPREFKALRGIKDQTEIALMKQAARVAAEAFEEIRPLVRPGAMEQELALALEFAMRRRGAQDRSFPFIVASGERGALPHGVASERRLRDGELVTFDFGAIWQGYCSDETVTLALGTA-DVRLREIYDIVFEAQQRALAAIRPGVSLAEIDGTARAYIGERGYGAFFGHGLGHGVGLEVHEYPVVSPRSTDVAAEGMVFTVEPGVYVPGLGGVRLEETVLVTTCGYELLTTIGKD...... 352
295 0.000e+00UniRef50_A0A1V5YVV6 Putative peptidase n=2 Tax=unclassified Candidatus Hydrogenedentes TaxID=1046981 RepID=A0A1V5YVV6_9BACT  ali  31  6.HDKRLDVLRTRLGVWGADVFISFDPADNAWLTGFFGSTSIVAVTAEEAWLFCDFRYLEQARAVTAAQVVEFSGAAEPFLARHLNAFCLKQAVCDPSVMTLACYNRLKEHEGELTAQPDVCRALRTVKEEGEIARIEKASLLAEDALQAVLGEIRPGMEETELAGRLDYAFRQRGAQRNSFDTIVLFGEGSSLPHGKPGNRGLQPGDIILIDCGCVLDGYCSDLTRTFVYKQSPGAWFQEIYDCVYQAQAAALAAVRDGISARTVDETARTAIKNSGFGDYFGHGTGHGVGLEIHESPRLNPESEAILAAGMVVTVEPGIYLPGRGGVRIEDLLVVTPSGSRVLTVLP--KELRIL 360
296 0.000e+00UniRef50_A0A1V5DWD9 Putative peptidase n=1 Tax=Syntrophaceae bacterium PtaU1.Bin231 TaxID=1811718 RepID=A0A1V5DWD9_9DELT  ali  34  10...RRMGRLRSLLGVGAGEAVLILDLKNIQYLAGFTGSDGALFVAPDSAVLLVDGRYENQAKREAAGVEVRRYGDKLAGIAAVVSEGGQGRILFDAAAMTVEGHAKLKLPGVVLAPAPADLNRLRGVKEEWEIDRMRRAARIAGDAVLAVMDSIRPGVQEKDIAIELEYKMRRLGADGIAFPSIIASGENSAMPHASPGMRRIREHDVIVVDYGAVCEGYRSDETITLSVGKPPD-EFREAYGAVREAHDTAMRAVRSGAVCGSVDAVARGLLSGKGWGPFFSHGTGHGVGLDVHEYPRLAAAVEGTLEAGMVVTVEPGIYLEGRWGIRIEDMVRVRNDDCEILTVFGKD...... 357
297 0.000e+00UniRef50_A0A2E0JGG3 Xaa-Pro dipeptidase n=11 Tax=cellular organisms TaxID=131567 RepID=A0A2E0JGG3_9FLAO  ali  28  6.FQRRQNKXRSKLAKENLDGMLVTNLTHIRYLCGXTGSSATLXISGDKVHFXTDGRYVVQXKEVKGANIIIDSIPHIEVXKNQNXLXPGSKIAFDGNSVSHQAYQQLSLSNXQLENITGVIEKMAMSKDSKEIEAIXTAVEITDQAFAEVLPMVKIGVEEKVIANQXSFLYRKYGSDSDAFAAIVGTGPNSAKPHHTPTDRKIGQGELLVIDSGAKFAGYHADMTRSFAT-KGFSEEQKXIYDIVLNAQINSINGIKAGXSCKSIDSIARDHITQAGYGKFFDHGLGHSLGLEIHEEPRFSKVSKDILEENYVMTVEPGIYVKDIGGVRIEDDIIVTKDGSEILN--KTSKEFQVI 361
298 0.000e+00UniRef50_A0A151BEB1 Peptidase M24 n=1 Tax=Candidatus Bathyarchaeota archaeon B23 TaxID=1779367 RepID=A0A151BEB1_9ARCH  ali  30  2....RLERLIKGVEEEGLDAYLVHGSANIYYLTSSTG-GGLLLIREGEATLYTPGLNYPMALEQVEVCEVRGEEGLFKAISGRLRE--GESVGYNTLPLSLYRRLREAFEGVELRERSELIWRMRRVKEEGELELMRRAGRLADLGMEAAREALRQGVREHEVAAEIAHVMMREGAEGLAFQPIVASGYRSAYPHGGVTDKRIEQGELVVVDIGATYKEYRSDITRTFIVGK-PSQRQERIYNVVLEAHLKAMETLKPGVEAREADDIARRVISEAELGEYFIHSLGHGVGLEVHEPPTLSERSEDVLERGNVVTDEPGVYIPRFGGVRIEDMVLITDSGVERLTRFEKDLDAVMI 353
299 0.000e+00UniRef50_UPI0006886A77 aminopeptidase P family protein n=1 Tax=Desulfitibacter alkalitolerans TaxID=264641 RepID=UPI0006886A77  ali  27  15.YLNRISRVQGLMGDLNVDYMLIGPTSNMFYLTGVDERLQLIVIPKKGPVLLLPEMYREKFRELFKLKYWKDTENSCSLLKLALAERGFK-VAVDEQLWTHFLNIMECFSKAEYIGASGILGLLKMCKDPTEIELMLAAGKIIDEVMSQMVDVIRPGISERKVAHLIETQIREAGADDIAFKPIVASGPNSALPHHSPTDRELKAGEFVVMDFGAVYKGYCSDMTRTFFLGKANS-RQREIYDIVKAAYDAGYKEAVKGKKIEDLDLAVRNVISSAGYGEYFIHRTGHGIGIEVHEDPYIMGGNTNVLENGMAFSIEPGIYMPGEFGIRLENIVVVNDNAPLELNKFP........ 370
300 0.000e+00UniRef50_A0A2X3K618 Peptidase M24 n=1 Tax=Candidatus Bipolaricaulis anaerobius TaxID=2026885 RepID=A0A2X3K618_9BACT  ali  33  3.HARRREELGRRMRNRGLDAFLVSDRPNLRYLTGFTGSFGIL-IAGERSLFATDSRYTEQAREIAGLPVEEVKGRWLPWLAERLKALGVAKVGIGAQRTSLHVYQELLASGIEFVPQTGLVEELRRVKSEEEIARISAAARLTDEGLRWVVGRLAPGQKERDVALDLEVWYRRHGAEGVAFDLIVAGGPGSAMPHHRPTDRAIARGDVVLFDIGAQVNGYCADLTRVVAVGD-PGGEVREVYRTVLEANRAGLAAVQAGRTGKDVDQAARDVIARAGHGDRFGHGLGHGVGLEVHEAPTVGPSSDDALEVGTVVTIEPGIYLPGRFGIRIEDLVAVTADGCRILSSSPKD-ELLVV 362
301 0.000e+00UniRef50_A0A0D2J1M4 Peptidase M24 n=3 Tax=Desulfarculaceae TaxID=453228 RepID=A0A0D2J1M4_9DELT  ali  30  2..KKRLAALRMLLKSKELDGILVTLPANRRYLSGFTESSGALLITASDAFIFTDMRYELSAREQAYFNCRIYARGLAWELAHLAPELRLKKLAFEAEGLLVEQKAKLALEGCEFIPTLGMVSFLRRRKEPGEVRSIEAALVLIESVLGEILAQDVTGMTERELALKITRASEDLGAEGPAFDPIVAAGPNGAEPHAVPGDRVIKEGEPVLFDVGARLKGYNSDISRTVAAGEKAGDLFKEVYATVRKAQVAAIDSIFCGMTGKQADSIARQVITEAGYGDKFGHSLGHGVGTMVHEFPSVGPNSPDLLLPGMIFTVEPGIYIPGWGGVRLEQMVEMTEQGCRLLNNLDCFYDL... 364
302 0.000e+00UniRef50_F8A832 Peptidase M24 n=2 Tax=Thermodesulfatator TaxID=241192 RepID=F8A832_THEID  ali  33  20...................ALLVTCQENRRYLSGFSESSGALLITKKEAFILTDPRYQEEAKEEPLFEPRIYRKGLIAELAKLIPLLEIKTLLIEPRYVSVALLRGFEKKSVKIDEARPVIERMREIKDQEEIEAIRKALAIAEEILSEVAKEIRPGVTEKELAAKVI-MMSHKMADGLSFPPIVASGPNAARPHAEPTDKPLKPGEPVIIDMGVKWQGYCSDITRTFFV-EKATGKFKYIYKMVKKAKEAAEQKLKAGVKAQEPDEAARTVFRQEALERHFWHSLGHGVGLAIHEAPTLSCRSHRKLKAGHVVTIEPGLYLPDWGGVRLEDMVVVTDEGFTRLNSLGF....... 356
303 0.000e+00UniRef50_A0A1W6HQU3 Peptidase M24 n=1 Tax=Prosthecochloris sp. HL-130-GSB TaxID=1974213 RepID=A0A1W6HQU3_9CHLB  ali  28  7....KLDMIRRKMAEKGLDAFFVSDLNTIRWLSGFSGSNAKILLSLNDALLFTDFRYSEQVRQEVSVESRIVSGGFASELARYDFGPG-NRMGVERDRMTLEEAEQLKFRKGRIVPLKGFFEEFRMIKDASEILMMQQAAAVSEKVLEKVLPMISPAVSEMDIAAEISYLHRKSGAEKDSFDPIVASGSRSALPHARPTTKKFRSGELIVIDLGCVCKGYASDQTRTVALGRV-SSEARRIYGIVRDAQLLGLESAFEGMRARDLDRIVRDAIADKGYKAEFGHSLGHGVGVEVHEAPSVSSLSEHSLHESAVFTIEPGIYLPGCFGVRIEDTVVMRKDGAEPF--QRFTKELVEL 357
304 0.000e+00UniRef50_A0A1V5H6P2 Putative peptidase n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1V5H6P2_9DELT  ali  30  6...QRIDRARSFLK--GLDAILLSSRPNVTYVTGYTGSDAVAVYTESHTDIFVDSRNTLQAQEESTARVHEIRKR-WEEIYEHLKSLGIATLGIESNVVDVDTFLLLKLKGIEMTPLGGQLKYLRAVKDPGEVSLIREAARISEKALDEVLAQGLVGRREADIAFDLECAMRRLGASSSSFEIIVASGPRSAMPHGAASAKIIRENEPVVIDFGCTYAGYSSDQTVTVCTGDA-GGEFAAAYRHVLEAQSLAIAALAPGVKASSIDKLARDRLDSVGLGAYFGHSLGHGVGMEVHEMPIVSSISKDTLEEGMVITIEPGVYLPGKFGIRLEDMFVITDNSCKRITNIDK....... 349
305 0.000e+00UniRef50_UPI000833FD87 aminopeptidase P family protein n=2 Tax=Bacillus TaxID=55087 RepID=UPI000833FD87  ali  29  2...DRVQRLREKIRELGIDGMMIIHPWNRVYMSGFTGSNGVILITENEAKLITDYRYIEQAQQQATGYEIVHKGRIFDEAAVQIKQMKITKLGFEQEHLSYGMFVKNKSSSAELVPTSGIIEDLRMIKSKDEIEKLRVAAEVTDSAFLHILNFVRSGISELDVARELESFIREHGCTNTGFSPTVVSGYRGSMPHGRASEKLIEDGDMITIDFGANYQGYWADISRTIAVG-NPSPELLTIHDVVLTSFKNCVANLKPGLTDQEVDALMKENIIMHGYNDRSGTGTGHGIGLEVHELPLFSVLKEKTLTENMVITVEPGIYLPNMGGARVEDVILITENGREVLT--PSTKELVIL 359
306 0.000e+00UniRef50_A0A0M0BTG1 Uncharacterized protein n=8 Tax=Candidatus Bathyarchaeota TaxID=928852 RepID=A0A0M0BTG1_9ARCH  ali  30  2...KRINTLQKAFKENKFDGYLVLSNTNITYLTGFSGANALLIPKNGESVVYVYGVNYEQAKDELTVELVERGEQLMDKIVKQAKAFKTEKLAVDAVNIENWRFLSKRLGDEKMLMTDSYIRELRKVKDAREIELMRKAADLTSEGMRVAYETVAPGIREYEVAAEIEYAMRKHGSYGTAFETIVASGLCSAFPHGGCSDRKIREGDLVIVDVGATYKSYRSDMTRTLVAGE-PSEKHKKIYQTVKTAQDKAFEAVKPNAKAKDVDCIARKIIGDAGYGENFVHGLGHGVGLEVHEPPILSPDSKDTLEVGNVVTVEPGIYLVGYGGVRIEDTVSVQRNGAEKLT........... 347
307 0.000e+00UniRef50_A0A1E7H453 Uncharacterized protein n=1 Tax=Desulfobacterales bacterium C00003106 TaxID=1869301 RepID=A0A1E7H453_9DELT  ali  35  9...QRLRKLRKRLHAQSIDMLWVLKEENRRYLSGFRGRAGSLFISESRQLLATDFRYTRQAEEAHGFELVDYSKGVIKVLPRIARDADVRRLGFEAGRVSCIQFQKLSEASVELVPCEGLIEDLRSVKDASELDAIRRSVAITEGVLALILEELEPGISEKEVAWSIEKRIREKGAEEISFPPIVASGKNAAFPHAIPTDRRIRKGEPIIIDMGSRLDGYCSDMTRTVTLGR-PDAEFADIVNIVYDAQQKAIAAIRAGVSSRFVDGIARDYIDRKGFGDKFGHGLGHGVGLAVHEMPALSPRQDTQLEAGMVVTVEPGIYIPGWGGVRLENMIVVQPDGADVLNRMP........ 366
308 0.000e+00UniRef50_Q7A552 Uncharacterized peptidase SA1530 n=273 Tax=Bacteria TaxID=2 RepID=Y1530_STAAN  ali  31  3....KISKIIDELNNQQADAAWITTPLNVYYFTGYHERLFALLIKKDGQVLFCPKMEVEEVKASPFIVGYLDTENPFS-----LYPQTINKLLIESEHLTVARQKQLIFNVNSFGDVDLTIKQLRNIKSEDEISKIRKAAELADKCIEIGVSYLKEGVTEREVVNHIEQTIKQYGVNEMSFDTMVLFGDHAASPHGTPGDRRLKSNEYVLFDLGVIYEHYCSDMTRTIKFGE-PSKEAQEIYNIVLEAETSAIQAIKPGIPLKDIDHIARNIISEKGYGEYFPHRLGHGLGLQEHEYQDVSSTNSNLLEAGMVITIEPGIYVPGVAGVRIEDDILVTNEGYEVLTHYEK....... 351
309 0.000e+00UniRef50_A0A133KGW7 Putative Xaa-Pro dipeptidase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A133KGW7_9FIRM  ali  29  15...................AIWVHKDENVRFLSNFTGDSTELLITPQRHLLITDSRYTEQAAEAEGWEVVNHQGQLYATISKILQEENISLLSVEASSLSVMAYWKLQEQFPELVINNIDLDPLRQVKTDTELYYLKKAAQIAANALQDILPQIAAQHTENEVRIALEQAMLAHGSEHTAFATIVASGKRSALPHGTATDKRIEIGDFVTIDFGAVYRGYHSDMTRTFVIGSA-SDRQRQLYDAVAHVQKESVKKVRSGTVAHTIDAFARQEFEKAGLNQYFIHSLGHGVGLEIHELPTLSPKCETVLEPNMVVTVEPGIYISGYGGIRIEDTVVVKEGEPEIIT--LFPHELMEL 349
310 0.000e+00UniRef50_A0A1Q7JTI5 Uncharacterized protein n=10 Tax=Acidobacteria TaxID=57723 RepID=A0A1Q7JTI5_9BACT  ali  29  10..ERRHQEVRNDAAARGVDALIVTSLPNILYLTNFTGSAAIAVLTADGLHFLTDFRYVTAVQECPALELAAVDGSYDTTLARVLASLPADRIGFEASHLTVSRHRWLVAASHELVPTEGLVERVRVRKDEHEIATLREAARRLSLAARHVLGDVQRGRTEREVAHAIDARLIEAGFTKPAFDTIVASGPNAALPHARPSERKLTEGDLVVLDFGGIYDSYCVDLTRTVSVG-AANGRTRDVYDAVREAHDRAIAAVAPGRSRFDIDAAARDTLGKHGLGEAFGHGTGHGLGIEVHEDPRISRRADEAVAAGMVFTIEPGAYLPGWGGVRIEDDVLVTEQGVEVLTDVTT--DLIEI 381
311 0.000e+00UniRef50_Q485R9 Putative Xaa-Pro aminopeptidase n=15 Tax=Gammaproteobacteria TaxID=1236 RepID=Q485R9_COLP3  ali  33  1MN---LTRLREKILNKSHSAMLIFSDINISYLSTFTGHAATILLTSKGNYLLTDYRYFEQAKTQASHFNVICRDRANQSLASLIEDLDCQSLSFESEHISVMQWQQIHQKLSQIEAVSGAVEALRFIKSTSEISSIEQAAKIADTALAAMLNSVKAGVTERELAIELDYQMAKLGSEEVSFATILLFGERSALPHGIPSDKQLKLGDIILIDFGAVVNGYRSDMTRTFVFGQA-SAEQKHIYQLVQSAQQAAIDAVYEGVLGSHLYQQSANILLNSEYKKYAGEGLGHGVGLVLHEQPFIGPDCHTTIEKGCVITIEPGIYIPGWGGIRIEDDVVLTDEGLKILTKSPKG--LIEL 360
312 0.000e+00UniRef50_A0A1J4S6D2 Uncharacterized protein n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1J4S6D2_9BACT  ali  31  20....................FLVSNPINIFYLAGYDEKDFWLLITSKTNYLLTDPRYSSSVKPSLDFRLLEITKDLAQAIKKVLQDLKIQTLGFEDKGLSFFEFRKFKLKPAELKPFGDPIESLRQIKNKEEVVKIQKAAGIADLAFNHILGFIKPGLTEEDIALMLEIFMRKSGADGISFPPVVAFGKNSAIPHHQTGKTLIQSPGILLLDFGARFQGYCSDLTRTIFLGKPPGELQKR-YELVLAAQNKVLVQVKAGMKAYEADGIVRRVFRENGCEEKFLHSSGHGVGLSVHEGFALSPQNQTILQKGMVFTVEPGLYFPDWGGIRIEDLVLTGKDGVKRISQSPV--EMIVL 360
313 0.000e+00UniRef50_U2SUM1 Putative Xaa-Pro dipeptidase n=30 Tax=Leptotrichiaceae TaxID=1129771 RepID=U2SUM1_9FUSO  ali  31  2..EKRTEKLTKLLDELNLDAIFITDLYNLRYFAGFTGTTGVGLATRKGNFFYSDFRYRSQGEAQVTFEFVEVSRGSLKFVGEHAEKLGLKKIGFEDHNVTFSLYQTLKEQKAELVPIGDKITYVRMIKSDEEIGFIKKAIEISDVAFSEALKIIKEGVSEKEIAGYMEYIQRKLGAEDRSFETILASGVRSAMPHGVASDKKIQKEEFITMDFGAYYNGYVSDMTRTVYYGNNITEKHKEIYNLVLEAQILGVNSIKEGVMSDEVDKIVRNFLTEKGYGKEFGHGLGHGIGLEIHELPYLSSVTQIELKENMVVTSEPGLYFDGWGGVRIEDDVVVKKDGREVLNKS--NKELIII 357
314 0.000e+00UniRef50_R6SKM0 Metallopeptidase family M24 n=5 Tax=Clostridiales TaxID=186802 RepID=R6SKM0_9CLOT  ali  30  4.....LEACKERLRQAGADALIVSSKVGQRYLSDFNYDDGYILVTPDKSYLLTDFRYIEAANNSAEFEVLAPKGGMLAEIASRLRTNNAKTVLFEEEEMTYGLYERDALPGCNLKGGSALLVSLRLYKDEEEIARIRKAQAITDETFSYILTFIKPEMTELEVALEMEFHMRSLGSEGVAFDTIAVSGTNSSRPHGVPRNVRLEKG-FFTMDFGARFDGYDSDMTRTVVLGKA-DTEMKKLYQTVRNAQTAAIEALHVGINCRQVDRIARDLIDGAGYAGCFGHGLGHGVGMYIHESPRFSPAADQVLEVGHVVTVEPGIYLAGKYGCRIEDMIYVHADGVEDLTHSP--KDLIEL 359
315 0.000e+00UniRef50_A0A0A6VAX3 Metallopeptidase n=65 Tax=Bacillales TaxID=1385 RepID=A0A0A6VAX3_9BACI  ali  27  1MNQ-RMKHVMNWLQQENIDAAFITSTDNVFYLSGFHERLLGIAIFQEEPFLICPAMEAHDARNAGWYEIVGYTDNPWDIVEKKVHGRTVRTWAIEKEHLIVERYEQFLAKDAAFVAAEEKLRTLRLIKDEQEKQILQEAAAYADLAIQVGISEIKEGKTELDIVAAIEYELKKKGISEMSFATTVLSGTKAASPHGNPDLTKITKGNLILFDLGVVHKGYCSDITRTVAFGDL-TERQIEIYETVLKAEEAAINAVKPGMLAKDIDLTARNIITEAGYGEYFTHRLGHGLGVSVHEYPSVTNTNELVLQEGMVFTIEPGIYVPDIAGVRIEDDVYVTKDGVEVLTKYPKALQ.... 362
316 0.000e+00UniRef50_A0A2N6BDA5 Integrase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2N6BDA5_9DELT  ali  29  21........LRAILKEQNLDGALVTDLANVRRLCGFTGSNGALLITHSDALFLTDSRYTTQALAETSDVEVREGGGKKLPFGALINDLCLERVGYEGQNLNCAAFLKEKAKSVELCDLGDAVSKIRQLKGPQEIEKMLAASGLAEEALKEAIRLFKPGVTELEIAAEFQIAVIRRGG-KLSFDVIVAGGPNAAMPHAMPGKRKFAEGDLVVVDFGVLLDGYCSDQTVTIPVGRV-SDNFLEVYEVVKRAQDAAISAAVPGATLGAVDSAARDVIAAAGFGDYFGHATGHGLGLEVHELPVVAPKASEVVKEGMVFTVEPGIYIPGEVGVRLEDVVYINSDGNELLSTLNKD...... 362
317 0.000e+00UniRef50_A9WCA0 Peptidase M24 n=9 Tax=Chloroflexi TaxID=200795 RepID=A9WCA0_CHLAA  ali  31  3...NRLQQLRATLAARELPAMLLTAPTSRRYISGFTGSAGALLISAEAAFLLTDGRYLIRAAAEAPHFTLREVRPPAALIADLASELGIKRLGFEAAVMTVAEHRQYTAAAIELVPTENIVEELRMVKDEEEIALLRRAAAITDAALAAVLPALTPTMTEREAAWRLEVALHDLGAEGPSFPIIVAAGRNSARPHHTPGDDVLGEGQPIIIDMGARLDGYHADLTRTIVLGQ-PDDTFRAVYAATLKAQQAAMQALRPGLPWSEADAIARRVIGEAGYAEGIAHSLGHGVGLVIHEAPWLRITAPDPLQAGMVTSIEPGIYLPEWGGVRIEDLVLITTNGYEVLSQAPK....... 359
318 0.000e+00UniRef50_A0A1V5VEU1 Putative peptidase n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VEU1_9BACT  ali  32  8.FQDRQKRLTVLLEKERVPALLVSNLINVRYLTGFACTYGSLLAVGGRFFFLTDSRYIFEARKKAVADEIEETKSAPEVIREILGGAKARKLCFEPEALSFADYEKLRARGVKLIPHSGAVESVRTVKDGSEVAAIKRASAVMARALRETLAETVPGSTEKDIRAGLESRMIMSGAEGIAFDTIAASGPRSAYAHGAPTDRKLAPGDFVVIDFGARVDGYNSDMTRTAHVGR-PSAEDARIYRAVLEARNSAVEAAVPGAPGEAPDRAARLALRKHGLEQYFTHGLGHGVGLEVHERPRLAPGAKEKLVPGMVFTIEPGVYIKGRGGVRIEDTFLQTKDGPVPLTSGSR....... 358
319 0.000e+00UniRef50_A0A1W9U5A2 Uncharacterized protein n=1 Tax=Desulfobacterium sp. 4572_20 TaxID=1971621 RepID=A0A1W9U5A2_9DELT  ali  30  6.FENRLDLLRSKFARLGVDTIWIIQPENRRYLSGFDESSGCLFITLDQALLVTDSRYTIQAQQDV--------------------------VGFDQKA---KEKASQHSPSVELIAVSNLVEEIRMIKGPEEVDMLSRSAQLMGNVLARVISELTPGQVEKDIAWKIEALIREQGADGASFPPIVASGPNGALPHAVPTERRIGEGEPIILDVGAKLNGYCSDMTRTVFLGNPPSD-FKEIYRVVRKAQLLALQSVRPGMKTNEADSIARDVIKNAGFGDFFGHSLGHGIGMAPHERPSVGPLKPEVLKEGMVFTIEPGIYIPGNGGVRLEEMVVLEGDGARVLTTNK........ 329
320 0.000e+00UniRef50_A0A0G0JP47 Peptidase M24, Xaa-Pro aminopeptidase n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A0G0JP47_9BACT  ali  31  2...QRIKDLQKLLKEKRVSSFLITHRPNLKYLFNFHGTRGMALVTQKQAYFLTDARYFNEIKRIKNAKAIEIEKNLQKLWAKFVKKLKIKECFFEENSMTVAQLKFFKKAGIKFKGVQNLAEEIRAIKDSKEIEYTKKSQEINEKTLKEVLKNLKIGITEKEISTLIKIYGLKFGADETSFKPIVAFGKNSAIPHHECNETKLKKGDTVLIDMGMKFKGYCSDMTRTFFFKSKPTKLQEKIYNLVLSAQEKTISNARAKMTGKHVDNFARKMIEKAGYGKNYTHSGGHGIGLEIHEIPSTNQEYKNKFPNNCIITVEPGIYIENFFGVRIEDMIILDSHGNKNITRMPKNLESAII 359
321 0.000e+00UniRef50_UPI0009B1AA36 aminopeptidase P family protein n=1 Tax=Marinilactibacillus piezotolerans TaxID=258723 RepID=UPI0009B1AA36  ali  27  1MNTA-LQQLIQRVSDKQLDMIYIDDPNLIGYLTGFHERVLALFVLKDSVFLFTPFLEASEARAQSSIEEIIDEENPWKIISKQLNRYNFETIGLVENQLTVDRYKQLLANPEQTIDISSMIQEIQLIKSDDELSKMKTAGKMADRALEIGMSALKVGISEQEVVAEIEYELRKLGISEMSFQTMVLFGDHAGSPHGNPGSRKLKANELVLFDLGVVADGYTSDVTRTVAFGDI-SEELKQVYNIVLKAQQTAQAAVRPGITTGELDQIARSIIEEAGYGEYFTHRLGHGLGKTVHEFPSLSKGSSMVVQEGMCFSLEPGIYIENQVGVRIEDCVYVTADGCKSFTHTPKTL..... 360
322 0.000e+00UniRef50_A0A109CEX0 Peptidase M24 n=4 Tax=Nitrospirae TaxID=40117 RepID=A0A109CEX0_9BACT  ali  28  13....RVDKLKAWLSSKRAGAFLITNLTNIKYLTGFTGSSGYLLAAGGKAYFFTDFRYKEQVAETRSCDIMITKKDAIKFIINFLEKKKIKNLSFE-DTISYRTYAQFKQR-FQLRALRDTVENIRIKKDAEELRHIKIAVQRAESALEEIKPRIKAGVTEKAIASMLGESLKAQGVEKIPFDIIVAAGRHSSMPHARPTEKVLEKGDLLIIDWGGESGGYYSDMTRTFLIGGGNDGKKKEIYDIVLKANKRARDSITKGQSAADVDSAARTLIAAAGFGRYFGHSTGHGIGMEVHEQPYISAVNKQKIEENMVFTIEPGIYIPDIGGVRIEDMVCVTGQSAETITNLTRNLEIL.. 363
323 0.000e+00UniRef50_S0SDN5 Uncharacterized protein n=25 Tax=Enterococcus TaxID=1350 RepID=S0SDN5_ENTAV  ali  29  2....KVEKLRKKLAEEKLDGLLVTDKINRRYLCGFTGSNGLLLVTENALQLFIDGRYTRQAQQQTQICEIPVGTSLIEVLRPFVK---GAVFGFEAGTITYQSFINFQALGGRLVATKNMIEELRMLKTPEELSAIRQAAKIADQTLEMILPLIRTGMTELELANEIDYRSKKLGSEGPAFETIVASGPRTALPHAHAGNKKIEANELIMIDFGSIHQGYYSDITRTFAFGEV-DNEIIETYQKVLSAQKQAIETVALGKPLGEIDQVARLVLEQENLVQYFSHNLGHGIGLSCHEYPALAPNETLLIEKNMSFTIEPGVYLPEKFGIRIEDDVAVNESGAEILTH--FNKEWMTI 356
324 0.000e+00UniRef50_A0A1M5LLU8 Xaa-Pro aminopeptidase n=8 Tax=root TaxID=1 RepID=A0A1M5LLU8_9FIRM  ali  33  1............MKEKGLNAFLVSKPENIRYLSGFTGEDAKLLILEDEQYIITDTRYREQAREAPHFELLLDKFPYLEALNK-VRRSCWDRLGIESLHLTYHEYRMLESTDVDLFPLEYEVEELRMVKEEEELECIREAARIGDMVFEEIVSFLKPGITEKKIADRIAFLLREKGCAKEAFDVIAAAGENASLPHARPGEKAVKPGEMLILDYGGFYEGYAADMTRTVFIG-SPSAYFQDAYREVLKAQKIGISVVRAGIKASKVDEAVRDYLKSSGLGDYFVHSTGHGLGLEIHEKPALSPAGDIELKENMVVTIEPGIYIPGKGGIRIEDTVIVKKDGCEIITR--TDKELRII 343
325 0.000e+00UniRef50_M5P3D0 Dipeptidase YkvY n=18 Tax=Terrabacteria group TaxID=1783272 RepID=M5P3D0_9BACI  ali  28  2...KRMEHISSWLREKDISAAFIHSKENVFYLTHFHERLMGVFAFQEEPFFVCPLMEKSQAKEAGWIIGYEDHENPWVLISAALKKRNLAKVAVEKEAISLSRADMLRANGAELVSAEEKLNELRVVKDEQEIAILREAAKLADYGVEAGAAALKEGVAEIEVVAKIEYELKKKGIQGMSFSTMVLFGEKSGQPHGNPGSRTLKAGDFVLFDLGVIIDGYCSDITRTLVY-KNASDRQKEIYETVLQAETAALEMSRPGVRIGDLDLKARGMIEKAGYGDYFPHRLGHGLGISTHEYPSMSHNNDALLKEGMVYTIEPGIYVPEIGGVRIEDDVLVTADGAEALTRYPK....... 358
326 0.000e+00UniRef50_A0A1S8KYI9 Putative peptidase n=10 Tax=Clostridiaceae TaxID=31979 RepID=A0A1S8KYI9_9CLOT  ali  27  1MN-SRIKRVIDNMKKHNLSQMIVTSPSSVFYLSGPGERLMAMYINSGKVTFIINSLFKNSKGLGNNIVTYDDSEEPIPILLKIINKES--TLGIDKNWPAHFLIELMENSNMKFINSSPIIDEVRMIKDEEEIKVLRESSKINDKVMEELIKYIEESKTEKEMAKVIQEIFQKNGIEKLSFETICSYGKNGADPHHIPDDTKLKEGDSIVIDMGGVYNNYCSDMTRTFFY-KEPCEEAKKIYDIVKRANEAGKNAVKPGVKLSDIDKITREVIEKEGYGEYFTHRTGHNIGIEDHEFPSVGGNSDIKAQVGMVFSIEPGIYIPEKYGVRIEDLVVVTETGCEVLNHVSRDMNIL.. 356
327 0.000e+00UniRef50_A0A1D7QT87 Putative dipeptidase ykvY n=20 Tax=Bacillales TaxID=1385 RepID=A0A1D7QT87_9BACI  ali  27  1MNE-RIKTLQENMNRENIDYVMVQSRPNVFYLTGFHERLLGVVIPKEGPTLICPQMEVNQISKLFWIIGYTDSEDPWSKLFSAL-QPDAQVVALEENIWTRFTSWQSNCPGSRYVTCDHLLNAMRLTKSDEEISIMKEAAALADQGIQAGVDALKEGVTEMEVIAQIEYTLKKEGVREMSFSTMALFGEKCGDPHGNPGMRTLQKGDAVLFDLGVEWKGYTSDMTRTVFFGEV-SEEQRTIYQTVLNAHLKAVALCKPGTLIQSLDQTARKEIEEAGYGNYFPHRIGHGIGIQVHEFPSLNDQNQNALTTGMTFTIEPGIYIPDISGVRIEDEILITEDGCVSLNS--FPKDLQVI 360
328 0.000e+00UniRef50_A0A2N1TNE5 Uncharacterized protein n=1 Tax=Spirochaetae bacterium HGW-Spirochaetae-1 TaxID=2013832 RepID=A0A2N1TNE5_9SPIR  ali  28  3...NRLSRAIHTLKKKARLPYLVTDICNIRYLTGFSGSYAWLLLNEGRSFFISDSRYEEYARSIKSVAFTLQKGDIFSLLKGMIKDNGFQQVYLEEQALTLSTYLQMRLRGTKIIPGENEINILRMEKDATELPILRKAAEITDRCFNHLLKFIKPGIYEWDIAVEIEHFYRQNGCRKTSFDSIVASGHGSSMPHYETSKKKVRAGDVILIDMGCTYEGYNSDLTRTIFLNSI-DAEIEKIYHIVREAQEQAIAAVRAGITTGKLDSAARDYIASRGYGENFGHSLGHGLGMEVHELPAIKKNGSLRLKKNMAITIEPGIYLPGLGGVRIEDMVLVTSRGHEVLTGS--NKDIIVI 357
329 0.000e+00UniRef50_A0A174GUD1 Xaa-Pro aminopeptidase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A174GUD1_9CLOT  ali  31  6.YEKRLSGLRAYIEDHGLTGALITSYENRRYFCGFTGSSGYLLVTRDHVVLITDKRYTTQAKEQTDCEIVEHSQDRLGLVADTMKRLGITS-SVMESGMTAGEYLKEHLGDHRTVLEDEYFLELRMVKDEWEIETTREAIRRAEAGFDRLIPRLKIGMTEKDLADELHYLVNREGAEAMSFGTIVASGARGAMAHGFPTNKVIENGDMVVVDFGVMYDGYCSDMTRTLLFGDI-SQENRRIFNLVLESGKRAVEAVRPGVHSSEVEAAHRDVFIREGLDDYALRGLGHGIGLQIHECPRVQIGKDTVLRPNMIFTIEPGLYFPGVCGVRTEDDVLVTESGVENLSH--TPHEIHI. 358
330 0.000e+00UniRef50_A0A175A6E2 Peptidase n=11 Tax=Firmicutes TaxID=1239 RepID=A0A175A6E2_CLOIN  ali  28  2...QRIQKIRSILEEKQIDAILIKSRSNKRYLGALTGSGVKVLVTRDELYQIMDGRYSNEARETTSGFVHEQGNSYLDEVVRLLGSH--ARIGIEAQQVLVKEYLSMQEYGLKTVLLEHELEEARRCKDAQEIALVRKACEITDAIFQETISTIRIGMKETEVSALLQYLAIKNGASAMAFDTIVASGVRGSMPHGRPSEKTFEAHEFITIDFGITYQGYQSDMTRTVCI-QEPKPELKKIYDIVLEAQCAGVDFIKAGIRGNDVDSYVRGIIQGHGYGPYFTHGLGHGIGMGDGELPLLNAGSDTVLEEGMIMSCEPGIYVPGLGGVRIEDDVLIENGRGVPLN--ATTKELIIL 352
331 0.000e+00UniRef50_A0A2U3D8L0 Uncharacterized protein n=1 Tax=Acidibacillus sulfuroxidans TaxID=1765684 RepID=A0A2U3D8L0_9BACL  ali  28  4.....WDRAASELTKMGYTHFIVTPGASFTYLTGLSERLTLFGMRSDGAALLVPKLEASGVSSHQNIKIFNYSDGPTQALQAFVSELDLTRVGIESMQLRVFEANFLLQQGVKLLAADELPMSLRLIKDDQEIAHLQSAAEIVDAALTAALPLFRFGMTELDVAAELEYQMRKLGSQGTPFATIVGSGPRGALPHGGPTTKRITAGELVVLDYGARFAGYAADTTRTLAFGE-PSDTARRVYEIVRTAQQAAIDGVTAGMTAAQVDRLAREVIERAGYGEYFTHRTGHGLGLDVHEYPSIMEGNELALTAGMVFTIEPGIYLPGEFGVRIEDDVVVTAKGALVLTR--FTKELMVV 362
332 0.000e+00UniRef50_A0A068NQ95 Xaa-Pro dipeptidase n=3 Tax=Armatimonadetes TaxID=67819 RepID=A0A068NQ95_9BACT  ali  30  1.....MDKLRAELAREGVEAMLVSDPTNVGWLTGFTGTFGRTIVTPKDALFVTDSRYTIQAQEEVKGMSMVSFANPIEFTAQQARSLGITRLGFETATTTYSQWQRLKFDGIELVPVRDVLSEMRQVKGQDEVDKIRRACGVSDAAFDHVRRLIQPGVTELDIALDLEFFMRRQGAE-VAFPSIVVSGERSARPHGKPSEKKLEIGDFVTMDFGARVEGYNSDITRTVVVGEA-TDRHREVYGAVLEAQLKSLDAIKPGAKARDIDRLSRDVLATHGLDKYFGHGLGHGLGRIVHDTGRLSPSSEDTIRVGQVWTVEPGVYIPGFGGVRIEDDVLVTETGIEIFNHS--TKELLVL 352
333 0.000e+00UniRef50_Q49YD7 Uncharacterized peptidase SSP1059 n=15 Tax=Bacilli TaxID=91061 RepID=Y1059_STAS1  ali  32  2....KLEQITEELKSQQADAAWITTPLNIFYFTGYHERLLALLISNGEQVLFCPQLEVEEVRASPFNGEVIGYLDTENALDKY--DIKFNKLLVESAHLTLQRQRELAFGVQSFGDIDQTIKTLRNIKSDSEIEKIKKACELADKCIEIGVSFLKEGVTERQVVNHIEYEIKAYGVNEMSFDTMVLFGDHAASPHGTPGDRQLKKDEFVLFDLGVIYENYCSDMTRTVKFG-TPDAKAQEIYDVVLKAEKEAIAAIKPGVTIKDVDDIARNIITEAGYGEYFPHRLGHGLGLEEHEYQDVSSTNTNEFKAGMVITVEPGIYVPGVAGVRIEDDILVTENGNESLTGYEK....... 350
334 0.000e+00UniRef50_A0A1M7SW48 Xaa-Pro aminopeptidase n=1 Tax=Desulfovibrio litoralis DSM 11393 TaxID=1121455 RepID=A0A1M7SW48_9DELT  ali  31  10.YETRREKLRKKMHSKGLDALIINYDANRFYLSGFEESSGLLIITSGKDWLCTDSRFYEAAKRLWDEKIFIYKTNPAEQIGELIKNNITGKIGFEANTTSVNFYHKLLNTNQTLVPSDGLVEELRIIKDNHEIELLSRACKLNHELMNAVPQMLKNGASEIQIAWDIEQFFRNKGASGLSFESIVAIGKNAALPHAIPSNEKTIDNCPVLVDVGCRLNDYCSDQTRTFWVGDKPTKSFKETFSQVQEAQMAAIEILRPGLSVNEAYSTALNIFKKYKVEQYFTHGLGHGIGLETHETPSLNATRTTILEAGMVITVEPGLYYSDWGGVRLEFMVLITENGYKIL............ 364
335 0.000e+00UniRef50_T4VBD4 Xaa-Pro dipeptidase n=57 Tax=Clostridia TaxID=186801 RepID=T4VBD4_PARBF  ali  29  1MNK--IEKLVKLLEEKKLDAIYLTNDQNVNYISNYNDEDAFAIISKKGNFLITDTRYMELAESLCKFELVNWHRNIGKAVEDVCLKNNIKTLGFEGSSLTFEKYEAFKKSEINLVCSDGLIEELRYVKNQEEIDNIKKACEIADKALEELIPHIKVGVTERELAAKLEYFMKMNGAHNLGFDTILISGAKTSLLHGKPSDKKIERGDLLLIDYGAMYNGYRSDTTRTFIVGEA-NQKQIELYELIKKAQLVGIENMKDGVHATVPDAKIREVVKE--YEQYYYRGLGHGIGRGLHEEPFLGNYGTKTLKEGCVVTMEPGVYFPGWGGIRIEDTVLVTKEGPQILT--KFPKELMIL 357
336 0.000e+00UniRef50_UPI0005D2B897 aminopeptidase P family protein n=1 Tax=Ruminococcus sp. HUN007 TaxID=1514668 RepID=UPI0005D2B897  ali  31  1MTETNIEKLMSMIPDSHTCAM-VTDPVNRRYFTGFRTSAGTVLCFRDKAYFIVDFRYYEKAAETVKGMDVILQDDADEQIAEILCRHAAETLMIEADTMTVSELREETFGDDVYIDLSEMIRDLRIIKDDTALDKITEAQRIAEKGFEYVLENIKRGMTEKEVALMLDNRMKILGAEDISFDTIVLFDRNASLPHGVPGNDRLEKG-FVLMDFGAVVDGYHSDMTRTFYAG-TPSEREKKAYETVLKAQLAGIKAAAPGLTGKQLDAVARDIINATEFEGSFGHSLGHGVGMEIHEEPYVSSKKEDVLEPGMIITVEPGIYLPGEFGIRIEDMGMITEDSFNDITKAP--KELIMI 357
337 0.000e+00UniRef50_A0A1E8GP97 X-Pro aminopeptidase n=2 Tax=Floricoccus TaxID=1930830 RepID=A0A1E8GP97_9LACT  ali  28  2...ERIEKLRNLMKEDSVESLLITNLNNIFYLTGFWGTSATVLVTENEQYFITDARYTLIARETVKNFKIIESRQPLVEVDSILKSENISSLQFEGE-VSFAFYQNLKNTSVDLKASSNLVEKLRIIKDNSEIKLIEKACSISDQAFIDVLDFIKVGISELDVANFLDFRMRELGASGISFETIVASGNRSSMPHGVASDKLLELGDTITLDFGCYYNHYVSDMTRTVFLGQ-PEDKMVEIYNTVLESNNTLINQTRAGLLYKDYDGIARDVIEQTGYGDYFTHGIGHGIGIDIHEDPFFGKTSEEKLQAGMVITDEPGIYVDDLGGVRIEDDLVVLDDGCKIITKAP--KELIII 351
338 0.000e+00UniRef50_G4KQR0 Proline aminopeptidase n=15 Tax=Firmicutes TaxID=1239 RepID=G4KQR0_OSCVS  ali  30  5......NQIAEVLESQNLDAMLLTQEANRFYASGFHGTDGVALVTKTKNYYFTDSRYTEAAARHIQNAVISEGRGYVTLINEALAKQGAKRGGFEDAYMTVADYELRKNLRCELVPATELLLELRKVKDAEEQETMIAAQRIAERALGDILKEIRPGVTEKEIAARLQYLMLHYGAENMSFDPIVVSGPNGSLPHGVPSEKAIQSGEFVTMDFGCIYHGYCSDMTRTVAVGSV-TDEMRRVYETVLVAQKAGIAAAAAGVTGKAVDGAARKVIEDAGYGDYFGHSFGHGVGVEIHESPNASPRNETPLPAGAVISAEPGIYLPGKLGVRIEDVLFLKDCGCTDITLAP--KNLMIL 357
339 0.000e+00UniRef50_W7DI08 Aminopeptidase YpdF n=14 Tax=Bacillales TaxID=1385 RepID=W7DI08_9LIST  ali  36  4.....................................................................VKIKGQFFEEVQGIIAELGLQTLYFEETYVTVAEHLMQSFFSAKLEPFSDLLEDMRKVKTASELSAIRAACEIADAAFTHILTFIKPGLTELEVSNELEFFMRRNGASGSSFDTIVASGLRSALPHGVASDKIIEVGDFVTMDYGCYYNGYCSDMTRTIAIGE-PSAQLKEIYAVTLEAQLKVIDSLKPGMTGIDADAIARDYIASKGYGDAFGHSLGHGIGLEIHEGPNLSMKSPNILVPGNVVTDEPGIYLPGIGGVRIEDDILITETGNEVLTHS--SKELIIL 288
340 0.000e+00UniRef50_B5Y692 Proline dipeptidase n=405 Tax=root TaxID=1 RepID=B5Y692_COPPD  ali  31  1MNQKRLEKVLEGMTQAGLSQMIISDPTNIFYLTGKWERMLVLLIRSEQPTLFVNELFPIREKLGLDVVTYNDSQDPIALLLPHIA--PDKPLGVDKNWPARFLIELMHQSPIDFVDISSIVDSVRAIKDDMEQQLMREASHINDQAMERVLHLIPNLHTEKKVSRLLLDIYEELGADGYSFEPIIAYGPNGADPHHESSTTSLKEGDSVIIDIGCRKNFYCSDMTRTVFYKKA-DDLQRKIYNIVLEANLKAIETVKPGVRFCDIDAAARNHIENFGFGGYFTHRTGHSIGLDVHETGDVSSVNTDIVQEGMIFSIEPGIYLPGKFGVRIEDLVLVTPTGCEVLNH--FPKELQIV 360
341 0.000e+00UniRef50_A0A174A618 Xaa-Pro dipeptidase n=6 Tax=Coprococcus TaxID=33042 RepID=A0A174A618_9FIRM  ali  29  1MN-TRIQKIVDAVKKNGHDGIVISKGSDIKYLTGFTGEYGVLLLTEQKNYFVTDGRFEFQAAQETEFEVVVYGENYFSQTGKLAAEAGVKQCAICGADLTFDDYQDLQAPDTKFVSEGSYVEPLRAIKTPEEIETIEQACRISERSFYALLDVIKPGVTEIDIANELEYQFRSRGGSGFCFETIVASGPNGANCHATASDRKIQLGDFVTIDFGTYYHGYCSDITRTVAVGKAKNPELYKMFDVVRKAKDAGQNSLKPGMVMGELRDIIVKVVEDAGY--HIPHGPGHNFGLDIHEQPYICTGSKVTLQPGMVHTIEPGIYIPGIGGVRQEDDFLITEDGYRRITN.......... 351
342 0.000e+00UniRef50_A0A0H3XMY5 Xaa-Pro dipeptidase n=1 Tax=Spiroplasma eriocheiris TaxID=315358 RepID=A0A0H3XMY5_9MOLU  ali  33  6........VTDLLVSNDLDAILITSKVNRYWYTNFPSSSGYLLITRTKAFLLLDGRYLTDAKTKVQNAEIIAIKDIFKDLKTLITAAEIKKLGFENEYLTYDFYLMYQENGMSLIPTS--VRQLRMVKTPEEINLLQHSAWITDQALQQVIDNFDVGMSEDDIENIIFTTFAKLGADKIYPRAIVTSGVRGSLPHGKPTTKPIMQGELVTIDFGCVYQGYYSDMTRTLAVGEI-SSQLQEIYEVVQTAQRLGVQAIAPGVKASDIHRICYDYINQKGYGEYFVHQTGHGVGLEVHEAPRIATYDNTPLQAGMVVTVDPGIYLPNVGGVRIEDDILVTTNGFEYLTK.......... 341
343 0.000e+00UniRef50_D5GYL3 Xaa-Pro dipeptidase n=6 Tax=Lactobacillus TaxID=1578 RepID=D5GYL3_LACCS  ali  27  1MHNERLKTLRRMMQQNGLDAILITSQANRYYISNFTGTYARVIVDLHSQYVIADGRYFYQLKEQPDFEIIDDKMQISKTIADFVVQKDYKTFGVESKEMNVEEYLAIKETNTKIIPTSDFIEHLRMIKDPTEKQKIEQADEISAKAFEHIKQFIHPGLTEKDVANELDNYGLKLGADSRAFETIVASGLRSSLPHGHASQKIIQNNEPIIIDFGFKVDHYYSDVTRTIHLGKVKD-QIHDIYEIDREAQQKAIEACEIGKPLKEIDAVARTVISKYGYGKYFLHGLGHGIGLTVHEYPLLNQSSSAVMKAGMTFTAEPGIYVENVGGVRIEDDLFMGEDKAHQLTHITKEWDQLE. 357
344 0.000e+00UniRef50_A0A1Q2HPG4 Putative peptidase n=3 Tax=unclassified Phycisphaerae TaxID=1546154 RepID=A0A1Q2HPG4_9BACT  ali  30  5.FQQRVKSARKNIKEQNCQAGLFTSWANVNYLTGFRGDDSWVMVSPRQVFLLTDSRYTEQARECFGCKIVSRKGSMIEAVGSLIKRYKVNNIAV-QRDMPYGASQDIEYKGVQLHPIESVVSSVRAIKDEAEIANIRKAVNISGKVLKFALAELKPGITESEFAGLIEYQMRKHSA-GRAFTTIACFGAGGSEPHHIPGKRKLRKNDYVLIDYGASWKGYCSDITRSFAVGRA-GEEYRRAYETVKLAQKAAIDMIAPGVKMADADKAARKVIKDSGFDVY-GHGTGHGFGLDIHEQPRLSGKSLDIFTPGHVITVEPGIYLSGKFGIRLEDDILVTENGREILSRGEKSPELEIV 358
345 0.000e+00UniRef50_UPI0009FA755B aminopeptidase P family protein n=4 Tax=Vibrionaceae TaxID=641 RepID=UPI0009FA755B  ali  32  11...............EQFDALLVSDPHHKRYLSGFTGSGGYLLLTQLGCELLVAGKYWQQVAEQSCLSVSTDQHGWLETLQQRLNVHGIQRLGFESHALSFQQVEQLKALSQQLVPTNNVVTPMRRWKSEQEIALIRKACEITETAIERGLRDFHLGMTEHQLAAHLEFHARMLGADSIDF-LIVVSGERGALPHGRPSQRVIEQNELVTIDFGVVYQGYHSDVTRTFCTGPV-SEQLQAIFDAVFTAQRMGVEMLRPGIAASRVDDGVRQYLARQGYREAFCHGLGHGVGLQGHEYPKLASDSSATLEVGMVVTVEPGVYLPQIGGVRIEDTLAITENGCESLTQLPRELRMI.. 350
346 0.000e+00UniRef50_R6CST6 Creatinase n=4 Tax=Terrabacteria group TaxID=1783272 RepID=R6CST6_9CLOT  ali  31  1MNQ-RMQLLKSAMQQDKVEALIISRGSDIKYLTGFTGEYGVLLLTADKDYFITDGRFTNQAEQETEGLEVIRGSSYFARTGELVKQCGIKECGIYGEDISFADYQALTKTGTHFVQAAPYVENLRRIKTPEEIATIRKACRISERSFYALLDVIKPGVTEIDIANELEYQFRSRGGSGFCFETIVASGPNGANCHATPSMRKIQQGDLVTIDFGTRYQDYCSDITRTVAVGEIKNQELLNIYRIVRDSKREAEKVLAPGLAMSQLHKVINQYVEERGYK--IPHGPGHSFGLDIHEAPFISAANDYQLQPGVIHTIEPGIYVPGVGGVRIEDDYLITESGFERLTN--ITDELIIL 359
347 0.000e+00UniRef50_A0A2T2WL84 Uncharacterized protein n=2 Tax=Sulfobacillus acidophilus TaxID=53633 RepID=A0A2T2WL84_9FIRM  ali  33  25.......RFQEALRERGWDGAVIASPENLRYLSGFTGSSAYLVVSTENAWLLTDSRYLQQASEAGDCEVLEQGVHVAASIARICREHGIFTLGWEDDKVPVRLFKEWLDTPVVWRPLDHLIEELRLIKTSEEIDAIRRAAQIAGAALMEVLGNL-VGRREIDVALDLEVAMRRLGAESLAFPTIVASGERGALPHAHPTDRVIRSGELATIDYGAQVEGYKSDETVTVATGPIPAD-LRRVWMVVKQAQTQAIATIRPGMSSRDVDEAARNVIRRAGYGDAFGHGTGHGVGLDIHEAPFASPNSERPLEAGMTITVEPGVYLAKIGGVRLEDTFVVTPTGFERLTIVRKSLSFLI. 379
348 0.000e+00UniRef50_J7ITC7 Xaa-Pro aminopeptidase n=10 Tax=Peptococcaceae TaxID=186807 RepID=J7ITC7_DESMD  ali  26  4.YTARIQKIQAIMKSQNTDYMVFAPTSHLFYLTGLDERLQVFLVPAEGPVMIMPDMYREAAEEEKNFETWSDETDPVNLLLPLIKK-GSAIAAIDERWAGHFLSLRRAFVGFEFIGVSNLMREIRMFKDQYEMSQLAKAGGLTDKVMAEVRMVIQPGISEKELAFFVESKLKEYGAEELSFKPIVASGPNTSSPHHYTGERKLQMGDLVVLDFGGLFQGYCSDMTRTFSVGKA-SAEVKKVFNAVKDANEAGFLAVQQGIACEKVDEVAREVISRAGYGEYFIHRTGHGIGLDIHEDPYIVKGNQEILKTGMTFSIEPGIYLPGKFGVRIEDIVGLTENGPVRFNN--FSRELIE. 363
349 0.000e+00UniRef50_M7NID0 Putative peptidase n=14 Tax=Bacillales TaxID=1385 RepID=M7NID0_9BACL  ali  28  4.....IQMIREELKKRGLDGLIINGEWNRRYVTGFTGSHGLVLITQETTEMIVDYRYYEQAAQQTGLPVVLHAEKIFDEAAREITKHGLKSVGFEQQHLSYGNYERLKSRTAKLVPTFDFVQNIRMIKRPDELEKMRMASKVTDDAYTHILGYIRPGQKEREVADELVRFIESRGGHAVGFYPIVASGVRSSLPHGRASDKVIEKGEMITIDFGANYDGYWSDISRTVAVGE-PDAQMREIQEVVYRSFMDCFHNIQPGMKDSDVDALMRKALIESGYNDRSGTGTGHGIGLEVHEKPLFSVDTEKTLEPGMVITIEPGIYLPGIGGARVEDVLLVTEEGCETLT--PSTKELVVI 358
350 0.000e+00UniRef50_Q5HNJ7 Uncharacterized peptidase SERP1271 n=219 Tax=root TaxID=1 RepID=Y1271_STAEQ  ali  30  3....KIKEIKKVLQQEDADAAWITTPLNIFYFTGYHERLFALLIPSEEPVLFCPKMEVEEVKQSPFIIGYLDTENPFDKYSKTFS-----KMLIESEHLTVKRQRELAFNIEHYQDVDQSIKDLRNIKSEDEIINIKKAAALADKCIEIGKSFLKEGVEEREVVNHIENEIKKYGVNEMSFDTMVLFGDHAASPHGTPGDRKLQQNEFVLFDLGVVYHHYCSDMTRTIHFG-TPNKEAQNIYNIVLKAETEAIKSIKPGVTIKDIDKIARDIIEEAGYGDYFPHRLGHGLGLEEHEYQDISSVNNNQLEAGMVITIEPGIYVPHVAGVRIEDDILVTENGYEILTQYEK....... 351
351 0.000e+00UniRef50_E2MY72 Creatinase n=20 Tax=Corynebacteriaceae TaxID=1653 RepID=E2MY72_CORAY  ali  27  8.YAARRAALIDALSDNDCDGFLTVDPTHVGWLTGFHGSNAGLIVAASGEALLTDGRYTVQAGKQAPDVELLTARNTGVALLGQARKLNIARLGVESEFLTMAAYQELEDQALELVSTTGVVAKRREVKSDTELVALRHVADIAVRAFEDLLGIVVAGRTEREVAAELEYRMRMHGADRPSFDTIVASGPNSAKPHHGAEDRVIEAGDLVTIDFGAFAGGYNSDMTRTLFAGETADEKAREIYNVVLEAQLAGVKAAVPGADVVAVDAACRDIIEKAGYGEHFVHSTGHGIGIEVHEAPFAARTGKGKLAAGMTLTIEPGIYVPGFGGVRIEDTLIITDNEPEIITQLPKPR..... 389
352 0.000e+00UniRef50_A0A1J4Z540 Uncharacterized protein n=3 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1J4Z540_9BACT  ali  28  7........LKKRLKTENLDALFVSHPANVSYLSGFSGNESYILVTRGKDFFITDFRYYQQARLELKDFSIELTGNHFDLIAGLIKKGRLKRVGFEAKHITYGEVIRDRLNGQEFLPVFDFIEDMRVIKSARELEIISRCIQINLTALKDLKNRIAPDKEESEIAALMEYKMKLAGALRPAFDTIVLSGKNCSMPHGAPGARPIKNNHVVLVDSGVYFNGYNSDLTRMFLLGKIP-PIINKILSVTQMAQEIAIGAVRPGITASVVDMAARDYIAKKGFARNFGHSLGHGVGREVHEAPQISARSKTILKPGMIFTVEPGIYIPGSGGVRLEDMVLVTEKGVKVLSR.......... 347
353 0.000e+00UniRef50_A0A0C1KAR3 Xaa-Pro dipeptidase n=4 Tax=Chlamydiia TaxID=204429 RepID=A0A0C1KAR3_9BACT  ali  32  3.FQNRLAKVEKVLHDSNVEAFLVEDPTNLYYLTGLVLSAGELLITQGNSALLVDNRYYEYCKNQAPVPVFLSDKNSLESL-----LGGINTLAFDGETISYQTYMQENFKDLKLVSLSHSLQKIRCLKDEHEIAILQEAAQLGMQGYEYIKSLLKEGVREDQLAAELEIFWKKNKAQGVAFEPIIAFGANSALPHYRPEETELREGMTVLFDVGVKWKGYHSDLSRTLFWGEPP-AIMRKVYAIVEKAQQRAMALCKPGITIGELDRAARDYISACGYGEHFLHSLGHGVGLEIHEWPSLRNKEQLPLQEGMVITIEPGIYLPGIGGVRIEDTLLITSTGYQVL............ 345
354 0.000e+00UniRef50_A0A1V5ZHT4 Putative peptidase n=1 Tax=Candidatus Latescibacteria bacterium ADurb.Bin168 TaxID=1852850 RepID=A0A1V5ZHT4_9BACT  ali  31  1............MRAERVDRFLVTCPEHVRWLSGFSGSSAWLVVGTREKVLLTDFRYRDQAAQAPDWRAVITQNGLVACVRELAAGWGDSRVGFESAHLTVKDHRALTSPKVQWVATEQIIERELFVKDEAEIAAIARSAAIADAAFAEVLPLVKPGVTERDLAAELEYRVRKLGADRMAFPPIVASGPNAALPHAQPSDRRIRTGDMVTFDIGAQRDGYASDMTRTIAVGKA-SKKLQKVYGIVLEAQMRAVAAVRPGLSCVELDGVARSYIQEQGFAEAFGHSLGHGVGLRVHDGPSISWRSQETLAEGMVITIEPGIYLTGWGGVRIEDLAVVTGKGCRVL--CSTPKELRIV 350
355 0.000e+00UniRef50_A0A1V6D8U4 Putative peptidase n=1 Tax=Planctomycetes bacterium ADurb.Bin126 TaxID=1852903 RepID=A0A1V6D8U4_9BACT  ali  28  14...ERRRGLIRLARKHKVQAMLVTRVEDVGYLSGFTGHDSWLLVGEESAILITDGRYDEQARECPGLEVFVRPAGLAAAVKECLKGRGVRRLGVQKGNVTVGLHGALTLGAAKVRASDDLVDQLRVIKDQQEVRAIERALRVAEQAFVELTAKALIGRTERQIAAELEYRMRMLGADKPSFESIIAAGPNGSKPHYRPRDRVVRKGEAVLIDWGAMVDGYCSDLTRVVFTGTIP-PKIAELYEIVLRAQQAGIAALSVGASCKKVDAAARQVVEDGGYGKQFVHGLGHGLGRQVHEAPSLARTSDTRLRCGMVVTVEPGIYLPGVGGVRIEDDVLVARQGPRRLSRLSRDLQAMVL 372
356 0.000e+00UniRef50_UPI000690C108 aminopeptidase P family protein n=1 Tax=Edaphobacter aggregans TaxID=570835 RepID=UPI000690C108  ali  33  20..................DGLLVTHLADVRYLCGFTGSNAALVLAGARAVLFTDGRYTAQAKDEVAGRVVIAKKPAVTAACEWMVEVGVKRCGFDAVHTTVAAFETMRKAKVRFVAVEPLVARLREVKDADEIAKIRAAAELGGKLFDEMLGYLRPGLKEMEVAATLEHAARMAGAEAMSFETIVASGERSALPHGRASGAKLPKRGFVTLDFGVVLNGYMSDMTRTVHLGKAR-PEEREVYDAVLEAQETAVAAVATGVTAGEVDEAARSVLRRAGLEEYFTHSTGHGVGLEIHEGPRLAAKQTQVLQQGMVITIEPGVYMPARFGLRIEDMVLVTAAGSEVLTPSVK....... 356
357 0.000e+00UniRef50_UPI000A043BC6 aminopeptidase P family protein n=1 Tax=Roseimaritima ulvae TaxID=980254 RepID=UPI000A043BC6  ali  31  3.YAARLDRLRSEIASQSLDALLVTSEINVRYLTGFTGDSTYLLVHAEGETLLSDRRYETQLQQECPDLVRGPDRTMLQLVEQALEKWGNQRVGLEADHVSWADQTQFAAASSQLQPTSGLVEAIRCIKDEAEIAILRRAVWIAERTFEGLQAQLRPGWTELEMAHEVESLMRRLGASGCGFAPILAVDANAALPHAHPGRQTLDQAEVLLVDWGAKYQGYTSDLTRTLSIG-PPSDKFRQVYQVVLEAQQAAIDAMAPGVALAEVDAAARQVIADAGFGEYFGHGLGHGIGLQVHEFPRMASISKGTLEAGMVVTVEPGIYLPGQFGVRIEDDVLITAGGHEVLSELAKGLE.... 358
358 0.000e+00UniRef50_A0A1H9ZJ58 Xaa-Pro aminopeptidase n=2 Tax=Nonomuraea TaxID=83681 RepID=A0A1H9ZJ58_9ACTN  ali  34  20................EVPALLVTSAVNVRYLTGLASSNAAVLVRADGSALLTDNRYIGKARTL-GVPVVEASD-----VAARLAEPGA---GIEAASMTVATYRRL---GAGLVPLGPVVEELRAVKDDDELELLRTACAITDQAFADVSARVVPGMTERELARLLENRMTELGADKPAFDSIVAAGENGAIPHHAPTDRELRAGDLVTMDFGARYQGYHADMTRTVSLG-PPAGWQREIYDLVAAAQRAGRHALAPGASAGDVDRAARSIVAEAGHGEHFRHGLGHGVGLEIHEEPFLGPSRTGRLEDRVPITVEPGVYLPGRGGVRIEDTLVTRAGGPELFT--KTSKELLIL 345
359 0.000e+00UniRef50_A0A0G3GRQ9 Xaa-Pro aminopeptidase n=86 Tax=Corynebacteriales TaxID=85007 RepID=A0A0G3GRQ9_9CORY  ali  30  9.FSNRRRALASAIAAQRLDAILVTHLTHVRYLSNFSGSNAALLVNKDTARICTDGRYTTQATEVPDIEALIERNSAVALLGTV---QGPRRVGFEADYLSVTQLEKLQAADVQLVPVSGVIEKLRLVKDNLSQQRLRDVAALATTALDDLLGELAVGRREIDVAADLEYRMRKLGAERPSFDTIVASGPNSAKPHHGASDRVITAGDLVTIDFGAHDRGFNSDMTRTFVMGHA-DEFAAEIYQVVLEAQLAGVAAATPGTQLVDVDKACRDIIEAAGYGEYFVHSTGHGLGLDVHEAPYAAQTGTGVLAAGMTLTIEPGIYVPGRGGVRIEDSLLITDGAPEIITIM--SKELTIV 364
360 0.000e+00UniRef50_A0A1C5SVJ2 Xaa-Pro dipeptidase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5SVJ2_9CLOT  ali  29  1MN--RLQELSTRCFPGKADALIITAPVNRQYLLGFHSSAGTLVFLPEKWYFIIDFRYFEKAQQQVTGCELILQDKLYDQINEILSTHQVKTVGLEDDSVTLSELSYRKRLQVEVVTGSGMIAEMRLVKSAQEIEQVALAQKMSEQAFLEMLKVIRPGMTEKEVALELEYRMKKQGADGISFDTIAVAGKNSSLPHGEPGDYRLENGDFLTMDFGALVHGYHADMTRTIGIGEV-SEKQKKVYHTVLEAQRLAFEQIRPGRVCSEIDSAAREYIDSCGYQGCFGHGLGHGVGLEIHEEPRFSPLCDAVLREGMILSVEPGLYLPGEFGVRIEDLVVIEKDGFRNLNTSP--KELICL 355
361 0.000e+00UniRef50_A0A2V2CVZ4 Peptidase M24 family protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2CVZ4_9FIRM  ali  28  3.HRKRIEQLREMMKEKYIFGVYVTSPENVFYLSGFTGGDARLLIGRTNAWLITDSRYTVQAAEECPEYTLITAENP-AALEALLRNETICTVGFENERIAYRDYKVLKERFVQLTELNGYFTELRDVKEEQELFCIEKACRIACCSLHEVLDFIRPGTAESEIAAELEYRMRKNGASGKSFETIVASGKRSAMPHGVASDKKIENGDAVTIDFGCIYKHYCSDMTRTFFVGR-PDAELERIYHIVYEAQIAAMEGYRFGMTGAELDGISREIIAGKGYGSNFGHSLGHGVGIEIHEGAAISRRNTEAIRKDTVFSIEPGIYVEGLGGVRIEDLVAAGENGLRILT-ADFDKKMLVL 359
362 0.000e+00UniRef50_A0A2K9JWT1 Putative peptidase n=29 Tax=Alteromonadales TaxID=135622 RepID=A0A2K9JWT1_9GAMM  ali  30  5.YAARQQRLVNKLQQHQSDAIIIYGYENIVYLTGFTGHAATLLMSSNGRHLITDYRYFERASDEAVGVEVILRNRDKETLPDCIFRLGPRQLAFEAHQISHADYLNISAKNTTLIAAPLWVESLRQVKDGYEINCIKRAAEIADSALAHTLPLLKVGITERDAAIELEYQMQKLGSEGLSFDTILLFGARSSLPHGNPGQTKLNLGDLVLIDFGAVISGYRSDMTRSYVLGE-PTKQQQSIYDTVQHAQRAALALIKAGVNCIDLNNASHDVLSHSDFSQYAGEGLGHGVGLFLHEQPFIKPGVDHQLEAGNIITIEPGIYIPNYGGVRLEEDVLVTENGFECLTHAP........ 355
363 0.000e+00UniRef50_A0A1V4XKN8 Aminopeptidase n=1 Tax=Syntrophaceae bacterium PtaB.Bin095 TaxID=1811717 RepID=A0A1V4XKN8_9DELT  ali  33  17....RIERMLDRLPDFSADALLVLDLKNIRYLSGFSGSDGALFIGRDRCALLVDGRYTTQAREETSGLEVVEYREKIEGLAGVLENGRPFTVGFEAAAMTVETHMKLRLKKTALRPLPETFRTIRAVKTEEELDRISTAAAIASRALASVLERIRPGMRERDIAADLEAAMIREGAEAVAFPTIVASGRNSARPHARPGLREIQRGDTLTIDYGAVLDGYHSDETCTVFVCRADTS-QKEVYGIVREAQAEALKAVRAGVRCSEIDRIARSRIEAQGLGGYFSHGTGHGVGLDIHEFPRIAATSEDVLEAGMVVTVEPGVYIPGFWGVRIEDLALVRDGEPAVLSGMPKAMQILEI 369
364 0.000e+00UniRef50_A0A1M4T596 Xaa-Pro aminopeptidase n=1 Tax=Ferrithrix thermotolerans DSM 19514 TaxID=1121881 RepID=A0A1M4T596_9ACTN  ali  27  7..KNRIENLKSLIADRKEEALFISNLTNVRFLSGFTGSNAAMIVFAHPSVFLTDSRYEEQASLELQRFLISEPKGYLELVSSETRRNDIRRLAVETSHLSVADYNELLGQEVEVVDGDQSVQLLRRTKDITEIQEIEKACQIADRALSYTKTLLTTGVTEREFAIELEYQMLKFGAEDRSFPSIVASGERSSLPHGHPTDRRIREGDVVVVDFGAVHSGYHSDCTRTYFFGE-PSAEVRETYELVLEAQQRAVATLCPGVTGREMDGAARSVFKENGVDQYFAHGLGHGVGLDIHERPFISTDTEVEITEGFVVTIEPGLYLSGRFGVRIEDTILVSKDGSNQLTRADK....... 367
365 0.000e+00UniRef50_UPI0007C51CC4 aminopeptidase P family protein n=1 Tax=Pediococcus inopinatus TaxID=114090 RepID=UPI0007C51CC4  ali  30  1MYTNRIKNLQTKLGHLKVDALLIENEFNLLYLTGFDGGDGRLFITPTDATLITDARYEEDLHERLEVGILMITRNYMEVITNQVKENSVKVLGFEDTIVYQDFAKLTQLPNLSLKATAGVVNQLRAVKGSEEIAANIKAIELSDQGFNYLLTQIKPGLTEIQVSNILDNWMKAHGSTGASFETIVASGVRAAMPHGAATSKIIKAGEMITIDFGYYVDGYTSDITRTIALGE-PDPKLKEIYNIVKAAQQKTMDAVKPGVSGKALDKIGRDFITSKGYGKEFNHGMGHGIGLDIHEYPSYGAMSEYAVSQNEILTVEPGIYVKDLGGVRIEDDVLVTETGYQRLS--KITQELIIL 357
366 0.000e+00UniRef50_A0A2E5F1F6 Uncharacterized protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5F1F6_9CHLR  ali  32  1MILNRLQLVREEMRHSNLDFLLITDPSNRQWISGFTGSSGIVLISKQTAYIATDSRYWIQVEQQPDFELVKIAGATTSIATELIEKSDASNFGYEPENLTMKQYQDYTKNTPNFIAAPSIINKLRMSKDSGELTSLIKAVEIADAGMNHAFQIIQPGMTEKTLAWEIQKNVIENGADSLSFNTIVAGGERGALPHARPLNIALANKTGVVIDMGVKVNGYCSDLTRTFFLG-TPTDKFKKVYDVVLTAQMMAIERIEVGMTGAEAHEIAASVIAEMGYGNYFGHGLGHGVGIDVHEAPRLSPASDTILENGHVFTIEPGIYLPGWGGVRIEDQCLMEAGKVRSLTKSPKDLEIGVI 366
367 0.000e+00UniRef50_A0A254WWL7 Uncharacterized protein n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254WWL7_9CYAN  ali  28  16MSTNRLSQVQQAMQAEGLDALFVANPKNVQYLAGFKTTEGYAVIYKGECHLLCDGRYISGVRKLSGITPQLITRTFADKIREIIGS-GRKTVGFERGAVLYGDAVALLEPDIDWKPADDILTTLRVIKTADEVELIRKAQAITGQCFDHMKTFIKPGMTEKQVGVEIETYLRSN-SDGNSFAPIVGFGETACNPHYTPSTRKLEKNQMVLLDFGGIYEGYCGDMTRMLFFGKA-DDRYREVYDLVLTAQKNCVAAVKPGAVCQDLDAVCRDYFKSKNCADAFMHGTGHGVGLAIHEDPRLKPTFRNPVAPGMVFSVEPGLYYAGWGGIRIEDLVAVTPTGCENLTT--TPKDLIEI 385
368 0.000e+00UniRef50_A0A160T7L7 Putative M24B family peptidase n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A160T7L7_9CHLR  ali  27  5MHSQRLQRLTEQIVAHGLDGLALVPGPNLLYFSGIHERPMVLIIPADDPAIIIPTLEAMKAEAAGRIFAWDDTEGFHGAFQQACAHLELADLGVEALHMRVLEMQTLQAPGLQIAHAEPALSALRAVKEPAEVAAMEKAIAVAEKALQRIAKRIKIGLTERQIAAMLTQELLASGAESIAFGPIVAAGPNSAIPHATPSDRAIRAGDLLVIDWGVYVDGYPSDITRTFAVGPI-DPELQRIYEVVKLANEEARRAIRPGLTGRQIDRVARDVIEDAGYGDYFIHRTGHGLGLEIHEAPDMSPANDRPIVAGNVFTIEPGIYLPGRGGVRIEDNVVATQDGSRTLTTY--DRELLTV 370
369 0.000e+00UniRef50_UPI000DC79F4A M24 family metallopeptidase n=1 Tax=Blautia sp. N6H1-15 TaxID=1912897 RepID=UPI000DC79F4A  ali  31  22.YQKRVEKIQKKFLEDGLDALLLTRGTDIRYLSGFTGEDAVLVLTEKKQFFITDGRFTNQAAENWEILLWRSGSSLYKETGLLLHQLQIKRAAVDIYDISHGSYQELQVWEGSLEFCKPYVSNLRRVKEKEELELIKQACKITEDSFLAFLPKVSVGMTEMELRNILEAEFRVRGSEAVSFDTIVASGSNGGNPHASLTGRKIEKGDMITVDFGAKYQGYCSDITRTFAVGK-PDKKLQEIYQVVYEAKQAGRELLKCGVQASAVDGAIRSVIEQAGYS--LVHGPGHGFGLDIHENPFLGPGNAYAMEE-MVVTLEPGIYVPGLGGVRIEDDYLIQKDGGECLT-PQITEELIIL 379
370 0.000e+00UniRef50_UPI000C1BDE20 aminopeptidase P family protein n=1 Tax=Lentibacillus sediminis TaxID=1940529 RepID=UPI000C1BDE20  ali  28  5MN-TRLAKLREAMHKQDLEAVVIFSRENRRYFADFAGSSGALIITESEALLLTDFRYYVEAKSSDYFEVIQHGGQLTESVGEHLKKLELKNVGVE-DSLAVGEMETLKKAGITFSLISSAIMEIRMRKDESEIASIREGIRLCDLAFDHILHFIKPGMSEKEIGLELEYVMKKNGAEGIKANHVIASGERSSLPHGQATDRIVQQGEFVKMDYGAVVNGYFTDFTRTVVLGE-PSEKQLEIYQIVNHALDVALEHVGPGKVCSELDEIGRSIIRDAGYGDNFGHSLGHSLGLDIHEKPAMRSTDQTVLEPDMVITVEPGIYISGWGGCRIEDLVVIRENGIENLTTA--TKELQVL 360
371 0.000e+00UniRef50_B1HQQ3 Xaa-Pro dipeptidase n=29 Tax=Bacillales TaxID=1385 RepID=B1HQQ3_LYSSC  ali  29  1MFQTRREKLVSRM-QQDVDLAILVPGPNMHYFTGLHERLTFAVITANDLYFLLPQVELNKIDPSYGGVIYSDEEGPKQAIQQLKKELGLQTIGVEFDTMHVHEQKSIEMLTYELYDIGENIRELRMKKELQEIAFMRQAVQIVEESLAATLPTIQAGVTEMEVAAQLEYEMRRRGSEGTPFGTIVASGYRGALPHGRASTKKIEAGEFIVIDFGAIYKGYVADMTRTVALGDV-SPTLQNIYSLVKQANEAAIDAIKPGMTAQDLDGIARGIIRNGGYGDYFTHRLGHGIGLSAHEEPYLMQRNLIVLEEGMAFTVEPGIYLPNVGGVRIEDNLLVTDNSYENL--MTFSKELIIL 361