current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] COG0011 Uncharacterized conserved protein, from COG1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# E-value Template Links and tools%idFirst MPKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYRLast
1 2.000e-25UniRef50_A0A076GZP0 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A076GZP0_9SYNE  ali  27  39MTWVSIDLCVVPIGVGVSLSPFIAACQRQIAQSGLKSQLGPNGTAIEGPWDEVMACVHACHQELHMGAPRIYTTLKINTRTDRQSFEDKVNAV. 133
2 3.000e-25UniRef50_A0A143HM50 Uncharacterized protein n=13 Tax=cellular organisms TaxID=131567 RepID=A0A143HM50_9GAMM  ali  17  2..KVHADLCLIPLGVGVSVGTYIAECQRVLDEAGLEYRLHAYGTNIEGDWDRVMAAVKRCHERVHAGAPRISTSLKLGTRTDRQSLQDKIDSVQ 95
3 4.000e-25UniRef50_P72699 UPF0045 protein sll0230 n=300 Tax=Bacteria TaxID=2 RepID=Y230_SYNY3  ali  20  22..NVIVDLCVVPLGVGVSVGQYVAACQKVLAEAGLKHTMHAYGTNIEGDWDEVFAAVKACHEAVHAGAPRITSSMRFGTRTDRQTMDEKVKSV. 114
4 2.000e-24UniRef50_Q7UYW9 Uncharacterized protein n=20 Tax=cellular organisms TaxID=131567 RepID=Q7UYW9_RHOBA  ali  17  2..KVIVDLCVVPMGVGVSVGKYVAECQKVLQEAGLKHQLHAYGTNIEGDWDEVFAAIKLCHERVHAGAPRITTSIKVGTRTDRQSMQDKIDSV. 94
5 3.000e-24UniRef50_A0A2G1WEA0 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2G1WEA0_9PLAN  ali  16  2..KVIVDLCVVPMGVGVSVGKYVAECQKVLQEAGLEHQLHAYGTNIEGDWDQVFAAIKRCHERVHAGAPRITTSIKVGSRTDRQTMQDKINSV. 94
6 1.000e-23UniRef50_E3L0H7 Uncharacterized protein n=76 Tax=Fungi TaxID=4751 RepID=E3L0H7_PUCGT  ali  17  11MTRCTADFCLIPIGDGASVGKYITECQRVLAKTGLEYKMHGYGTGLEGPWDEVMNAIKACHEAVHMGCPRVATDIRIGTRIDKSSLSQKVESV. 107
7 1.000e-23UniRef50_I4BXX8 Uncharacterized protein, MTH1187 family n=3 Tax=Synergistetes TaxID=508458 RepID=I4BXX8_ACEMN  ali  29  1MGKVVAEITVVPIGTGPSISSYVAEVEKTLRSFNLKIQLTPMSTILEGEFDEVLKAAKAAHNCFERGALRVSTTLRIDERRDKLTMEGKVKAV. 96
8 1.000e-23UniRef50_Q46KR0 Uncharacterized protein n=13 Tax=Cyanobacteria TaxID=1117 RepID=Q46KR0_PROMT  ali  24  3...VSIDLCLVPIGVGVSLSPYIKTCLSIIEEHKLEHELGPNGTAIEGEWDQVFECVKKCHEAVHKGAPRVYTTLKVNTRTDKKQLKEKVGSVR 95
9 1.000e-23UniRef50_A0A1G6ELY2 Uncharacterized protein, MTH1187 family n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1G6ELY2_9DELT  ali  22  2..NVLAELSIFPMDKGESLAPYVARAVTIIEQSGLAYQLGPMSTVIEGEWDQVLEVVSRCQNDLAKDCDRILVYLRLDCRRNRVDMGAKVKSVQ 94
10 2.000e-23UniRef50_A0A2N5U1E2 Uncharacterized protein n=2 Tax=Basidiomycota TaxID=5204 RepID=A0A2N5U1E2_9BASI  ali  17  42MTHCTADFCLIPIGDGASVGKYIAECQRVLAKTGLEYKMHGYGTGLEGPWDEVMNAIKACHEAVHMGCPRVATDIRIGTRIDKSSLSQKVTSV. 138
11 2.000e-23UniRef50_A0A0E9NH61 Uncharacterized protein n=2 Tax=Dikarya TaxID=451864 RepID=A0A0E9NH61_9ASCO  ali  21  4..NCTADFCLVPMGTSPSVGAYIARCQQILERSGLKYELHGYGTGLEGDFTEVCEAIRKCHEAVHEGCPRIATDIRIGTRMDKSSLEQKVQSVR 98
12 5.000e-23UniRef50_A0A291P860 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A291P860_9GAMM  ali  17  3...VIIDLCVVPLGVGVSVSPYVAACQRVIEDAGLEHRMHAYGTNIEGSWDEVLAVVKRCHEAVHAGAPRITTTLKLGTRTDRQHMDDKLESV. 94
13 5.000e-23UniRef50_A0A0S7WRS2 Uncharacterized protein n=3 Tax=candidate division TA06 TaxID=1156500 RepID=A0A0S7WRS2_9BACT  ali  21  1...MVVSFSIIPLDKGVSLGKYVARVTELVEESGLDHRLTPMSTIVEGDWDEVFDLIRRCHERMREDSVRVVTTIKVDDREGATRLDGKIQSV. 91
14 8.000e-23UniRef50_B5YLA3 Uncharacterized protein n=46 Tax=root TaxID=1 RepID=B5YLA3_THEYD  ali  21  1...MIAQFSIIPLGVGVSVSQYVAKVIKVVDESGLPYRLHAMGTIIEGEWDEVIGLIKKCRDILMNEVERVVIDIKIDDRKGKGRIEAKIKSV. 91
15 9.000e-23UniRef50_A0A1G7YB00 Uncharacterized protein, MTH1187 family n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1G7YB00_9RHOO  ali  27  2...VLLEFSMFPTSVGESKSAYVARIIDIIDKSGVTYQLTPMGTILEGEWPEVMGVVTACFEALKADCPRISTQLKVDYRAGGESMKTKIASV. 92
16 1.000e-22UniRef50_A9BB42 Uncharacterized protein n=16 Tax=Terrabacteria group TaxID=1783272 RepID=A9BB42_PROM4  ali  20  3...VSIDLCLLPLGVGTSLSPYIAVCRDIIEEKGLDYELGPNGTAIEGDWNDVFECIRACHEAIHSGANRIYSSVKVNTRIDRQSFREKVKSV. 94
17 1.000e-22UniRef50_A0A1F5J4B6 Uncharacterized protein n=1 Tax=Candidatus Dadabacteria bacterium RIFCSPHIGHO2_12_FULL_53_21 TaxID=1797756 RepID=A0A1F5J4B6_9BACT  ali  22  2..KMIIELSVIPIGAGTSLSEYVADVMRVIESSGLKYESHSMGTNIECGWDDVTPLVRKCHEALAKGVERISTTVRISERTDKPTMEGKMKS.. 93
18 1.000e-22UniRef50_UPI0008549649 thiamine-binding protein n=1 Tax=Candidatus Marispirochaeta associata TaxID=1560235 RepID=UPI0008549649  ali  39  1MPAMHLSLQILPRVDEEKLYPTVDKVIALIKESGLPHIVGPMGTTIEGEIDELFEIVKEAHRCLAEGATRVGSVIKTDMKPGGISFDEKVGKYR 95
19 1.000e-22UniRef50_O67847 Uncharacterized protein n=2 Tax=Aquifex aeolicus TaxID=63363 RepID=O67847_AQUAE  ali  22  49....LVFVSMTPLGKGESVSQYVARVVDIIDKSGLPYVLTPMGTIIEEDWDEVMEVLKKGFEALKEDCNRISITMKIDYRKGKKRLIQKVKSVQ 140
20 2.000e-22UniRef50_A0A1H0AGN7 Uncharacterized protein, MTH1187 family n=3 Tax=Bacteria TaxID=2 RepID=A0A1H0AGN7_9DELT  ali  21  2..STLAELAIFPLDKGESVSEYVAKVLKIIQQSNLEHQLTPMGTCIEGEFDDIMNIVSKCFKALEPECNRIYLTLKIDFRKNKNALKQKIKSV. 93
21 2.000e-22UniRef50_A0A1H4AWG7 Uncharacterized protein, MTH1187 family n=1 Tax=Desulfuromusa kysingii TaxID=37625 RepID=A0A1H4AWG7_9DELT  ali  17  2..KVIVDLCVVPMGVGVSVSKYVALCEKILTEAGLKTRLHAYGTNIEGEYDQVFAAIRQCHEQVHAGAPRISTTIRMGTRTDRQTMADKIQSV. 94
22 3.000e-22UniRef50_H1XVB1 Uncharacterized protein, MTH1187 family n=124 Tax=root TaxID=1 RepID=H1XVB1_9BACT  ali  25  2...VLIEFSMFPLDKGESLSPYVARILDIIDKSGVNYRLNPMGTVLEGDYDEVMGVVRQCFKALEKDCRRISMTLKMDYRKNESRLEKKIQKV. 92
23 3.000e-22UniRef50_UPI000DBDBCCF hypothetical protein n=1 Tax=Aspergillus homomorphus CBS 101889 TaxID=1450537 RepID=UPI000DBDBCCF  ali  19  104.PHCTADFCLIPIGTSPSVSAQIADVQRLVEKSGLKFVMHSAGTTLEGPWDKVHQVIGQAHTILHQGIVRIQTDIRVGSRTDKQSFEDKVNKVR 199
24 7.000e-22UniRef50_A0A150J0G5 Uncharacterized protein n=8 Tax=Euryarchaeota TaxID=28890 RepID=A0A150J0G5_9EURY  ali  26  1...MIVEISFVPIGVGTSLSRYIAKVIKNIEKSGLKYQLTPMGTIIEGEWDEISNLIDYSHNIFEMGIERIITNIKIDYRLDKSSMQDKIDSVK 93
25 7.000e-22UniRef50_C5K8Q3 Uncharacterized protein n=1 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5K8Q3_PERM5  ali  17  60...VLADVCIVPMGVGTSVSKYVSEVEKVLRGHGVTTTLHGYGTNIEGQWSDVMAAVKAAHEVLHEGCPRVSSSMRFGTRIDKQTMQDKVDKV. 152
26 8.000e-22UniRef50_J3P969 Uncharacterized protein n=8 Tax=Sordariomycetes TaxID=147550 RepID=J3P969_GAGT3  ali  18  55.AACYADFCLIPVGVGVSVANEVAEVQRLLKASGIKYTMHSAGTTVEGSWDEVMKVIGQAHAVVHRGCQRVQSSLRVGTRTDKQTASEKVKRV. 148
27 9.000e-22UniRef50_A0A0G2E9N0 Putative cell wall biogenesis protein n=76 Tax=Eukaryota TaxID=2759 RepID=A0A0G2E9N0_9PEZI  ali  16  13.PACTADFCLIPLGTTPSVSREVAAVQRLLQASGLHYTMHSAGSTLEGSWDDVMRVIGQAHALLHQGVVRIQSDIRVGSRTDKQSFEDKVAAV. 107
28 1.000e-21UniRef50_A0A1G3C3H7 Uncharacterized protein n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3C3H7_9BACT  ali  20  1...MVVNFSIVPIGKGNSLSTQVAEVLKIVSESGIDYKLHAMGTILEGDWDDVLGLVKKCHKKILKDSDRVLTTISIDDHKGRTRIAGKVQSVK 92
29 1.000e-21UniRef50_G7V6K3 Uncharacterized protein n=53 Tax=cellular organisms TaxID=131567 RepID=G7V6K3_THELD  ali  22  1MGKVIAEVVIVPHGTGTSLSPYVAEVEKILRSYDLKVMLTPMGTILEGELDTVLKAVRAAHEPFKAGALRVGTTIRIDDRRDKASMEQKVKSV. 96
30 1.000e-21UniRef50_A0A1Z8WWW5 Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z8WWW5_9GAMM  ali  32  2..KVMVDLCVVPMGTGVSVSDEIATLEQLIRKSGLKNQLHPYGTVIEGEWEEVMRLVKKCHTLLHQGTKRIFTSLKIGTRVDKQTMEDKVNVV. 94
31 2.000e-21UniRef50_K8EIF3 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=K8EIF3_9FIRM  ali  39  1MPVINLGFQVLPKVPDGNTYAAVDRAIEVVQRSGVKYQVGPMETVMEGELDTLLAIVKQAQECLAAGASEVMTFVKIHYRPGGVTIDEKMAKYR 95
32 2.000e-21UniRef50_B2VS20 Uncharacterized protein n=38 Tax=Eukaryota TaxID=2759 RepID=B2VS20_PYRTR  ali  17  13.PSCIADFCLIPLGTTASVSKEVAEVQRLLKKSGLDYSMHSAGTTVEGSWDEVMRVIGQCHSMLHQGIVRIQSDIRVGSRTDKQGFKDKVEVV. 107
33 2.000e-21UniRef50_E4ZWU7 Similar to cell wall biogenesis protein Ecm15 n=75 Tax=leotiomyceta TaxID=716546 RepID=E4ZWU7_LEPMJ  ali  19  14.PACIADFCLIPLGTTASVSKEVAEVQRVLKRSGLVYKMHSAGTTVEGSWEEVMRVIGQCHALLHQGVVRIQSDIRVGSRTDKQSAEDKVAAV. 108
34 2.000e-21UniRef50_A0A292PWI6 Uncharacterized protein n=8 Tax=Pezizomycotina TaxID=147538 RepID=A0A292PWI6_9PEZI  ali  18  18...VYADFCLIPIGTGTSVSKHVADVQRLLKKSGLNYHMHSAGTTVEGSWEDVTRVIGQAHSMLHQGISRVHTDIRIGSRTDKQTMQDKVASV. 110
35 3.000e-21UniRef50_A0A235BYI9 Uncharacterized protein n=1 Tax=candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 TaxID=1973747 RepID=A0A235BYI9_9BACT  ali  24  1MP--IFDISVSPLGTGTSVSRYVRAAFEVIKKSGLKYTLSPMGTCLQGDWDKIFATIKQIHDTLAMGCGRLVTSIRIDDRRDKQPMQAKVERV. 94
36 3.000e-21UniRef50_A0A1F9M1L7 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11 TaxID=1797896 RepID=A0A1F9M1L7_9DELT  ali  21  1...MLAEFSVTPLDRGGKLGPLVAESLAIVRRSGLTHQLCPMGTVVEGSLDEVFAVIKACHENMLRHSERVSTSIKIDDRKGGGRLAGKVASV. 92
37 4.000e-21UniRef50_E6VVM0 Uncharacterized protein n=2 Tax=Desulfovibrionaceae TaxID=194924 RepID=E6VVM0_PSEA9  ali  28  2..SVVVQFSIFPLHATGSLAPYVARAVEVVRASGLPFQLGPMGTVVEGEWGEVMAVINACYRELEPDFDRIYVSFTADSRRGRQDMASKVASV. 93
38 4.000e-21UniRef50_C5LT90 Uncharacterized protein n=1 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5LT90_PERM5  ali  17  60...VLADVCIVPMGVGTSVSKYVSEVEKVLRGHGVTTTLHGYGTNIEGQWSDVMAAVKAAHEVLHMGCPRVSSSMRFGTRIDKQTMQDKVDKV. 152
39 4.000e-21UniRef50_A0A1F9INW8 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=A0A1F9INW8_9DELT  ali  23  1...MLAEFSVIPIGIGESMGDQIARVLKIVDESGLAYKANPMGTVIEGSWEDVMAIIKKCHQEVIKSSPRIVTSISIDDRPGKPRITEKLKS.. 90
40 4.000e-21UniRef50_C4XQ82 Uncharacterized protein n=47 Tax=root TaxID=1 RepID=C4XQ82_DESMR  ali  23  2..SAILDFSIFPLDKGDSLSAYVARAIRIVRESGLPYVFSPMSTSIEGEWDEVLAVVTRCKEALEKDCSRIHVAVRIDWRTGPGRLTAKIQAV. 93
41 4.000e-21UniRef50_A0A125PJ50 Uncharacterized protein n=2 Tax=Rhodotorula TaxID=5533 RepID=A0A125PJ50_9BASI  ali  20  26....TADFCLVPMGVEVSVSKYIAECQRVLEKSGLKYQLHGYGTGLEGEYGEVMKVIEQCHEAIHAGCPRIATDIRIGTRTDKKSLAAKVSSVK 132
42 5.000e-21UniRef50_A0A1F9E3S4 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A1F9E3S4_9DELT  ali  21  1...MLAEFSIIPVGKGESAGATIAEVLRLVDESGLAYKAGAMGTVVEGEWDAVMGLIKKCHDAAAGTAPRLLTHITIDFRPGK........... 80
43 5.000e-21UniRef50_A0A1S6IYR5 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1S6IYR5_9FIRM  ali  22  2...AIVEVTVIPLGTDTSLSSFVAGCVKILQQSGVQYQLTPMGTIIEGELASLLELVRQMHEPFLAGASRVTTTIRIDDRRDKTTMQSKVAAV. 94
44 5.000e-21UniRef50_Q4WPN6 Cell wall biogenesis protein Ecm15, putative n=26 Tax=leotiomyceta TaxID=716546 RepID=Q4WPN6_ASPFU  ali  21  13.PHCTADFCLIPIGTSPSVSSQIADVQRLIEKSGLKYVMHSAGTTLEGPWDKVHQVIGQAHMLLHQGIVRIQTDIRVGSRTDKQSFEDKVNKVR 108
45 5.000e-21UniRef50_A0A0F4GJ78 Uncharacterized protein n=1 Tax=Zymoseptoria brevis TaxID=1047168 RepID=A0A0F4GJ78_9PEZI  ali  19  93.AKCTADFCLIPIGTTASVSHEIAAVQRLLKKSGVKYSMHSAGTTLEGPWTTVMNLIGQCHSLLHAGVVRIQSDIRIGSRTDKQGFEDKVRAVQ 188
46 5.000e-21UniRef50_G7WFR0 Uncharacterized protein n=30 Tax=root TaxID=1 RepID=G7WFR0_DESOD  ali  40  1MANIIMALQVIPKVEESRIYEVVDEAIKVIAASGVPYEVGPMETTMEGEPDQLWEIIKEAQECLRAGASRVMAYIKMDYVPTGSTIHEKIDKYR 95
47 7.000e-21UniRef50_A0A1G7T5Q5 Uncharacterized protein, MTH1187 family n=8 Tax=Bacillales TaxID=1385 RepID=A0A1G7T5Q5_9BACL  ali  34  1MPNALLSIQVIPKTPGESVIPYVDRAIEVIQASGVKYQVNPLETTMEGDLDQLLDIVKQMNEALISGSPGVISQIKISYNPDGVSMDKLTEKYR 96
48 8.000e-21UniRef50_A0A167ZF55 PLC-like phosphodiesterase, TIM beta/alpha-barrel domain protein n=6 Tax=Hypocreales TaxID=5125 RepID=A0A167ZF55_9HYPO  ali  18  379.AACYADFCLIPVGTGKSVAEEVAEVQRVLKASGLKYTMHSAGTTVEGAWDEVMTVIGKAHTVVHRDVLRVQSSMRVGSRTDKQTAEDKVKRV. 473
49 8.000e-21UniRef50_Q58452 UPF0045 protein MJ1052 n=7 Tax=Methanocaldococcus TaxID=196118 RepID=Y1052_METJA  ali  27  4MRKVVAEVSIIPLGKGASVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAFKEAHSTVLNDVDRVVSSLKIDERKDKETIERKLKA.. 96
50 1.000e-20UniRef50_A0A2I0SA21 UPF0045 protein ECM15 n=21 Tax=leotiomyceta TaxID=716546 RepID=A0A2I0SA21_9PEZI  ali  17  26.AACTADFCLIPLGTTASVSKEVAEVQRFLKKTGIKYSMHSAGTTLEGTWDECMKVIGQCHTMLHAGVVRIQSDIRVGSRTDKQSLEDKVNAV. 120
51 1.000e-20UniRef50_J3KLD4 Uncharacterized protein n=26 Tax=leotiomyceta TaxID=716546 RepID=J3KLD4_COCIM  ali  17  32.NHCIADFCLIPIGTSPSVSETIADVERLVEKSGLKFLMHSCGTTLEGPWDKVFALIGQTHAMLHQGTARVHTDIRVGSRVDKRTMENKVKVVQ 127
52 1.000e-20UniRef50_X6ND88 Uncharacterized protein n=1 Tax=Reticulomyxa filosa TaxID=46433 RepID=X6ND88_RETFI  ali  20  35..HVVADICVTPLGKSPSVSKEIASLVEIIRDSGLKSHLHACGTNVEGDWADVFDIVKKCHECLHKGFPAVSTSIRCGTRTDKQSLHDKVDHV. 129
53 2.000e-20UniRef50_A0A2S8GCI1 Uncharacterized protein n=3 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8GCI1_9PLAN  ali  21  2...VLLEFSMSPLNKGDSVSQYVARSLKIIAASGLDYRLHAMGTIIEGEIEEVLAVMQKCLEAMAEDCDRVTCTAKLDYRKGAGRLESKVESV. 92
54 2.000e-20UniRef50_G2MT48 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=G2MT48_9THEO  ali  39  1MPVVNLSLQVLPVVSEEKVYPIVDKVIEYIKRTGVKYVVGPMETTMEGELDTLLEIVKKAQECIKEGASRVISVVKIDYKPEGVTIDEKIKKY. 94
55 2.000e-20UniRef50_A0A1B1Z7R2 Uncharacterized protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1B1Z7R2_9BACI  ali  20  1MP--IADITIIPIGTETSVSSYVAEIQKVLQEGKVKYQLTPMSTLIEGELSDLFDVIQQLHEPFANGIQRVATNIRIDDRRDKSTMEGKLQAVK 97
56 2.000e-20UniRef50_A0A2M8D5N0 Uncharacterized protein n=1 Tax=Acidobacteria bacterium CG_4_9_14_3_um_filter_49_7 TaxID=1973888 RepID=A0A2M8D5N0_9BACT  ali  16  15.HKMIAEFSIVPFTGRESLSAHVAHIHRIVQESGLSFRLTPMGTIIEGQPRAVFDLIYTCHMEMKGHANRVFTRISIDDRGDDLRMDKKIAAVQ 108
57 3.000e-20UniRef50_G7Q4M5 Uncharacterized protein n=4 Tax=Desulfovibrio TaxID=872 RepID=G7Q4M5_9DELT  ali  18  2..SAILDFSIFPLDKGESLSAYVAKAVRIVRESGLPYVFSPMSTSIEGDWDEVLAVVTRCKEELEKDCRRIHVAMRVDWRDGPSRLAAKIRSV. 93
58 4.000e-20UniRef50_A0A2D6ZZU1 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2D6ZZU1_9RICK  ali  14  5..TVSIXICLIPMGVGTSVSKYIVECQKIFKKYHLKTYLHAYGTNIEGDWDTVFNAIKECHIVCHKGAPRINTTIKCGTRIDKQXLQDKIDSVK 98
59 4.000e-20UniRef50_A0A0G4KKM0 Uncharacterized protein n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4KKM0_9PEZI  ali  14  185...CYADFCLIPVGTGVSVAKEVAEVQKLLKASGLHYQMHSAGTTVEGSWDDVFRVVGQAHALVHAGGVRVQSSMRVGTRTDKKQFEDKVKRV. 277
60 4.000e-20UniRef50_A0A1Q7HR79 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1Q7HR79_9BACT  ali  27  2...AIVAISVTPIGTGPSVGEYVADALRVIERSGLRYRLNAMHTEIEGELEQVLDLVPAIHACFARGAKRVSTVLKIDDRRDALSMEAKVRSV. 94
61 4.000e-20UniRef50_C4JQ42 Uncharacterized protein n=1 Tax=Uncinocarpus reesii (strain UAMH 1704) TaxID=336963 RepID=C4JQ42_UNCRE  ali  20  145..HCIADFCLIPIGTSPSVSEAIADVERLVGNSGLKYLMHSCGTTVEGPWDMVFKLIGQAHSMLHQGMVRVHTDIRVGSRVDKKTIEAKVKVVQ 239
62 4.000e-20UniRef50_M7T0J9 Putative plc-like phosphodiesterase protein n=1 Tax=Eutypa lata (strain UCR-EL1) TaxID=1287681 RepID=M7T0J9_EUTLA  ali  15  447..RCYADFCLIPVGTHASVAEEVAEVQKLLKASGLTYTMHSAGTTVEGSWDDVMKVIGQAHSVVHAGVVRVQSSMRVGTRTDKQTAQDKVKRV. 540
63 4.000e-20UniRef50_A4BJC1 Uncharacterized protein n=3 Tax=Saccharospirillaceae TaxID=255527 RepID=A4BJC1_9GAMM  ali  16  2..KCMADLCVIPFNGNISVADEIAQCHRVLQRFNLDIQLHGYGTNLYGEWDEVFAAIKACHELHDQGIVRISSTIKVGTRTDKQTIQDKVDAV. 94
64 5.000e-20UniRef50_A0A2A4LV08 Uncharacterized protein n=2 Tax=Cellvibrionales bacterium TaxID=2026722 RepID=A0A2A4LV08_9GAMM  ali  23  2..KVHIDLCLIPMGGNISISDEITACQRVFERRGLTHRLHAYGTNVEGDWDEVMAAVKECHECVHQGRARIASTLKIGTRTDRQSLDDKVSSV. 94
65 5.000e-20UniRef50_A0A0V0Q866 Putative Thiamin/hydroxymethyl pyrimidine-binding protein n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0Q866_PSEP  ali  18  5..KCIVDLSVTPMGKSSSVSEEMVQIQKIIKKSGLSHQMHAEGTNIEGDWDTVFTVIRECHEKLHEGIARISSNIRISTRTDKQTIQGKLDRV. 97
66 5.000e-20UniRef50_C5UWA3 Uncharacterized protein n=18 Tax=Bacteria TaxID=2 RepID=C5UWA3_CLOBO  ali  44  1MSLCNVSLQVVPSVPEEMIYPVVDKVIEYIESTGVKYEVGPMETTMEGELEFLLEIVKKAQECVEEGAARVISMIKIDYKRDGVTMDEKIKKYR 95
67 6.000e-20UniRef50_A0A0Q4BHK8 Uncharacterized protein n=1 Tax=Methanomassiliicoccales archaeon RumEn M1 TaxID=1713724 RepID=A0A0Q4BHK8_9EURY  ali  25  2..NVIAEFTIIPVGVGESISPYVAECLKIVRTSGLRHELTATCTIVEGELDEVMRTILECHRKVRSMSPRVVTSIRIDDREGESDIERKVSSV. 93
68 8.000e-20UniRef50_A0A1E5G148 Uncharacterized protein n=44 Tax=cellular organisms TaxID=131567 RepID=A0A1E5G148_9BACL  ali  23  2...AIAEISIVPIGTGTSVSHYVAEVHKMLKEGTIRYQLTPMSTILEGELEQIFKVLQQLHEPFEKGANRVLTTLKIDDRRDKQKMEDKVKSV. 98
69 8.000e-20UniRef50_Q46213 UPF0045 protein CPE1503 n=140 Tax=Bacteria TaxID=2 RepID=Y1503_CLOPE  ali  46  1MDTCNVSLQILPSVEDSRLYEVVDKVIEYIESTGVKFEVGPMETTMEGKIDDLLEIVKKSQECIEEGAGRVISIVKIDYKKGGVTMDEKVGKYR 95
70 8.000e-20UniRef50_A0A0M4DHL6 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=A0A0M4DHL6_9DELT  ali  22  2...AVVEVSITPLGAGIGVSRFVAGALRRLKESGLHYQLTPMGTVIEGDLDEILRVVRLMHEPFNEGAQRVSTQIKIDDRRDVETLASKVRSV. 94
71 9.000e-20UniRef50_A0A2H3FMV0 Uncharacterized protein n=3 Tax=Sordariomycetes TaxID=147550 RepID=A0A2H3FMV0_GIBZA  ali  23  11..SCYVDFCLLPLGTGVSVAEDIAEVQKVLKASGLKYTLHSAGTTVEGSWDEVMAAVGKAHAAVHKGVVRIQSSMRVGSRTDKQTAEEKVKRV. 104
72 1.000e-19UniRef50_C9Z6Z6 Uncharacterized protein n=613 Tax=Actinobacteria TaxID=201174 RepID=C9Z6Z6_STRSW  ali  24  1...MIVAFSVTPLGVGEDVGEYVADAVRIVRESGLPNRTDAMFTSIEGEWDQVMDVVRRAVAAVEERAPRVSLVLKADIRPGVTDLTSKVETV. 91
73 1.000e-19UniRef50_A4J9F5 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=A4J9F5_DESRM  ali  35  1MSIVNVGFQVLPKTKGDNSYQIVDKAIEVVQKSGVKYEVGPMETVMEGELDVLIDIVKRAQECITAGASEVMTYIKIHYRPEGVTLDEKIAKYR 95
74 1.000e-19UniRef50_L8FVF5 Uncharacterized protein n=16 Tax=Leotiomycetes incertae sedis TaxID=221903 RepID=L8FVF5_PSED2  ali  15  10.ATAVADFCLIPIGTTASVSAEVAAVQRLMKASGLSYTMHSAGTTVEGSWDAVFRIIGQAHTLVHNGVLRVQTDIRAGTRTDKQHFAEKVSKV. 104
75 1.000e-19UniRef50_A0A0J1F603 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A0J1F603_9FIRM  ali  38  3.NKIMMAFQVLPKVEEERLFEVVDEAIAVVAASGVKYEVGPMETTMEGEPDQLWAIIRQAQDCVKAGASRVLTYIKMDYNPGLTTIDEKIHKYR 96
76 2.000e-19UniRef50_U6EED8 Uncharacterized protein n=9 Tax=cellular organisms TaxID=131567 RepID=U6EED8_9EURY  ali  20  2...ITAELTVIPIGTDTSLSKYVAAAIAALDETQVDYKLHGMGTLLEADPDDLFEAIKIAHEVFKAGSQRVVTSVKIDDRRDRQTMEKKVQSVK 96
77 2.000e-19UniRef50_A0A148NAM9 Uncharacterized protein n=2 Tax=Methylothermaceae TaxID=1486721 RepID=A0A148NAM9_9GAMM  ali  25  2..KVQIEFSLIPIGGDPHLSEDIALCEKILADYGLEVELHAMGTNIEGDWDAIMQALKACHEIMEKGRSRIYSVLKIASREEEKSFQEKVASVR 95
78 3.000e-19UniRef50_P54499 UPF0045 protein YqgV n=466 Tax=root TaxID=1 RepID=YQGV_BACSU  ali  16  2...AIADVTIIPIGTETSVSAYVADVQKILEEGKIKYQLTPMNTLIEGELSDLFAVIQAIHEPFQKGLHRVATNIRIDDRRDKTTLESKIESV. 98
79 3.000e-19UniRef50_F6BGW0 Uncharacterized protein n=25 Tax=Bacteria TaxID=2 RepID=F6BGW0_THEXL  ali  43  1MSAVNVSLQVLPIVEEERIYPVVDKVIDYIKSTGVKYFVSPMETTMEGDIDVLLDIVKRVQNCADEGAKRVISIVKIDFKPDGVTIEEKIGKYR 95
80 3.000e-19UniRef50_UPI00099504E7 thiamine-binding protein n=1 Tax=Bacillus patagoniensis TaxID=228576 RepID=UPI00099504E7  ali  14  246MP--IADVTIIPIGTTPSVSSYVAKIQLVLDEYKLTFELTPMSTLIEAELPVLFEVIQKIHEPFENGVNRVATNIRIDDRRDKQTLDSKRRSVK 344
81 4.000e-19UniRef50_Q9KCY2 BH1437 protein n=27 Tax=Bacillaceae TaxID=186817 RepID=Q9KCY2_BACHD  ali  20  251.NMAIVDVTVIPIGTETSVSAYVAEIHQVLKEDKVRYELTPMSTLIEGELPILFEVIQAIHEPFQHGIKRVATNIRIDDRRDVQRMEEKVEAVR 348
82 4.000e-19UniRef50_A0A218P3U6 Uncharacterized protein n=5 Tax=cellular organisms TaxID=131567 RepID=A0A218P3U6_THECE  ali  31  2...AVAELCLFPLGTEPSVGKYLEPVIEVIRASGLKYRVCPMGTVVEGSVDEILGLVRACHEILKAGARRVVISLRIDDRTDKLTIEGKVR... 92
83 4.000e-19UniRef50_A0A285BJ70 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=2 Tax=Bacteria TaxID=2 RepID=A0A285BJ70_9FIRM  ali  46  1MPVVNVSLQILPTVEEEKIYPVVDKVIEYIKSTGVKYIVGPMETTMEGELDKLLDIVKVAQNCINEGAKRVVSIVKIDYKPNGVTIDEKIHKY. 94
84 4.000e-19UniRef50_A0A2N7TWV7 Uncharacterized protein n=5 Tax=Halomonas TaxID=2745 RepID=A0A2N7TWV7_9GAMM  ali  23  2..RVIADVNITPLGAGASLSSHVAACEEIIEEAGLKYHLHAHGTNLEGSWEEVMRVIQRCHDVLHEGAPRVDSSIRVATATDKQSLEERVNKV. 94
85 5.000e-19UniRef50_A0A1H3KR49 Uncharacterized protein, MTH1187 family n=8 Tax=Bacillales TaxID=1385 RepID=A0A1H3KR49_9BACI  ali  21  250.HMAIADITVIPIGTTTSVSEVVAEIHLLLNAKNIRYELTPMSTLMEGELEDLLKVIKEIHEPFNMGVKRVATNIRIDDRRDRQSMNSKLESVQ 346
86 5.000e-19UniRef50_I1RRK4 Uncharacterized protein n=13 Tax=saccharomyceta TaxID=716545 RepID=I1RRK4_GIBZE  ali  23  11..SCYVDFCLLPLGTGVSVAEDIAEVQKVLKASGLKYTLHSAGTTVEGSWDEVMAAVGKAHAAVHKGVVRIQSSMRVGSRTDKQTAEEKVKRV. 104
87 6.000e-19UniRef50_D5VQM0 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=D5VQM0_METIM  ali  27  2..KVVAEISIIPMGKGPSVSKYVKKAIEVLKKYNLKVVPNAMGTVVEGELDEVIKAYKEAHLKVLEDVDRVVSQLKIDHRKDKESIERKLKA.. 92
88 6.000e-19UniRef50_C5A5C9 Uncharacterized protein n=13 Tax=Thermococcus TaxID=2263 RepID=C5A5C9_THEGJ  ali  31  2...AVAELCLFPLGTEPSVGRYLEPVIEVIEKSGLKYMVCPMGTVVEGSVDEILELVKKCHEILKAGAKRVVISLKIDDRIDKLSIEGKLG... 92
89 1.000e-18UniRef50_A0A0C5CF11 Uncharacterized protein n=4 Tax=Bacillus coagulans TaxID=1398 RepID=A0A0C5CF11_BACCO  ali  37  115.NQVTVSFSVVPHIKSDDLYGVVDRAIEVVQNAGVRYEVGAMETTMEGDLDELLEIIKKAQDCVQAGAIDVLTSIKIHYRPSGVTMDEKIAKYR 209
90 1.000e-18UniRef50_A0A1V5Y734 Uncharacterized protein n=10 Tax=Euryarchaeota TaxID=28890 RepID=A0A1V5Y734_9EURY  ali  22  2...IVADFSMIPMGTGTSASHYVKAVHEVLKSSGVNFVPGPMSTSLEVELEELFRVIDAANERLEMGAQRIITNIRIDCRLDKISIRSKLGAV. 94
91 1.000e-18UniRef50_E2LV51 Uncharacterized protein (Fragment) n=3 Tax=Agaricomycetidae TaxID=452333 RepID=E2LV51_MONPE  ali  12  8...AVADFCLIPMGTGESVAEYIAECQRVLEKSGVQFKMHGYGTNLEGPWSQVSQAIHDCHAAVHAGAPRIATDIRIGTR.............. 86
92 1.000e-18UniRef50_A0A2N7PJT7 Uncharacterized protein n=12 Tax=Bacteria TaxID=2 RepID=A0A2N7PJT7_9BACT  ali  27  2..SVLVSISIFPLDKGESVSSYVARAVKVIKDSKYPYKVSPMETSFETELEEALSVIRKCFEVLEPDCNRIICNVKIDYRKGRISLISKLKS.. 93
93 1.000e-18UniRef50_K4IKI7 Uncharacterized protein n=9 Tax=Bifidobacterium TaxID=1678 RepID=K4IKI7_BIFAP  ali  24  11..NTVAEVTIAPSGQGEELSTYVAQVIKVIRDSGLPNQTNAMSTVVEGDLHRVMEVVEEATRVLAEQGYRTGVSLRLDIRPGKRDIHEKVERV. 102
94 1.000e-18UniRef50_G9MML4 Uncharacterized protein n=17 Tax=Hypocreales TaxID=5125 RepID=G9MML4_HYPVG  ali  18  10.ASCYADFCLIPVGTGVSVAEEVAQVQRVLKASGLKYTMHSAGTTVEGSWEDVMTVIGKAHSAVHEGVVRVQSSMRVGSRTDKQTAEDKVKRV. 104
95 1.000e-18UniRef50_L0F4R7 Uncharacterized protein n=25 Tax=Bacteria TaxID=2 RepID=L0F4R7_DESDL  ali  36  1MINASVAIQVLPSVEGKDVIRVVDKVIQYLKSSGLNVYVGPFETTIEGEYDQLMEMVKRCQLCIEEGAPSVMSYVKISYRPEGLTIDEKVTKHH 97
96 2.000e-18UniRef50_A0A1J5NA48 YKOF-related Family protein n=1 Tax=Pseudodesulfovibrio hydrargyri TaxID=2125990 RepID=A0A1J5NA48_9DELT  ali  24  2..SCVATFSLFPLEDQGSFAPYVARTIEIVRESGLAHELGPMGTVLEGDLADIMRTIKQCHDDMRKECGRVYLTLAVDSREGESRMRGKVDSV. 95
97 2.000e-18UniRef50_A6UU95 Uncharacterized protein n=15 Tax=Archaea TaxID=2157 RepID=A6UU95_META3  ali  26  2...VVAEISIIPLGEGPSVSKYVKNALKVFKKYDLKIEPSAMGTVLEGDLDEILEAFKEAHREVLSDTKRVVSSLKIDERIDKETIKRKLNAIK 93
98 2.000e-18UniRef50_H3ZJV3 Uncharacterized protein n=5 Tax=Thermococcus TaxID=2263 RepID=H3ZJV3_THELN  ali  27  2...AVAEICIFPLGTTPSVGKYLEPVFEVIKESGLKYMTCPMGTVVEGDIDEILALIKKCHEIFKTGAQRVVISVRIDDRVDKLTIESKLG... 92
99 2.000e-18UniRef50_A0A194AFK3 Uncharacterized protein n=2 Tax=Desulfoplanes formicivorans TaxID=1592317 RepID=A0A194AFK3_9DELT  ali  24  1...MLASFTILPMGVGEELREHIAAVVDLVDGSGLDYKVGAMQTTLEGDQAKVMDLIMQCHNLMMARAPRVLTSITLDDRKGANRLEGKVADV. 91
100 2.000e-18UniRef50_A0A0S8HMA5 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0S8HMA5_9BACT  ali  21  2..SVLLEFSMFPTDRGESVSGYVARLVEIVHASGLPYKLGAMGTTLEGQAPEVFEVVQKCLADLQRDTRRVTAFIKLDWRAGRTGLTGKVASV. 93
101 2.000e-18UniRef50_E6W2A9 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=E6W2A9_DESIS  ali  27  1...MLAEFSITPIDKHGHLSEYVAKTIEIIRQSGLPYELHAMGTIVEGEPEEVFSLIQKCHVNMRQHSLRVSTSIKIDDKVGTTGLYKKVKSV. 92
102 2.000e-18UniRef50_F0JKJ3 Uncharacterized protein n=11 Tax=root TaxID=1 RepID=F0JKJ3_DESDE  ali  24  3...VIIDLSIFPLDKGGSLSTYVSRALNVIKESGLKYRLCPMGTSIEGEWDDVMKVVDGCYRAIAKDSDRLYMTIKVDARKGRDDMSQKLHSV. 94
103 2.000e-18UniRef50_W4QN30 Uncharacterized protein n=18 Tax=Bacillaceae TaxID=186817 RepID=W4QN30_BACA3  ali  16  209.HLAIVDVTVIPIGTETSVSMYVAEMQEVLKDGKISYQLTPMSTLIEGELPILFEVIQAIHEPFKNGVSRVATNIRIDDRRDKATMAGKLEAVK 306
104 2.000e-18UniRef50_D1BZB7 Uncharacterized protein n=80 Tax=cellular organisms TaxID=131567 RepID=D1BZB7_XYLCX  ali  20  2...AVFAFSVAPLGAGESVAPQVAEAVRIVRESGLPNRTTSMFTEIEGEWDEVMPVIKAATDAVGIDGHRVSLVIKADIRPGTTQIDAKVERV. 92
105 2.000e-18UniRef50_A0A2H5XEH1 Uncharacterized protein n=1 Tax=bacterium HR17 TaxID=2035412 RepID=A0A2H5XEH1_9BACT  ali  27  1MPKVVAEVSIVPVGTDTGVSRFVAAAIKALETQGLRYQVGPMGTAIEGDLDAVWQAVRAMQEAVAEGAQRILTTLRIDDRRDKPNLERKVRAV. 100
106 2.000e-18UniRef50_A0A2H6APK7 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A2H6APK7_9BACT  ali  27  2...ALAEISVIPIGTTPSIGDWIAEAVKVLEKSGIKYELSPMGTLIEGKASDIFRIAGKMHESLRKGIKRVVTTLVIDDRRDKVTMRSKVASVR 95
107 3.000e-18UniRef50_E3EE17 DglA n=37 Tax=cellular organisms TaxID=131567 RepID=E3EE17_PAEPS  ali  17  2...AIAEVTVIPIGTGTSLSDYVAQMQKVLKQKGITYELTSMSTIIEGSLDDVFTAIAALHEPFLAGAKRVSTSVKIDDRRDKSSSRQKLRSV. 95
108 3.000e-18UniRef50_A0A133VJ22 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A133VJ22_9EURY  ali  30  2...VVAEVTVIPIGTGPSLSKYVGKALEKLEESNVKYDLTSSGTILEGEMDEVLKGVKEMHESFDEDVLRVVTTLQIDDRRDKLTIEGKKESVR 95
109 3.000e-18UniRef50_A0A0E4C8L5 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A0E4C8L5_9FIRM  ali  35  1MPEANLSLKVLPIVPEDQLYPLVDQVIKMIHDSGLNYMVSPNDTTIEGDLVTLLDLVKKAQECIAAGAPRVISMITIDYKPDGVSIDEKI.... 91
110 4.000e-18UniRef50_A0A2J6JAW0 Uncharacterized protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2J6JAW0_9DELT  ali  17  2...AVVEVSISPLGTEPGISAYVAGCVRIARESGISCQLTPMGTVFEGDLDAILAVIRTMQESFASGAQRVSTSIKIDDRRDGVSMERKVQAV. 95
111 4.000e-18UniRef50_UPI00040CFEBE thiamine-binding protein n=2 Tax=Paucisalibacillus globulus TaxID=351095 RepID=UPI00040CFEBE  ali  34  1MANALLSIQVIPKVDEKDLYSFVDEAIAVIEATNVKYKVHPLETTMEGELSELLQIVQKMNEKMSEGVPSVISQVKIAYRQEGITMDELVEKYQ 95
112 4.000e-18UniRef50_U9SJK9 Cell wall organization and biogenesis-related protein, putative n=3 Tax=Rhizophagus irregularis TaxID=588596 RepID=U9SJK9_RHIID  ali  13  9..HVLADFSIIPMGAGTNTTKYIVECQKVLLDSGLNFNLHANGTNLEGNYDQVMCAVRKCIDKMHEGAPRCDTNIRLNTRTDKVTMQDSIRVV. 101
113 4.000e-18UniRef50_O27255 UPF0045 protein MTH_1187 n=5 Tax=Methanobacteriaceae TaxID=2159 RepID=Y1187_METTH  ali  23  2...ITAELTVIPLGTSTSLSSYVAAAVEALKKLNVRYEISGMGTLLEEDLDELMEAVKAAHEVLQAGSDRVYTTLKIDDRRDDRGLRDKVESVK 96
114 5.000e-18UniRef50_A0A2P7PGI0 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2P7PGI0_9ACTN  ali  25  1...MLIAFTLTPVGVGESFPDEIADAVEIIRASGLPYRSDSMYTMIEGEWEEVMDVVRRATEAVAARAPRVQLVLKADVWPGRPGLDGKIGAF. 92
115 5.000e-18UniRef50_A0A2T2ZSW6 YkoF-like protein n=1 Tax=Coniella lustricola TaxID=2025994 RepID=A0A2T2ZSW6_9PEZI  ali  17  84..RCYVDFCLIPVGTASSVANEVAAVQKLLKESGLTYTMHSAGTTVEGSWDEVMAVVGKAHAVVHAGVGRVQSSMRVGTRTDKQTAADKVKRV. 177
116 6.000e-18UniRef50_UPI0006979D00 thiamine-binding protein n=1 Tax=Nitriliruptor alkaliphilus TaxID=427918 RepID=UPI0006979D00  ali  21  1...MLVAFSVSPMGGSDSVGDAVAACVRIVRDSGLANETNAMFTNVEGPYDEVMAVVRSCIETCAEIAPRVSVTLKLDHRPGHEGLATKVQR.. 90
117 7.000e-18UniRef50_A0A124FBW9 Uncharacterized protein n=3 Tax=Archaeoglobus fulgidus TaxID=2234 RepID=A0A124FBW9_ARCFL  ali  26  1...MIVEISAVPIGVGESLSSFVARVIEVLKEEGVNYSLGPMGTSFEVEFGRLAEILEKVRALFEAGSPRNYYVIKIDNRAKGGRMADKVKAV. 92
118 8.000e-18UniRef50_Q4WHM4 Cell wall biogenesis protein, putative n=8 Tax=Aspergillus TaxID=5052 RepID=Q4WHM4_ASPFU  ali  15  12.ARCTADFSLIPIGTTASFSQQIADIQRLLQQTGLKYQMNPTGTTIEGPWDQVVQVIGFAHTLIHEGVPRIQTDIRISTRTDKVQMEGNIVSVQ 111
119 8.000e-18UniRef50_A0A218PEC6 Uncharacterized protein n=2 Tax=Thermococcus TaxID=2263 RepID=A0A218PEC6_9EURY  ali  34  2...AIAELCLFPLGTTPGVGKYLEPVIEVIKASGLKYRVCPMGTVVEGSVEEILNLVKACHEILKAGAKRVVISLKIDDRIDKLTIEGKMR... 92
120 8.000e-18UniRef50_A0A0L0H6Z3 Uncharacterized protein n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0H6Z3_SPIPN  ali  19  2..KVVADFCLIPLGVGTSLTKYVAIVQQTLQASHIKYLMHSCGTNIEGEWDHVMEAIKSCHTSLHTRVPRIHTTVRIGTRIDKSSIQEKIDRVK 97
121 8.000e-18UniRef50_F2KP84 Uncharacterized protein n=5 Tax=Archaeoglobaceae TaxID=2232 RepID=F2KP84_ARCVS  ali  27  1...MIVEISVVPIGVGESLSSYVSEALKVIREKGVKYQLNPMGTVLEVDFSELGELLDEIRCRLEEGAPRIYVVVKADWRKKATDMEHKVKAV. 92
122 8.000e-18UniRef50_A0A1H8GB68 Uncharacterized protein, MTH1187 family n=5 Tax=Clostridiales TaxID=186802 RepID=A0A1H8GB68_9FIRM  ali  19  2...AVVELTVCPLGTGTSASKYVAGAQKILSEQDIKYLLNPMGTVMEGDIDEIFALIRKIQEDFDKGVDRVYSIIKVDDRRDKISMEQKLQSVK 96
123 9.000e-18UniRef50_A0A1G8CWE1 Uncharacterized protein, MTH1187 family n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A1G8CWE1_9BACI  ali  19  250...AIMDVTIVPVGTSPGMSENVAEMQEVLKEARVDYELTPMSTIIEGNLDDLFAITKELHEPFQKGVDRVATNIRIDDRRDKGRMKEKMQSVK 346
124 9.000e-18UniRef50_A0A0M4FQU5 Uncharacterized protein n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A0M4FQU5_9BACI  ali  14  2...AIADITIIPIGTEPSVSHYVADIQKVLEEGKITYQLTPMSTLIEGTIPDLFTAIQAVHEPFKEGVKRVATNIRIDDRRDKNTMNGKLESVK 99
125 9.000e-18UniRef50_I0GIP3 Uncharacterized protein n=1 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0GIP3_CALEA  ali  35  2...AIAEFTVIPAVPEDEIYEIVDEAIKVVIDSGLKYEVSANSTTIEGDLDTLLEVIKKAHIVADKGSGRVFTVIKIDDKKNGVTIEEKVKKYR 93
126 9.000e-18UniRef50_A0A1Y1RA09 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A1Y1RA09_9PROT  ali  19  2..SALVEFAMFPTEKTESKSAFVARVLDIVDRSGLPYQLTPMGTIIEAEVGEVFAVIEAAYAELQEDCSRIYSAIKIDYRKGPVRLEKKTGSV. 94
127 9.000e-18UniRef50_A0A1G7AAA7 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=17 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1G7AAA7_9BACL :_  ali  30  1MAHALLGIQIIPKVPGGDVIPYVDEAIAVIGASGVRYEVGPLETVMEGELGTLLDIVKQMNEKMQAGCPGVLSQVKISYRPEGMSMDALTEKYR 96
128 1.000e-17UniRef50_UPI000363CBF1 thiamine-binding protein n=1 Tax=Desulfovibrio oxyclinae TaxID=63560 RepID=UPI000363CBF1  ali  21  27..SAILELAIFPMDKTGSVSTYVGRVLEVVKQSGLPYETNSMGTCIEGEIAELMSLCTRCFAVLEEDSDRVYATMKVDWRKGRQGMRGKLKS.. 117
129 1.000e-17UniRef50_D8F4T3 Uncharacterized protein n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=D8F4T3_9DELT  ali  32  1...MIAQLSVYPIGEGTSLGRFVRKGVAVIEQSGYKYEVGGMSTAVEPDLDALFDLVKAVHAHLGEGAKRVVVDLKIDDRRDKATIESKKTSV. 93
130 1.000e-17UniRef50_S6GIA2 Uncharacterized protein n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=S6GIA2_9GAMM  ali  20  4....IMDIMVSPAGVGLSISPYVAHCQKIFQAANLNHQLHSFGTNVEGEWDQVMAAVKRCHELHEMGAVRITSHIKLGTRVDRQTIQDKIDSV. 94
131 1.000e-17UniRef50_A0A1F5YZ90 Uncharacterized protein n=1 Tax=Candidatus Glassbacteria bacterium RIFCSPLOWO2_12_FULL_58_11 TaxID=1817867 RepID=A0A1F5YZ90_9BACT  ali  22  1...MLAQMSLFPLGKVSGMSQDVAKVIELIEQSGLPYQVTSMGTLIEGEWEEVIELIGRCRKKLLERHERIYMVLKVDDQPGVTKLTGKVDSV. 91
132 1.000e-17UniRef50_F6CPY7 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=F6CPY7_DESK7  ali  23  1MVMAVVEVSIVPIGTGTSLSAYVARCVDVLQEKNIRYQLTPMGTIMEGDLDLILSVVRRMHEPFTQGIARVVTTIRIDDRRDKLTMAGKVSAV. 97
133 1.000e-17UniRef50_R4K4U4 Uncharacterized protein, MTH1187 family n=19 Tax=Clostridiales TaxID=186802 RepID=R4K4U4_CLOPA  ali  37  2...VIADIAVIPSVSEEELYKQVDAAIDYIKNSGLKYEIGAMSTTVEGEYDEVFELIKKVHRPFEAGSERVITVVRIDEKKGGLIIDDKLKNYK 96
134 2.000e-17UniRef50_A0A1I1YTX9 Uncharacterized protein, MTH1187 family n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1I1YTX9_9FIRM  ali  20  2...AIVELTVCPLGTGTSASKYVAGAHDILSASSVKFMLNPMGTVMEGNIDEIFSLIRKIQEDFDKGVDRVYSIIKVDDRRDKITMEQKLNSV. 95
135 2.000e-17UniRef50_G8TZ10 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=G8TZ10_SULAD  ali  23  2..QVIAAVSIAPLGTGTSVSAYVAEAQRVLSRHPLRFRLDPMFTTIEGELAEIFRAIEEMHEALVAGAERLSTVIKIDDRRDASSMEEKVTVVK 97
136 2.000e-17UniRef50_A0A2V2E5D6 Uncharacterized protein n=1 Tax=Coriobacteriia bacterium TaxID=2052159 RepID=A0A2V2E5D6_9ACTN  ali  21  1MNTLIA-VAIAPFGVGDELSSEVAEVVKVIRESGLPNRTYSMFTEIEGEWDEVMRVVRDATFVLAEKGIRTEVILKADVRPGFSRMDEKVARV. 93
137 2.000e-17UniRef50_I3IRH4 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=I3IRH4_9BACT  ali  24  1...MIAEISVVPVGEEVDLASHVAKVVKVIHESGLDYKLNAMSTVVEGDSDSVFDLIKKCHTTMLETAQRVYTVIKLDERKDVKMIEHKVRSV. 94
138 2.000e-17UniRef50_A0A1H7WJJ9 Uncharacterized protein, MTH1187 family n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A1H7WJJ9_9ACTN  ali  26  1...MIVAFSVTPLGVGEGVAEPVARAVRVVRESGLPNRTDAMFTTIEGEWDEVMDVIKRAVDAVAEVAPRVSLVLKADLRAGVTDMTTKLES.. 90
139 2.000e-17UniRef50_D3DGI9 Uncharacterized protein n=14 Tax=Bacteria TaxID=2 RepID=D3DGI9_HYDTT  ali  23  4....IVFVSMTPLGKEESVSKYVARVVDIVDKSGLDYVLTPMGTIVEEDWDQVMEVLKKGFEALKTDCNRISIVMKIDYRKGRT--KGLVSKVR 92
140 2.000e-17UniRef50_Q9WYV6 Uncharacterized protein n=14 Tax=Thermotoga TaxID=2335 RepID=Q9WYV6_THEMA  ali  100  1MPKVTVSIKVVPAVEDGRLHEVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKRFVLQLDIDYKAGGITIEEKVSKYR 94
141 2.000e-17UniRef50_A0A1I5NKN2 Uncharacterized protein, MTH1187 family n=2 Tax=Bacillaceae TaxID=186817 RepID=A0A1I5NKN2_9BACI  ali  22  250.HMAVVDITVVPVGTSTSISEDVAAMQQVLDGHNIHFQLTPMGTVLEGKLEDLLPIVKELHDPFQRGAGRVSTNIRIDDRRDKEGMAEKLASV. 347
142 3.000e-17UniRef50_A6Q3Y8 Uncharacterized protein n=2 Tax=unclassified Epsilonproteobacteria TaxID=34035 RepID=A6Q3Y8_NITSB  ali  20  2..SVLMEIAMFPTDVGESKSKYVAEVLKVIEESGLPYQLTPMATIVEGEVEEVSALIPKMHALEKMGCGRVYSVAKFDIRPGKSRLKQKVESVQ 96
143 3.000e-17UniRef50_A0A2J6WRP5 Uncharacterized protein n=23 Tax=Bacteria TaxID=2 RepID=A0A2J6WRP5_9BACT  ali  21  4....LVEFAMFPTDKGESVSNYVSRIIKMIDGLGIPYKLTPMGTVFEANMEEALEIINIAYKQLEPDCNRIYTVIKMDIRKGKNRMEGKIKSV. 94
144 3.000e-17UniRef50_F9FVI3 Uncharacterized protein n=16 Tax=Fusarium TaxID=5506 RepID=F9FVI3_FUSOF  ali  19  460..SCYVDFCLLPIGTGTSVAEDIAEVQKVLKASGLKYTLHSAGTTVEGSWNEVMAAVGKAHAVVHRGVVRIQSSMRVGSRTDK........... 542
145 3.000e-17UniRef50_A0A1F2SNH8 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F2SNH8_9BACT  ali  21  1...MLVELSINPLGRGTHISKDLAEILQLIDESGLPYCLTPSGTCIEGGWDEVMAVVKRCHDRERSLSSHVMTTLRIEDEEGGVDLNENIAAV. 91
146 3.000e-17UniRef50_A0A2H6GU36 Uncharacterized protein n=1 Tax=archaeon BMS3Abin16 TaxID=2005740 RepID=A0A2H6GU36_9ARCH  ali  26  2...ITAEVSVVPIGVGTSESRAVKKFIEGLKKSGLKVFPGPMCTAIETEVEELFDAIDEAHDLFEEGFQRIITTIKIDDRRDKSTIKHKLEA.. 93
147 3.000e-17UniRef50_G2DFP7 Uncharacterized protein n=1 Tax=endosymbiont of Riftia pachyptila (vent Ph05) TaxID=1048808 RepID=G2DFP7_9GAMM  ali  21  46..SVLLEFSMFPTDQGESVSEQVSQVIAMIRDSGVDYQLTPMGTIIETELGDALALVERAYQLLEQGCRRVYSSLKLDIRQGKQRLAQKIRSV. 139
148 4.000e-17UniRef50_A0A0P9C921 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A0P9C921_9BACL  ali  44  1MPNSHVAIQVVPMVPDDQMYEVIDKAIEVIANSGVRYEVGAMQTVMEGELDTLLEIVKQAQACIDAGATEVVTQIAVHYRPGGVTIEEKLDKYR 96
149 4.000e-17UniRef50_B1LW42 Uncharacterized protein n=54 Tax=Bacteria TaxID=2 RepID=B1LW42_METRJ  ali  18  2..RVSADLCIVPMGVGPSVSPYVREIKGIIESSGLTATMHPNGTNIEGELSEICALAERCEARLAEGVQRTFFTLIFSTRRDKQSMADKLAAV. 94
150 4.000e-17UniRef50_V6IZB1 Uncharacterized protein n=9 Tax=Bacillales TaxID=1385 RepID=V6IZB1_9BACL  ali  35  1MPISNVGLQILPFSKEKDTYDLVDEAIKVIQQSGVKYEVTALETILEGELDELLDVVKKVYATVEAGADEVAAEVKIHFRPQGTSIEEKVGKYR 95
151 4.000e-17UniRef50_C9R8P4 Uncharacterized protein n=9 Tax=cellular organisms TaxID=131567 RepID=C9R8P4_AMMDK  ali  27  2...VVAEISVVPLGTGPSVGRYVAECVKIVRESGLKYEITAMGTLVEGELEEILELVRKMHAPFAAGVQRVVTTVKIDERRDKLSLEGKVAAVK 95
152 4.000e-17UniRef50_A0A1F5R7W4 Uncharacterized protein n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5R7W4_9BACT  ali  24  2...AIAEITLVPVGTGPSVSSFVVDTIKLAKSTGLKLEITSMGTNIEGPLEDILAVAQAMHQCLSTGAERVFTSIKIDDRRDKVTIEGKRARV. 94
153 4.000e-17UniRef50_A0A1F8MF00 Uncharacterized protein n=13 Tax=root TaxID=1 RepID=A0A1F8MF00_9CHLR  ali  26  2...AIAEISVVPLGTTPSVSQYVARAIKVLEERDIRYEITAMGTIVEGDLDRILALVKKMHEVFEEGVARVLTTVKIDERRDKQGMKEKVDSLR 96
154 5.000e-17UniRef50_A0A2H0ACN2 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_60_8 TaxID=1973981 RepID=A0A2H0AC  ali  29  1MKKVVAEISAFPIGKEESLSKSVAEVVKAIKESGLKYQIGAMGTTVEGEWNQIMKLFTKCRNKLITSNNRIYLMLKIDERKSPTSIAHKIKVIR 96
155 5.000e-17UniRef50_A0A0A8WDV5 Uncharacterized protein n=12 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A0A8WDV5_PAESO  ali  36  2...VIADIAVIPLRPEEEMYKVVDYCIEIIKNSGLKYEIGANSTTIEGNFDDVFDILKKVHKPFKLGCERVITTFRIDEKHGGITINEKLKNHR 96
156 6.000e-17UniRef50_T2GSM4 Uncharacterized protein n=1 Tax=Mycobacterium avium subsp. hominissuis (strain TH135) TaxID=1229671 RepID=T2GSM4_MYCHT  ali  24  66..SVLVAFSVTPLGVGEGVGEIVAEAVRVVRDSGLPNKTDSMFTVIEGEWEEVMAVVQRAVEAVAARAPRVSTVIKADWRAGVSAMTHKVASV. 158
157 6.000e-17UniRef50_A0A031WE10 Thiamine-binding protein n=22 Tax=Clostridiales TaxID=186802 RepID=A0A031WE10_CLODI  ali  34  2...VIADIAVMPLRPEEEMYKVVDACIAEIEKSGLKCEIGAMSTTVEGDFDEVFELLKKVHKPFNLGCERVITVARVDEKAGGLTIDEKLRNHR 96
158 6.000e-17UniRef50_D3P9E5 Uncharacterized protein n=3 Tax=Deferribacteraceae TaxID=191394 RepID=D3P9E5_DEFDS  ali  23  2..SAMVFFSATPIGKEESVSKYVARVVKKIKESGFNWQLTPMGTIVEGELKEVLNVVADAVEEL-KDCNRISISIKIDYRRDRKSLDKKVESV. 93
159 6.000e-17UniRef50_E5WIJ7 Uncharacterized protein n=131 Tax=root TaxID=1 RepID=E5WIJ7_9BACI  ali  17  2...AIADVTVIPIGTETSVSSYVADIQRVLKKYKIRFQLTPMNTIIEGELTDLFEVIQAMHEPFEKGLMRVATNIRIDDRRDKRKMEEKVRRV. 98
160 7.000e-17UniRef50_C6Q2C8 Uncharacterized protein n=26 Tax=Bacteria TaxID=2 RepID=C6Q2C8_9CLOT  ali  35  2..NASVAIQVLPKVEGEETIRIVDEVIAYIRSTGLNMSVGPFETTIEGDYDELMNIVKRCQLCIEQGAPSVMSYVKISYNPEGVTIDKKVKKHH 95
161 8.000e-17UniRef50_A0A101VXC1 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A101VXC1_9FIRM  ali  26  2...AIVAVNMVPLGVGTSVSKYVAAAEKVIKDRGIKRQLGPMFTTLEGDLDEIMQAIREMQEVFETGVERVVTTIKIDDRRDAATMDAKLES.. 93
162 8.000e-17UniRef50_A0A1T4JIX2 Thiamine-phosphate synthase n=1 Tax=Treponema porcinum TaxID=261392 RepID=A0A1T4JIX2_9SPIO  ali  24  2..NTLIAFSVAPFGAGEELSDAVAEVVQIIRNSGLKNRTYSMFTEIEGEWDDVMRVVKDATFVLAQKGLRTELVLKADIRPGYTTMDGKLER.. 92
163 8.000e-17UniRef50_A0A1S7HX62 ECM15 (YBL001C) n=8 Tax=Saccharomycetaceae TaxID=4893 RepID=A0A1S7HX62_9SACH  ali  19  1MPKCLADVCMVPIGTGASISDFVALIEGKIRESPLKSTLHSAGTTIEGPWDDVFTLLGELHEMAHAGYVRLQSSMRVGTRTDKQTAQDKVDTV. 98
164 9.000e-17UniRef50_A0A147JS35 Uncharacterized protein n=1 Tax=Hadesarchaea archaeon DG-33 TaxID=1775754 RepID=A0A147JS35_9EURY  ali  27  5...VVAELSVVPIGTSTSLSDYIATALREVKRAGVKYRLCPMSTVFEADLETVLEVAKAAHAVIDAGAKRVVTTLRIDERLDELTMEERIERV. 97
165 9.000e-17UniRef50_A0A2N1PC06 Uncharacterized protein n=11 Tax=candidate division Zixibacteria TaxID=1379697 RepID=A0A2N1PC06_9BACT  ali  20  1...MLIQFSMFPVGKKESASAEVAKIINIIDKSGLSYKTSAMSTVVEGEWEAIMKLINKCRLQMRRNNNRVYMVMTMDDRKGKKRLTGKVES.. 90
166 1.000e-16UniRef50_A0A084IY15 Thiamine-binding protein n=282 Tax=Bacteria TaxID=2 RepID=A0A084IY15_BACMY  ali  38  4..QVTISFSVVPQAKNKDVYSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDVIKRAQQCVDAGAEEVITSIKIHYRPSGVTIDEKVWKYR 97
167 1.000e-16UniRef50_A0A265EH91 Uncharacterized protein n=2 Tax=Marinococcus halophilus TaxID=1371 RepID=A0A265EH91_MARHA  ali  16  239...AIVDVTVSPIDKGTGMSDTVAKIQDVLEKHNIDIEMTPMSTLLEGNIDDLLQAVREIHEPFQEGYQRVSTNIRIDDRRDGKQMKKKMESVQ 335
168 1.000e-16UniRef50_A7GKR9 Uncharacterized protein n=10 Tax=Firmicutes TaxID=1239 RepID=A7GKR9_BACCN  ali  39  4..QVTISFSVVPQAKTKDLYTVVDKAIEVVQQSGVRYEVGAMETTMEGDLNELLDIIKRAQQCVDAGAEEVITSIKIHYRPSGVTIDEKVWKYR 97
169 1.000e-16UniRef50_Q5WKH7 Uncharacterized protein n=15 Tax=Bacillaceae TaxID=186817 RepID=Q5WKH7_BACSK  ali  22  1MATMLAGIQLIPNGKEDHTGGIANKVIDVIEQSGLRHRVGPLETVVEGDFDSLMALLRDVHQQVQAGAEEVLTNVKMHYRTSGVSLEDK..... 90
170 1.000e-16UniRef50_A0A2C6AG40 Uncharacterized protein n=2 Tax=sordariomyceta TaxID=715989 RepID=A0A2C6AG40_9HYPO  ali  20  10.AACYVDFCLIPVGTGASVAEEVAAVQRLLRASGLRFTMHAAGTTVEGGWDEVMALVGKAHTVHRRGVVRVQSSLRVGSRTDKQTAAEKVERVR 105
171 1.000e-16UniRef50_A0A1J4WL46 Uncharacterized protein n=8 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1J4WL46_9BACT  ali  25  3...VVAEISAFPIGEGESLSEPVAEVVKIIKESGLNYQIGAMATTVEGEWDQIIELFTRCRNKLIESSNRVYMSLKTDERKTETHIAHKIKAV. 93
172 2.000e-16UniRef50_A0A0T5Z886 Uncharacterized protein, MTH1187 family n=18 Tax=Bacteria TaxID=2 RepID=A0A0T5Z886_9GAMM  ali  20  2..SVLLEFSMFPTDQGESVSAQVSQVIAMIRDSGVDYQLTPMGTIIETELSDALALVERAYQLLEQGCRRVYSSLKLDIRQGKQRLAQKIRSV. 95
173 2.000e-16UniRef50_A0A1Y3QQ87 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1Y3QQ87_9FIRM  ali  20  2...AIVAVSIAPIGTGTSVRRYVAAAEKVLREYNLRYRLDPMFTTIEGDLREIFECIIRMHDAVAAGAGRISSVIKIDDRRDKTTMEDKIKAV. 95
174 2.000e-16UniRef50_A0A087M0M1 Uncharacterized protein n=11 Tax=Bacteria TaxID=2 RepID=A0A087M0M1_9RHIZ  ali  17  2..KIIADLCIVPMGVGPSVSAYIREVRDILAGTGLTHEMHANGTNIEGEMSAVSAAVEACCQRLHEGVERIFCTMHFSTRTDKQTMAEKLAR.. 93
175 2.000e-16UniRef50_Q8J1F7 UPF0045 protein ECM15 n=97 Tax=saccharomyceta TaxID=716545 RepID=ECM15_ASHGO  ali  19  5..HTLVDICMVPLGTSPSVSDYVTKIEKRIRESHLKSTMHSFGTTIEGPWDEVMSLIGQLHEYSHEGYVRIHTEMRLGTRTDKQTAQDKVDVV. 98
176 2.000e-16UniRef50_UPI000406653A thiamine-binding protein n=1 Tax=Spirochaeta cellobiosiphila TaxID=504483 RepID=UPI000406653A  ali  32  1MPIINLSLQILPTTEVSQIYPTVDKVIDLIKSSGVKYVVGPMETTMEGDMDVLFDIAKQAHYICQAGADSVVAIIKTHYRPGDVTMEEKIGKYH 96
177 2.000e-16UniRef50_A0A1D2QW22 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=A0A1D2QW22_9EURY  ali  20  2...IVAEFSVVPIGTGIGVARFVKAAVEALKKENIKFELHAMGTIIEAEDKTLFNAIEKAHEVFSEGTERVVTTLRIDDRRDKISIKSKIDAVR 95
178 2.000e-16UniRef50_A0A2A9NTF6 Uncharacterized protein n=2 Tax=Basidiomycota TaxID=5204 RepID=A0A2A9NTF6_9AGAR  ali  16  1MHHAVADFCLIPIGTGESVAEYIAECQRVLQKSGLTYKV-------EGPWTQVSQAIHDCHAAVHAGAPRIATDIRIGTRTDREGNEGKVKRV. 95
179 2.000e-16UniRef50_A0A1G0KY64 Uncharacterized protein n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A1G0KY64_9GAMM  ali  21  2..SVLMEFSMFPTDKGESVSPYVSEVIRMIRESGVSYRLTPMGTIIETELSEALAIVEQAEQVLRQECRRIYSSIKLDIRAGRSRMEGKIRSV. 95
180 2.000e-16UniRef50_A0A0J6D2A6 Uncharacterized protein n=1 Tax=Anaerobacillus macyae TaxID=157733 RepID=A0A0J6D2A6_9BACI  ali  24  2...ALLEISVAPIGTTTSMSHFVTNAIRLAEKEGFKYHVGPTSTVFEGDVDELFELARDIHTALKNGSDRVVTNIKIEDREDNLTIDGQVNEVK 95
181 2.000e-16UniRef50_P35195 UPF0045 protein ECM15 n=26 Tax=Saccharomycetales TaxID=4892 RepID=ECM15_YEAST  ali  20  1MPKCLADVCMVPIGTDASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGHEGYVRVHTDIRVGTRTDKQTAQDKIDVV. 98
182 2.000e-16UniRef50_A0A0S7YBT1 Uncharacterized protein n=10 Tax=Bacteria TaxID=2 RepID=A0A0S7YBT1_9BACT  ali  20  6......EVSMTPLGKDESVSTYVSKVVDVIDKSKLPYVITPMGTIIEGEWDEVMNVFKRGFEQMQKECTRISILMKIDYRKGKSRMKTKIKS.. 93
183 2.000e-16UniRef50_A0A2A9CBV9 Uncharacterized protein (TIGR00106 family) n=1 Tax=Bacillus sp. es.036 TaxID=1761764 RepID=A0A2A9CBV9_9BACI  ali  21  2...ALLEISVTPVGTSTSMSHFVTEAIQIAEKEGFTYHIGPTSTVFEGNVDELFELARDIHTSLRKGSDRVITNIKIEDREDKLTIDGQVNEVR 95
184 2.000e-16UniRef50_E6TWY0 Uncharacterized protein n=1 Tax=Bacillus cellulosilyticus (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) TaxID=649639  ali  17  251...AIADVTVIPIGSTTSVSEVVAEIHRLLKATDIHIELTPMSTLIEGDVSDLLEIIKDIHEPFKLGHKRVATNIRIDDRRDKSTMKTKLQAVQ 346
185 3.000e-16UniRef50_A0A2P6VZ59 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon SW_10_69_26 TaxID=1919232 RepID=A0A2P6VZ59_9EURY  ali  25  2..RAMVFFSLHPIGRDDSMSDEIAEAVKVLREHGLEHEVGPTGTTIFGELGDIMQAIEECHDRISEDGTRVNSELMIDAKPDVGEMRGRVDRV. 94
186 3.000e-16UniRef50_A0A177L0D1 Uncharacterized protein n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A177L0D1_9ACTN  ali  22  1...MLFAFSVAPTSTSASMSKAVAEAVRVVRESGLPHETTSMFTTIEGEWDEVMPVIRAATDAVLAVAPRVSLVLKADLRPGRSGLRGKVDRV. 94
187 3.000e-16UniRef50_X4ZU21 Uncharacterized protein n=573 Tax=Bacteria TaxID=2 RepID=X4ZU21_9BACL  ali  21  2...AIAEITVIPIGTGTSLSSYVAGMQRALESEGITFELTSMGTIIEGPLPRILAAVEVLHEPFAAGAQRVSTALKIDDRRDKASSKQKLESV. 95
188 3.000e-16UniRef50_A0A0D1C5Z3 Chromosome 7, whole genome shotgun sequence n=27 Tax=Basidiomycota TaxID=5204 RepID=A0A0D1C5Z3_USTMA  ali  17  9...AVADFCLIPMGTTTSVGEYITECQRVLQDQGIRYEVHGYGTNLEGTFGTVCKAIELCHEAVHRGAQRIATDIRIGTRTDKPTMDGQTENQR 106
189 3.000e-16UniRef50_A0A1M4T2L9 Uncharacterized protein, MTH1187 family n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1M4T2L9_9FIRM  ali  20  2...AVVEVSIVPVGTGTSLSAYVARCLEVLKEKHIRYQLTPMGTIIEGDLDVLLAVIRRMHEPFGREVTRVVTTIRIDDRRDKLTMAGKVAAV. 95
190 3.000e-16UniRef50_A0A2H5W8A6 Uncharacterized protein n=1 Tax=bacterium HR11 TaxID=2035406 RepID=A0A2H5W8A6_9BACT  ali  20  4....LMFLSVTPLDKGESVGAYVARAVDVIDRSGLDYRLTAVGTVLEADWEELSRVVQACLEDLQRDCRRISVLIKVDYREGKGRLRQAVESV. 94
191 3.000e-16UniRef50_B0S3G7 Uncharacterized protein n=67 Tax=Bacteria TaxID=2 RepID=B0S3G7_FINM2  ali  17  2...AILELTLVPIGTTTSLSQYVAKAYDNVRKENIKVELNPMGTVMQGDIDELLKAVRDMQEAFNEGVDRVYSVIKIDDRRDKASFEQKLDSV. 95
192 4.000e-16UniRef50_A0A225ANU4 Uncharacterized protein n=1 Tax=Talaromyces atroroseus TaxID=1441469 RepID=A0A225ANU4_9EURO  ali  16  16MPDMIADFSLNPIGDSPSYSQQIAAIQRLCQRSGVKFSMHTTGTTLEGPWEKVQQVIGWAHCLVHQGTPRIQTDIRMSTRTDKQQMEAEVASV. 112
193 4.000e-16UniRef50_A0A1V6N0W6 Uncharacterized protein n=2 Tax=Methanobrevibacter arboriphilus TaxID=39441 RepID=A0A1V6N0W6_9EURY  ali  25  2...ILVDFGVVPIGTETDLGKYVAVAVQAIKESGLKYELTGMGTQIEANLDEVYEAVKTAQEVFDIGANRVFTVLKIDDRRDKKDLQDKVATV. 96
194 5.000e-16UniRef50_D3FXR0 Uncharacterized protein n=21 Tax=Bacillales TaxID=1385 RepID=D3FXR0_BACPE  ali  24  1MATVTAGFQVLPNGKDVDTDGVIPKIVEVVQNSGLTYHVGPMETVIEGSIDDVFNVIKSAQQVIDEGASDVLTNIKLHYHKDGVSIKDKLTHV. 94
195 5.000e-16UniRef50_D2RGY8 Uncharacterized protein n=1 Tax=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) TaxID=572546 RepID=D2RGY8_A  ali  25  1...MIVEISVVSIGVSESQSEYVSEVVRLLKERGIKFSVNPMGTVFEKNFRELADLMDEAVNRLEKGVPRVYIVIKADWRKKRKGMEEKVRSV. 92
196 5.000e-16UniRef50_A0A086YZP1 Uncharacterized protein n=17 Tax=Bacteria TaxID=2 RepID=A0A086YZP1_9BIFI  ali  21  21..NTVAAVAIAPSGAGEELSKYVAQAVGVIRDSGLKNETNAMFTNIEGDLDDVLRVVRDAALRLASQGHRTGVSLKLDIRPGRNQMERK..... 108
197 5.000e-16UniRef50_A0A1Y4S8E2 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4S8E2_9FIRM  ali  36  2..NASVAIQVLPKVEQEETRRIVDEVIAYLASTGLHYVVGPFETTLEGDLDELLDIVKECCRCTNAGAPSVMSYVKISYKPDGVTIDDKTGKYQ 96
198 5.000e-16UniRef50_A0A2V1B3G4 YkoF-like protein n=1 Tax=Cadophora sp. DSE1049 TaxID=1485229 RepID=A0A2V1B3G4_9HELO  ali  14  11.AKCQADFCLIPVGTTPSISTYISQVELLATQSGLKCSTHDHGTAIEGSWTEVMNVIGQAHALIHAGVQRIYSDVRIGTRTDK........... 94
199 5.000e-16UniRef50_A0A0B5WU92 Uncharacterized protein n=4 Tax=Bacillus coagulans TaxID=1398 RepID=A0A0B5WU92_BACCO  ali  37  5.NQVTVSFSVVPHIKSDDLYGVVDRAIEVVQNAGVRYEVGAMETTMEGDLDELLGIIKKAQDCVQAGAIDVITSIKIHYRPSGVTMDEKIAKYR 99
200 5.000e-16UniRef50_A0A2H6HTK7 Uncharacterized protein n=1 Tax=bacterium BMS3Bbin04 TaxID=2005727 RepID=A0A2H6HTK7_9BACT  ali  30  2...ALLAISVAPGGTGTSVSEYVAKAIKVATEDGVKVELGPMFSTLEGEFEDVWEVARKMHALVEAGAPRIATSIKIDDRRDKSTIESKMSA.. 94
201 7.000e-16UniRef50_A0A0U3F7P4 Uncharacterized protein n=2 Tax=Ignicoccus islandicus TaxID=54259 RepID=A0A0U3F7P4_9CREN  ali  26  1...MIVEIQVLPLGTGPSVSEYVAEAVKVLRDKGLNFKVTPMATVFEIDFSQISDVLDEIRKRMEAGIKRVVFVIRIDYRSDKLKMDRKVESV. 94
202 7.000e-16UniRef50_T0DSZ1 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=T0DSZ1_ALIAG  ali  21  2...AIVAVSIAPLGTGTSVSQYVAETQRVLKRFPLKFRLDPMFTTIEGELPDIFAAISEMHEALSMGAQRLSTVVKIDDRRDNHSMEEKIAVV. 95
203 7.000e-16UniRef50_A0A178TYL8 Uncharacterized protein n=19 Tax=Bacillaceae TaxID=186817 RepID=A0A178TYL8_GEOTM  ali  15  2...AIVDVTVIPIGTTPSVSEYVAEMQKVLEDGKIDFMLTPMNTIIEGELPVLFEVIQAIHEPFSKGIQRVATNIRIDDRRDKRRMADKIASVQ 99
204 8.000e-16UniRef50_U7MIX5 Uncharacterized protein n=7 Tax=Corynebacteriaceae TaxID=1653 RepID=U7MIX5_9CORY  ali  22  59...MIVAFSVAPTTTNEEMSEAVAEAVRVVRESGLPNETNSMFTLLEGEWDEVFAVIKKATSAVEAVSPRVSLVIKADIRQGVTGLTAKVDAV. 151
205 8.000e-16UniRef50_A0A151DXJ4 Uncharacterized protein n=9 Tax=Thermoplasmata TaxID=183967 RepID=A0A151DXJ4_9EURY  ali  16  2...IIASLSIAPLGKGTSVSTYVKTVIEILKKEHVTFQTNAMSTVIETDLETLFEIVQKAHAVVAAGAERIITEIKIDDRRDKQTIGSKLESLK 95
206 8.000e-16UniRef50_A0A075R3P3 Uncharacterized protein n=87 Tax=Bacillales TaxID=1385 RepID=A0A075R3P3_BRELA  ali  35  1MANALVSIQIIPTTPGEGVIPFVDKAIEVISQSGVKYFVSPLETTMEGELEELLAIVKKMSDVMEAGCPSVISQIKIYHRADGLSMDALTEKYR 97
207 8.000e-16UniRef50_A0A1X7HQW3 Uncharacterized protein, MTH1187 family n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A1X7HQW3_9BACL  ali  18  2...AIAEVTVIPIGTTTSLSMYVAEMQRVLEKQGISYELTSMSTIIEGELNSVWGAIAALHEPFLSGAKRVSTSVKIDDRRDQVSSKQKLQSVQ 96
208 9.000e-16UniRef50_A0A2N2DNL9 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-13 TaxID=2013774 RepID=A0A2N2DNL9_9FIRM  ali  23  2...AVLQINVTPLGTEESISSFVSEACKIARDKGLKFEVNPMSTVIEGHQSELFDVAQKMHEMFQMGANRVITSITIDERTDKQTMENMVEAV. 94
209 9.000e-16UniRef50_W7ZN43 Uncharacterized protein n=7 Tax=Bacillus TaxID=55087 RepID=W7ZN43_9BACI  ali  17  263...AIVDVTIIPIGTETSVSSYVATIQEVLEEHDITYQLTPMSTLIEGDVSTLLDVVKKIHEPFKRGIDRVATNIRIDDRRD............ 347
210 1.000e-15UniRef50_B3EP26 Uncharacterized protein n=3 Tax=Chlorobiaceae TaxID=191412 RepID=B3EP26_CHLPB  ali  20  20...ALMDITVIPLDTSKGLGKRVAELEATLQESGLEYRLTDMGTTVCGSATELFAIAERLHEHFATGTDRVYTVMKIDDRRDKTAIGDKVASV. 112
211 1.000e-15UniRef50_A0A1G5QIK9 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=559 Tax=Bacteria TaxID=2 RepID=A0A1G5QIK9_9MICC  ali  24  1...MLLAFSVAPSGPDASVHDAVAAAVKIVRESGLPNQTDSMFTTIEGEWDEVFDVVKRATEAVGRYGSRVSLVIKADIRPG............ 90
212 1.000e-15UniRef50_A0A2D6N4X1 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2D6N4X1_9CHLR  ali  31  5..HCVADIQVVPQGPDATTYALIDRAIDVIEGSGLHYEVGAMSTTFEGDPAQVWEVLRQVHQALSAGAPSQLTTIRLIESADGPTMNEKTGKFR 98
213 1.000e-15UniRef50_A0A1F2SVE0 Uncharacterized protein n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2SVE0_9BACT  ali  18  1...MLVELSINPLGCGTHLSKNLAEILKIIDASRIPYCLTPSGTCIEGNWDEVMALAKQCHDQARSISSHVMTTLRMEDEEG............ 79
214 1.000e-15UniRef50_S4GG26 Uncharacterized protein n=31 Tax=Bacteria TaxID=2 RepID=S4GG26_GARVA  ali  25  27..NTVAALCIAPSGVGEELSEYVADCVKVIRDSGLKNETNAMFTNIEGEFDDVMRVVKDATMVLVEKGYRTGVILKLDIRPG............ 106
215 1.000e-15UniRef50_A0A2T4K239 Uncharacterized protein n=74 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2T4K239_9STAP  ali  27  1MTNTLMSIQIIPKHNETEVIPLVDEAIKVIDQSGLKYEVHPLETTIEGEMNACLILIEQINERMAEECESIISQIKFYHVPEGITMESLTEKYK 95
216 1.000e-15UniRef50_A0A1G3CX30 Uncharacterized protein (Fragment) n=1 Tax=Planctomycetes bacterium RIFOXYB12_FULL_42_10 TaxID=1801985 RepID=A0A1G3CX30_9BACT  ali  25  1...MIAEISVIPIGEGIDLASYVARIVKIIDESGLDYKLNAMGTVVEGDGDRIFDLIKKCHNKMLETAQRVYTT.................... 71
217 2.000e-15UniRef50_F1YED8 Uncharacterized protein n=14 Tax=Actinobacteria TaxID=201174 RepID=F1YED8_9ACTN  ali  22  1...MLFAFSIAPGTTDDSVSRAVAEAVRVVRASGLPNETTSMFTTIEGDWDECMAVVKSACEAVAATSPRVSLVLKADMREGFTQLTQKVERV. 94
218 2.000e-15UniRef50_D1JHW3 Uncharacterized protein n=4 Tax=cellular organisms TaxID=131567 RepID=D1JHW3_9ARCH  ali  19  3.AMIIAEITVIPIGTTASVSKYIAEAVSELEKHGLNPELTAMGTIFEEDLALVLNAFRAVHESFEQGAVRVVTTLRVDERRDKGSIKQKLQSV. 98
219 2.000e-15UniRef50_E3GWW0 Uncharacterized protein n=11 Tax=Euryarchaeota TaxID=28890 RepID=E3GWW0_METFV  ali  29  2...IIAEISVVPVGTSTSLSEYIAAAVSKIKEKNIKYKVSSMGTQVEKDLEELFEVVKAAHEAVNKGADRVYTTVTIDDRRDDKSLEERVDAVK 96
220 2.000e-15UniRef50_A0A0L8NWG8 Uncharacterized protein n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A0L8NWG8_9ACTN  ali  19  1...MLIAFALTPMGVEENGAAYVADAIKIIRESGLPNRSDSMYTMIEGDWDEVMDVVKRATETVAARVPRVQVSIKADVWPGDRPLDGKIA... 89
221 2.000e-15UniRef50_A0A2W0HCM2 Uncharacterized protein n=2 Tax=Bacillaceae TaxID=186817 RepID=A0A2W0HCM2_9BACI  ali  14  256.HMVTADVSIIPVGKGTSESEQIAEIEAVLNEYRLTYKVNAMSTVIDAELPVLFEVIERVHEPFKSGVERVATHIRIDDRRDKQSMTDKEKSV. 352
222 3.000e-15UniRef50_A0A1H8FZ15 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=1 Tax=Bacillus persicus TaxID=930146 RepID=A0A1H8FZ15_9BACI  ali  32  4.ATVTAGFQVLPDGKDMNTDGMIPEVIEVVKDSGLKYEIGPMETVVEGNLHEVFELIEKAQRVINTGADECITNIKIHYKPNGVAIEDKV.... 93
223 3.000e-15UniRef50_A0A087BGT6 Uncharacterized protein n=2 Tax=Bifidobacterium merycicum TaxID=78345 RepID=A0A087BGT6_9BIFI  ali  32  381..NCSVAIQFLPMNTDEETCAIVDEVIAYIKSTGVDYFVGPFETAIEGDFDTCMDIVRNCQLVAKAGATHVMSYVKINYRPDGMTTEHKVGKYH 477
224 3.000e-15UniRef50_A0A0K1RAV6 Uncharacterized protein n=146 Tax=Bacteria TaxID=2 RepID=A0A0K1RAV6_9CORY  ali  26  1...MIAAFSVAPTVTTAAMSEAVARAVQVVRDSGLPHETTAMFTTIEGEWDEVMDVIKRATAAVEEVSPRVSLVIKADIRPGYTDM........ 86
225 3.000e-15UniRef50_A0A1H2RXP2 Uncharacterized protein, MTH1187 family n=2 Tax=Marinococcus TaxID=1370 RepID=A0A1H2RXP2_9BACI  ali  16  239...AIVDVTVSPVDKGTGMSDTVAKIQDVLEKHNIDIEMTPMSTLLEGNIGDLLQVVREIHEPFQEGYQRVSTNIRIDDRRDGKQMKKKMESVQ 335
226 4.000e-15UniRef50_F2NFR1 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=F2NFR1_DESAR  ali  21  2...AIMEISVVPLGGGVGVGEYVADLIRYLQNNSIPYKLTDMGTILEGEVDQLLSVARNLHEPFHRQVKRVVTHIAIDDRRDRVHLEDKIKAV. 94
227 4.000e-15UniRef50_D2RA62 Uncharacterized protein n=151 Tax=Bacteria TaxID=2 RepID=D2RA62_GARV4  ali  26  19..NTVAALCIAPSGVGDELSEYVADAVQVIRDSGLKNETNAMFTNIEGEFDDVMRVVKDATMTLVSKGYRTGVILKLDIRPG............ 98
228 4.000e-15UniRef50_D6XW52 Uncharacterized protein n=2 Tax=Bacillales TaxID=1385 RepID=D6XW52_BACIE  ali  20  257...AIADITIMPLGQTTSVSEVVAEVHKRLKETDLEYTLTPMSTIIEGKPEDLYTIIREIHEPFTLGHQRIALNVRIDDRRDKATMAMKLSSV. 351
229 4.000e-15UniRef50_A4E843 Uncharacterized protein n=63 Tax=Terrabacteria group TaxID=1783272 RepID=A4E843_9ACTN  ali  18  11..NTLIAVAIAPCGTGDELSAEVAEVVRVIRESGLPNRTTSMFTEIEGDWDEVMQVVRDATFVLASKGIRTEVVLKADIRPGFTTMTGKLER.. 101
230 4.000e-15UniRef50_A0A1X9M9T8 Uncharacterized protein n=4 Tax=Bacillus TaxID=55087 RepID=A0A1X9M9T8_9BACI  ali  28  3.ATVAAGFQVLPDGRDVNTDGMISEIIEVVKDSGLTYAVGPMETVVEGNLHEVFDVIQKAQQVINTGATECITNIKIHYKPDGVSIGDKLLK.. 94
231 5.000e-15UniRef50_D3R690 Uncharacterized protein n=16 Tax=Bifidobacteriaceae TaxID=31953 RepID=D3R690_BIFAB  ali  22  44..NTVAAVAIAPSGVGAELSEYVAEAVEVIRESGLPNETNAMFTNIEGNLDDVLKAVRDATVKLAEQGYRTGVTLKLDIRPGFSQISEK..... 131
232 5.000e-15UniRef50_A0A2A3UFV6 Uncharacterized protein n=1 Tax=Sphingobacteriaceae bacterium TaxID=2021370 RepID=A0A2A3UFV6_9SPHI  ali  29  2..KINAAIQLLPLGAKGSRYEVIDKAIALIQNSGLNYKVCPFETVVEGETEPVYKLIRDIQEELKHNCDELLINIKIHAATRDLRFSEKLEKY. 93
233 5.000e-15UniRef50_A0A1Q9UCD3 Uncharacterized protein n=1 Tax=Kytococcus sp. CUA-901 TaxID=1517899 RepID=A0A1Q9UCD3_9MICO  ali  27  1...MLVAFSIAPSSEEPDVSEAVARAVGIVRASGLPNHTDSMFTTLEGEWDECMAVIKECVDVLSAESPRVSLVLKADIRPG............ 81
234 5.000e-15UniRef50_A0A1W9R6D1 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium 4484_70.1 TaxID=1970782 RepID=A0A1W9R6D1_9BACT  ali  18  1MP--VLEISILPLGTTASVSSYVAGCVKILKEKGIKYQITPMETIIERSLRKLFRVAEKMHKEVLSKVDRVVTTIKIDDRKDKLTMTGKISSVK 96
235 5.000e-15UniRef50_A0A1V6A0K8 Uncharacterized protein n=1 Tax=Firmicutes bacterium ADurb.Bin153 TaxID=1852883 RepID=A0A1V6A0K8_9FIRM  ali  29  1MAKGSLAIQVLPMGTGSELYRAVDLAIEVIKESGVMFEVGPFETTMEGEIDILWAVAFKAHRAVDSGIGSVLTYIKMSESDEPSSMEEKVAKHR 97
236 5.000e-15UniRef50_U2D7C9 Uncharacterized protein n=3 Tax=Clostridiales TaxID=186802 RepID=U2D7C9_CLOS4  ali  34  6.PECSIAIQVLPKVEGEEVIRVVDEVIAYLKSSGLPVFVGPFETTVEGPFDQLMEMVKECQKCIRAGAPGVSSYVKIAYNPGVWSIDKKVTKHH 101
237 5.000e-15UniRef50_F7YVM0 Uncharacterized protein n=3 Tax=Thermotogaceae TaxID=188709 RepID=F7YVM0_9THEM  ali  46  1MAKITCSIKFLPLVDTATVYALVDEAINIIKNSGLKYLVGPSETTVEGEFEEIVELIKKIGLEMQDDCERFVLQASFDMKREGVTIDEKIRNYR 96
238 5.000e-15UniRef50_A0A094CV43 Uncharacterized protein n=5 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094CV43_9PEZI  ali  17  206............IGTTASVSAEVAAVQRLMKASGLSYTMHSAGTTVEGSWDEVFRIIGQAHTLVHKGVLRVQTDIRAGTRTDKQHFAEKVSKV. 289
239 5.000e-15UniRef50_A0A120JTS4 Uncharacterized protein n=1 Tax=Erysipelothrix larvae TaxID=1514105 RepID=A0A120JTS4_9FIRM  ali  17  1MHHVTCDFTLIPIGTSTSVSEYVKEVPRILKTFPLTYEISGMAASLEGDIDEIYSAIRTIQEAFDKGLSRVYTVIKIDDRRDEATLKYKKEAVQ 98
240 5.000e-15UniRef50_A0A197K9M8 YkoF-like protein n=1 Tax=Mortierella elongata AG-77 TaxID=1314771 RepID=A0A197K9M8_9FUNG  ali  20  61..RCLADFAIYPVGTTASFQRHIDEVEKVLKRCGIDYKVHPQCTTMEGEMGAITYAIKACHEALHMGCPRIASNVRFET............... 138
241 6.000e-15UniRef50_A0A1M3BG35 Uncharacterized protein n=2 Tax=unclassified Solirubrobacterales TaxID=1363568 RepID=A0A1M3BG35_9ACTN  ali  20  2...ATADLTVIGLGPDPSAGAYIAAIQRRLAEQDVGYRMHAMGTSLEGSTADILALVGELHAPFAEGLPRVYTVLKLDERRDRQTLDDKVASV. 96
242 7.000e-15UniRef50_A0A1F9TUS0 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1F9TUS0_9BACT  ali  22  1...MIASFTLIPLGTTDSLSKSLVKAMKLVAQSGLPYKAGPMGTAVEGDWDDVMGLIDRCRNTILKEAPRVMIQIAVDTRRGKNQLVSKVAS.. 91
243 7.000e-15UniRef50_A0A139P9D2 Uncharacterized protein n=17 Tax=Firmicutes TaxID=1239 RepID=A0A139P9D2_9STRE  ali  23  2..RASIALQILPLGAQENRLAVIEEVIDFLQKQPVKQLVTPFETVLEGEWEELFPLLQQAVEIAGAQADTVFANVKINY-GEILSIDEKLEKY. 91
244 8.000e-15UniRef50_A0A0A0JQB4 Uncharacterized protein n=349 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0A0JQB4_9MICO  ali  23  16...MLVAFSVSPSATDDEVTAAVADAVSIVRESGLPHRTDAMFTTIEGEWDECMAVVKACVDAVAAHGPRVGLVLKADVRPGRSGMQGKLDR.. 107
245 8.000e-15UniRef50_D3FC99 Uncharacterized protein n=8 Tax=Solirubrobacterales TaxID=588673 RepID=D3FC99_CONWI  ali  21  2...ATADLTIIGLGPDASAREYIAAVQRRLAAQDVKFQMHAMGTSLEGETADVLALVGELHAPFELGIPRVYTVLKLDERRDKQTLDDKVRSV. 96
246 8.000e-15UniRef50_B4SC76 Uncharacterized protein n=17 Tax=Bacteria TaxID=2 RepID=B4SC76_PELPB  ali  20  2...ALMDIAVLPLDKEGGFSGFVAGLQELLAASGCSYRLHDMGTTVEGPAPLLFNLALKLHEYFSQGGRRVYTVMKIDDRRDRVRLGDKSASVK 95
247 8.000e-15UniRef50_A0A0S7XN74 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0S7XN74_9BACT  ali  17  2...AIMEVSVVTVGSGPSQGDVVAETVKVAKRHGAKFALSPMGTALEGDLDALLEIAREMHECFNGGTQRVITTIRIDDRRDKLSMEYKVDSV. 94
248 9.000e-15UniRef50_A0A2M9HH45 Thiamine-phosphate synthase n=5 Tax=Bifidobacterium TaxID=1678 RepID=A0A2M9HH45_9BIFI  ali  21  270..NTLAQLTIWPTGVGEELSEYVAEVVRVIRESGIRNETHAMSTELEGDYDDIIALVKRAAFVLRDHGYRTQVSLQMDMRPGRDQMHRKVELV. 361
249 1.000e-14UniRef50_A0A2H5Y0M6 Uncharacterized protein n=1 Tax=bacterium HR21 TaxID=2035416 RepID=A0A2H5Y0M6_9BACT  ali  19  2..KVIGMVSIIPIGSGMSLSPYIATCVRTLREAGLHCELHAEGTNVEGQWETLCTALRQCFERLDQGVQRISVLLKVEMRSDR........... 83
250 1.000e-14UniRef50_A0A0G4IYX0 Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4IYX0_PLABS  ali  18  2..HVIADFRLMPIGGSLSMREHVKRCHQLLNDLGLETFEHACGTNITGEFDAVMNAIKQCHEKLASGVARICTDIHVDLRTDKTT......... 85
251 1.000e-14UniRef50_A0A2T4H3Y1 Uncharacterized protein (Fragment) n=1 Tax=Fusarium culmorum TaxID=5516 RepID=A0A2T4H3Y1_FUSCU  ali  23  34..SCYVDFCLLPLGTGVSVAEDIAEVQKVLKASGLKYTLHSAGTTVEGSWDEVMAAVGKAHAAVHKGVVRIQSSMRVGSRTDKQTAEEKVKRV. 158
252 1.000e-14UniRef50_W6EQ98 Uncharacterized protein n=5 Tax=Sulfurospirillum TaxID=57665 RepID=W6EQ98_SULMU  ali  21  2..SVLMEFSMFPLEGEGSKSADVARIVEMIHENGYSYKLTPMSTVVETPMSEALKLVEQAYALLEA-CGRVYACLKFDIRPNRTDMHQKIESVQ 94
253 1.000e-14UniRef50_C8WUJ8 Uncharacterized protein n=8 Tax=Firmicutes TaxID=1239 RepID=C8WUJ8_ALIAD  ali  22  2...AMVAVSISPIGTGTGVSHFVAEAERVLARYDLQYRLDPMFTTIEGDLSTIFAAIQEMHEALAMGAKRLSTVIKIDDRRDHHSMDEKVAAV. 95
254 1.000e-14UniRef50_A0A1B8WJM7 Uncharacterized protein n=8 Tax=Bacillales TaxID=1385 RepID=A0A1B8WJM7_9BACI  ali  30  1MANALVSIQILPTTPGESVIPYVDRAIEIIKAAGVPYRVAPLETTMEGELSHLLGVVQSMSEAMEMGCPSVISQIKIYYNPNGASMGRLLEKY. 96
255 2.000e-14UniRef50_A0A1I3UXR9 Uncharacterized protein, MTH1187 family n=4 Tax=Bacillales TaxID=1385 RepID=A0A1I3UXR9_9BACL  ali  26  1MP--LLEISVIPVGTSPSFSSSVTDAIRVIEEKGLNYQVTPTATIIEGEIDQLMDVAKSIHQNLTNGVNRVITQMSIDHRTDKLNMNRQVEIVQ 95
256 2.000e-14UniRef50_A0A2I1GT67 Uncharacterized protein n=1 Tax=Rhizophagus irregularis TaxID=588596 RepID=A0A2I1GT67_9GLOM  ali  11  9..HVLADFSIIPMGAGTNTTKYIVECQKVLLDSGLNFNLHANGTNLEGNYDQVMCAIRKCIDKIRNGCS......................... 75
257 2.000e-14UniRef50_A0A2D4SR47 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D4SR47_9DELT  ali  21  2..KILAEVCIIPIHGATSLRREIAMAHSILKETGCHVELHSYGTNIEGDFDVIMSAIKTIHQTLHAGTMRLHTSMKISSRIDKQTLQDKVDAV. 94
258 3.000e-14UniRef50_N0BE05 Uncharacterized protein, MTH1187 family n=1 Tax=Archaeoglobus sulfaticallidus PM70-1 TaxID=387631 RepID=N0BE05_9EURY  ali  20  1...MIVEISVVPIGVGESLSRYIARVIDVIKKQSKDFKLTDMGTIIKVDFTELGKLLDLIREEL-KDCPRLYFVIKADERFKDYDLDYKVESV. 90
259 3.000e-14UniRef50_P9WFQ0 UPF0045 protein MT1949 n=145 Tax=Actinobacteria TaxID=201174 RepID=Y1898_MYCTO  ali  21  2..SVLVAFSVTPLGVGEGVGEIVTEAIRVVRDSGLPNQTDAMFTVIEGDWAEVMAVVQRAVEAVAARAPRVSAVIKVDWRPGVTDMTQKVATV. 94
260 3.000e-14UniRef50_A0A0P9C530 Uncharacterized protein, MTH1187 family n=2 Tax=Thiohalorhabdus denitrificans TaxID=381306 RepID=A0A0P9C530_9GAMM  ali  28  4....TVNYSVIPLHSGGHVGDLVAQVVERVEKSGLEYRLTAMGTQIEGELDEIFDLIKDCERLVEKDSERFYTVLTMDYRGEKGALTDKVQSV. 94
261 3.000e-14UniRef50_B4U9H4 Uncharacterized protein n=3 Tax=Hydrogenobaculum TaxID=168657 RepID=B4U9H4_HYDS0  ali  24  4....ILSISMFPVDKGESLSQYVSKVSKIIHESGLEYVITPMATIIETEIEPLLEIIKKGLETMQQDSNRIYVNMAIDYRKGDKTLKQKVESLK 96
262 3.000e-14UniRef50_A0A1M6KAR8 Uncharacterized protein, MTH1187 family n=1 Tax=Dethiosulfatibacter aminovorans DSM 17477 TaxID=1121476 RepID=A0A1M6KAR8_9FIRM :_  ali  22  21...................SKYVAECHRILEETGLKHVLTPMSTVVEGDIDDIFNIIRIIQERMYQGAERVYTQIRIDDRRDKLTIKGKLKAV. 96
263 4.000e-14UniRef50_D0L1F8 Uncharacterized protein n=26 Tax=Bacteria TaxID=2 RepID=D0L1F8_HALNC  ali  22  2..KATAELQVIPIGNGVSVREEVTRVVGLLKAHDFLVETHASGTNIEGEMNAILAAVGQVHEVLHEGSVRLVSYLKLETRTDKPTLAGK..... 90
264 4.000e-14UniRef50_UPI000836DDA4 thiamine-binding protein n=7 Tax=Actinobacteria TaxID=201174 RepID=UPI000836DDA4  ali  22  1...MLFAISISPTTSDESVSHAVARAVKVIRDSGLPHETTSMFTTIEGTWDEVMPVIKSACDAVGEVSPRVQLVMKADLRPGEGEMTGKLER.. 93
265 4.000e-14UniRef50_A0A2N1W5B7 Uncharacterized protein n=1 Tax=Candidatus Goldbacteria bacterium HGW-Goldbacteria-1 TaxID=2013807 RepID=A0A2N1W5B7_9BACT  ali  26  2...AIMDISIVPIGTNTSVSEYLVNAIKILQEKGAKYHICPMGTVVEGEVNDLYDYARTMHEFCDIDVQRVVVTIKIDDRRDIVTMEKKVKS.. 95
266 4.000e-14UniRef50_F4BXR6 Uncharacterized protein n=6 Tax=Methanothrix TaxID=2222 RepID=F4BXR6_METSG  ali  20  2...IVAEFSMVPMGSGTSAGDYIKAIHHILGEAEVNFIPGPMSTAVEKSLQELFDLMEKANDKLQMGVKRIITTIRIDMRLDKISMQSKLSRVR 95
267 4.000e-14UniRef50_I4Y5C5 MTH1187/YkoF-like protein n=2 Tax=Wallemia TaxID=148959 RepID=I4Y5C5_WALMC  ali  12  3...CCADFCLIPFGSSSSVARELAIVHQTLEQTRLTFKLNGHGTEIEGEWDDVTRAIKQCHQALHEGVSRICSDIRISTRIDKQSTDGKVKAVH 104
268 4.000e-14UniRef50_A0A0G4M2N8 Uncharacterized protein (Fragment) n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4M2N8_9PEZI  ali  15  64...CYADFCLIPVGTGVSVAKEVAEVQKLLKASGLHYQMHSAGTTVEGSWDDVFRVVGQAHALVHAGGVRVHLDM................... 137
269 4.000e-14UniRef50_A0A1Q3QKA9 Uncharacterized protein n=1 Tax=Acidobacteriales bacterium 59-55 TaxID=1895690 RepID=A0A1Q3QKA9_9BACT  ali  21  1...MVLELTIIPRGRDLSISSDIAGLVKIIEASGLDYRMTAFGTLVEGTWDQLMSLAKECHFEVRKKSERVLTMMRLDDYGERTGIEGAVSRV. 91
270 4.000e-14UniRef50_A0A126R1L9 Uncharacterized protein, MTH1187 family n=22 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A126R1L9_9EURY  ali  21  2...ITADFSILPMGEGTEISEYVTRAVEIIDASGLNYQLTAMGTQIEDDLRKLYQVCADVQEIFEMGSGRVYSVLKVDDRRDRRTLEAKIKTV. 96
271 5.000e-14UniRef50_Q8TWL4 Uncharacterized conserved protein n=2 Tax=Methanopyrus TaxID=2319 RepID=Q8TWL4_METKA  ali  24  3...VVMEISFYPIGTGPSVSDEIVEVVKALKEAGFEPQVGPMGTVVEVEFEDALEALRVAREAALRVVDRAVFVVKIDERRDKLTAEGKVRSV. 95
272 5.000e-14UniRef50_UPI000694A4D7 thiamine-binding protein n=1 Tax=Desulfovibrio alcoholivorans TaxID=81406 RepID=UPI000694A4D7  ali  20  1MPIML-EFSLIPLDRKDKISRFVSETIEIIKSSGLPYQLGAMSACIEGEWDQVMSVAKQCFDKATENSEHVHIDFKIIWRKG............ 81
273 5.000e-14UniRef50_B1L3X9 Uncharacterized protein n=13 Tax=TACK group TaxID=1783275 RepID=B1L3X9_KORCO  ali  29  3....IVEIAVDPIGTSPSVGDYIRRVVEVIKRRGLKHWVGPMGTSIESSFKELGELLQDIHDELNRGVMRIVTAVRIDDRRDKIDMEYKVRR.. 94
274 6.000e-14UniRef50_A0A1M5T5Y4 Uncharacterized protein, MTH1187 family n=1 Tax=Desulfofustis glycolicus DSM 9705 TaxID=1121409 RepID=A0A1M5T5Y4_9DELT  ali  18  24...ILAQLSIYPVSEGLSMGRFVRKGVKIIEESGYTYQVGGMSTSIEPTLPDLFELVNKIHQQLEEGARRLIIELKVDDRRDKASLAGKIQSV. 116
275 6.000e-14UniRef50_W0JI14 Uncharacterized protein n=4 Tax=Desulfurella TaxID=33001 RepID=W0JI14_DESAE  ali  22  2...AVCGITVIPIGTSPSASSYIAKVVSLIKESGFKAMPTPIGTAIEGDLEEILSIIPKIRDAIYEGLNRVVMNVYIDDRNDKQTLKGKMES.. 93
276 6.000e-14UniRef50_C0GKM3 Uncharacterized protein n=5 Tax=Clostridiales TaxID=186802 RepID=C0GKM3_9FIRM  ali  25  1MP--VLEISIMPIGTDESFSSYVSQACEVVDKRGLQYQVTPMSTMVEGSMEDLLAVVKDLHSPFDTGVNRVITNVTIDERRDKLDMSSMVQA.. 93
277 6.000e-14UniRef50_C7PAH6 Uncharacterized protein n=10 Tax=Bacteroidetes TaxID=976 RepID=C7PAH6_CHIPD  ali  28  3.HKINLALQILPSVPSDQVYAVVDEAIAVIQASGLKYRVCPFETVIEGTYDECMEVVRKAQECFKAGASQLLVYVKMQIKKDDVSIEDKTGKY. 96
278 7.000e-14UniRef50_A0A1Y0HMM6 Uncharacterized protein n=2 Tax=Sulfurospirillum TaxID=57665 RepID=A0A1Y0HMM6_9PROT  ali  20  2..SVLMEFSMFPLEGEGSKSADVARIVQMIHESGYSYKLTPMSTVVETTIGEALKLIEEAYALLEA-CGRVYACLKFDIRPSRVDMHQKIESVQ 94
279 7.000e-14UniRef50_A0A243T3E0 Uncharacterized protein n=4 Tax=cellular organisms TaxID=131567 RepID=A0A243T3E0_9GAMM  ali  25  2..HVVADVNVTPIGAGASLSSHIAACEEVIEAAGLKYRLHAHGTNIEGSWEEVMRVIQRCHDVLHEGAPRVDSAIR.................. 76
280 7.000e-14UniRef50_Q6AQZ7 Uncharacterized protein n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=Q6AQZ7_DESPS  ali  24  1...MLASFTILPFGVGEELKEHVAAVVALVADSGMDYRLGAMQTTIEGEQAEVMALIMRCHELMMERAPRVLTSITMDDRRGATRLRGKVSDV. 91
281 8.000e-14UniRef50_A0A1E7H804 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1E7H804_9DELT  ali  21  1MP--IATVNVIPLGTSPSVGNYVAECIKVLEKAGAVFEVTAMGTVIDGEIEEILNMAGKVHEPFKKGVLRVVTTITIDDRRDKVTSRQKLGSV. 94
282 9.000e-14UniRef50_A0A161LX72 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A161LX72_9BACT  ali  20  2..SVIMEFAMFPMDKGAHVSQYVKRVVEMVDALPFQSQLTAMGTIVECDMEECLDVLAKANSLLETVADRIYCTAKFDNKPGKTQMNHKIEAVR 95
283 1.000e-13UniRef50_F6BL54 Uncharacterized protein n=1 Tax=Thermoanaerobacterium xylanolyticum (strain ATCC 49914 / DSM 7097 / LX-11) TaxID=858215 RepID=F6BL54_  ali  27  1MP--ILEINFVPVGTGASYSSFVQEAVELLNTRGLKYTVTPTSTVIEGNTGELMKVAEEIHNPFKDGAMRVVTNIMIDERRDKPDMEKRVSEV. 94
284 1.000e-13UniRef50_A0A2H9QTN5 Uncharacterized protein n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A2H9QTN5_9EURY  ali  23  2...IIGEISTAPLDKGVHLHEYVKVAVSAIKNTGVKYKTSAMSTTFEKDLDELLRVVRDAHAIINLGSQRVYTIVKIDDRRDDATMETKLG... 92
285 1.000e-13UniRef50_B1YAU6 Uncharacterized protein n=12 Tax=Thermoproteaceae TaxID=2267 RepID=B1YAU6_PYRNV  ali  26  1MAKMVVSLSVVPLGTGPSVSEYVKKATAVIRESGLRYRTGAGFTDVELDYQQLAELLEKMEKALAEGVQRILYTIKIDRRMDKLYIEHKIAK.. 96
286 1.000e-13UniRef50_A0A0E0VQ96 Uncharacterized protein n=89 Tax=Bacillales TaxID=1385 RepID=A0A0E0VQ96_STAA5  ali  27  15MKDTLMSIQIIPKTPNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQSLNERMVEECPSIISQVKFYHVPDGITIETLTEKY. 109
287 1.000e-13UniRef50_E4T3Z6 Uncharacterized protein n=16 Tax=Bacteroidetes TaxID=976 RepID=E4T3Z6_PALPW  ali  27  3.KTVNIALQILPSSHSVHPYALVDKAIEVIAASGLRYKVTPFETVMEGSYDKIMEVIKQAQECYEAGAESLMTYVKIQTSRENVSIEDKMEKY. 95
288 1.000e-13UniRef50_J4GM45 Uncharacterized protein n=1 Tax=Fibroporia radiculosa TaxID=599839 RepID=J4GM45_9APHY  ali  17  41...AIADFCLVPVGTEPSVAEYVAECVRVLEKTGLTYKMTPYGTNIEGPWSAVMKAIHDCHAAVHKGAPRIATDIRIGTRVDRTGNEHKVRRV. 161
289 1.000e-13UniRef50_A0A1H0FZN0 Uncharacterized protein, MTH1187 family n=1 Tax=Bacillus daliensis TaxID=745820 RepID=A0A1H0FZN0_9BACI  ali  26  2...ALLEISVVPVGTGESFSGDVERAVSVIEQNGLKYQVTPTATIIEGDIDKLFDVAQVIHNEIKNNAKRVVTSIKIDDRTDELTLDRQVDHV. 94
290 1.000e-13UniRef50_A0A1F6Q9F5 Uncharacterized protein n=1 Tax=Candidatus Melainabacteria bacterium GWF2_37_15 TaxID=1801606 RepID=A0A1F6Q9F5_9BACT  ali  21  2...ATAEIAIIPMGTGTSTSDFIAEADRVLLSHPVKNKLTGMGTELECDIDTLFEVLKEMHQKFTKGAQRMYTVIKIDDRRDKSTLESKVTS.. 95
291 1.000e-13UniRef50_A0A133V6T6 Uncharacterized protein n=12 Tax=cellular organisms TaxID=131567 RepID=A0A133V6T6_9EURY  ali  18  2...AVVEVTVIPLGTTPSISEYVARALDVLREKDIKYELTSTGTIIEGDLDKVLNLAKKMHESFDEGVSRVITIIRVDDRRDKQ.......... 85
292 2.000e-13UniRef50_A0A2I0NGH6 Uncharacterized protein n=1 Tax=Candidatus Methanoperedenaceae archaeon HGW-Methanoperedenaceae-1 TaxID=2013824 RepID=A0A2I0NGH6_  ali  28  1MKTVIAELQVVALGTGTSMSQHVSEAVSAIGKLGIKYSLTPMGTAIEASMDEVFDAVKTVHEALRTGVKRVVTHLAIDDRRDPKSMEEKVESVK 99
293 2.000e-13UniRef50_UPI00036CAFA6 thiamine-binding protein n=11 Tax=Salinispora pacifica TaxID=351187 RepID=UPI00036CAFA6  ali  21  1MP-VLVAFSVTPLGVGEDIGELVAEAVRVVRESGLPNHTDAMFTLVEGEWDQVFEVIKNAVDAVAVRSPQVSTIIKMDY............... 79
294 2.000e-13UniRef50_A0A151BFF0 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon B25 TaxID=1779369 RepID=A0A151BFF0_9ARCH  ali  27  9.........VVPLGLGPSVSRLIAEGIKELERRGVKYQLTPMSTVYESSVEEAFEAAKAVHEIFKAGAVRLVTTVKVDDRRDRKRMEEKVEAVR 97
295 2.000e-13UniRef50_A9WDS1 Uncharacterized protein n=13 Tax=Terrabacteria group TaxID=1783272 RepID=A9WDS1_CHLAA  ali  31  1MASVTVSFEVLPGGLPDKATTYAAVDAAIAVVSGLTYRVCPMETTIEGDYDAIMAVIKQAQEVLAAGASRVFTLIKVDYDPNGSSIAEKLAKY. 96
296 2.000e-13UniRef50_A0A0F9RA70 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9RA70_9ZZZZ  ali  25  2...IHAEVSVYPMGTTTSASFYIAKGIEAIKNEGLRYEVNPMGTLLESEVDKIFEASKRITEAIHNGVQRVEVVLKIDSRKDKDSLEEKMESLK 97
297 2.000e-13UniRef50_A0A2G5BC74 YkoF-like protein n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=763665 RepID=A0A2G5BC74_COERN  ali  23  3...VSGEIQIVPIGPDVSFTKYIARVKTIMEASGLQHTMHDSGTNFQGDYTLIMHVTQDCQSVLDNGAPRVLCYLKLGTRTDKQPAAAKVEKY. 98
298 2.000e-13UniRef50_UPI000997DA74 thiamine-binding protein n=1 Tax=Salipaludibacillus agaradhaerens TaxID=76935 RepID=UPI000997DA74  ali  31  1MP--LLEISVVPVGTTESFSHDVEKAVSIIEQNNLKYQVTPTSTIIEGELDKLMDVAQVIHNEIENEAKRVVTTIKIDDRTDKISLESQVNKV. 94
299 2.000e-13UniRef50_D5DEY1 Uncharacterized protein n=13 Tax=Bacillus TaxID=55087 RepID=D5DEY1_BACMD  ali  21  1MP--LLEISIIPVGTDTSFSSEVINAVRKLKGKELHYDVTPTSTIIEGDLEQLWQVAKEIHEAISSGPNRVITNMRIDHRKDKKTMNHQINTV. 94
300 2.000e-13UniRef50_A0A1Q9NLD2 Uncharacterized protein n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9NLD2_9ARCH  ali  17  5..SIIAELTLSPRSPSVSLSKPIKEALKILNKEGLTLETHAMGTNIQCNLDLLFNAIKQVQEFLIQDYPRVVTTLKIDQRTDKRRMRDKINSVK 101
301 2.000e-13UniRef50_A0A261F177 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A261F177_9BIFI  ali  18  31..NTLASVAIYPNGVGEELSQYVSQAVEVIRESGLTNETHSMATEIEGDLDDVLRVIRDATMKLAGQGYRTGVHLSLDIRPKRDQMHAKVKLV. 122
302 3.000e-13UniRef50_A0A1F5AS05 Uncharacterized protein n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1F5AS05_9BACT  ali  21  2...IIAELAVFPTSEGSSVSRYVKEAVRVIEESGLRTETGGMSTTIEPDLKSLFQVIEDAHQILKMGARRIHIDLRVDHRLDKETIASKKAAV. 94
303 3.000e-13UniRef50_A0A178PE81 Uncharacterized protein n=2 Tax=Staphylococcaceae TaxID=90964 RepID=A0A178PE81_STALE  ali  27  1MTNTLMSIQIIPEHEDTGVIPLVDEAIRIIDDSGLKYQVNPLETTIEGDMNACLILIEQINERMVEECKSIISQVKFYHVPEGIMMDTLTDKYR 95
304 4.000e-13UniRef50_A0A0K8LRD0 Pyruvate dehydrogenase E1 component subunit alpha n=1 Tax=Aspergillus udagawae TaxID=91492 RepID=A0A0K8LRD0_9EURO  ali  16  390.ARCTADFSLVPIGTNASFSQQIADIQRLLQQTGLKFHMDPMGTTIEGSWDQVVQVIGFAHTLIHEGVPRIQTDIRIST............... 473
305 4.000e-13UniRef50_UPI000DCA4E80 thiamine-binding protein n=1 Tax=Bacillus endophyticus TaxID=135735 RepID=UPI000DCA4E80  ali  29  2..TILLEISVIPVGTEASYKEYITDAVNLIKDKGLTYHIGPSSTVIEGEIDQVMEVAKEFHKHLKQNANRVVTNLRIEERSDKMSISHQMRAVK 96
306 4.000e-13UniRef50_A0A084QHI9 Uncharacterized protein n=2 Tax=Hypocreales TaxID=5125 RepID=A0A084QHI9_STAC4  ali  17  10.ASCYADFCLIPVGTSVSVAAEVAEVQRLLKASGLKYTMHSAGTTVEGSWDEVMTVIGKAHAVVHQGVLRVQSSMRVGTRTDKQTAADKVKRV. 139
307 4.000e-13UniRef50_A0A219AN53 Uncharacterized protein n=5 Tax=Methanobrevibacter TaxID=2172 RepID=A0A219AN53_9EURY  ali  20  2...ITCDFAILPVGEDTECKKYVTAAVQLIKDSGLNYQLTGMGTQIEAELKELYDAIANAQEEFKTGIGRVYTVIKVDDRRDNRTLDAKVKTV. 96
308 5.000e-13UniRef50_F0UM12 Predicted protein n=35 Tax=Eurotiomycetidae TaxID=451871 RepID=F0UM12_AJEC8  ali  17  21...............SASVSQQIADVQRLVEKSGVKYVMHSAGTTLEGSWDAVFALIGQAHAMLHQGIVRIQTDIRVGSRTDKQSMEDKVAVV. 100
309 5.000e-13UniRef50_A0A259CQJ0 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A259CQJ0_9HELI  ali  18  1MLSVLMEFSMFPTSEGASVSKSVSKIIDAIDKSGVPYQLTPMGTVIESSMKEALGIIELAYEQLN-DCDRVYSSLKFDIRKNENRLKTKIASV. 98
310 5.000e-13UniRef50_A0A1W9VQG6 Uncharacterized protein n=2 Tax=unclassified Candidatus Cloacimonetes TaxID=1047068 RepID=A0A1W9VQG6_9BACT  ali  23  4..NVICDLVVVTYDIGPSLSPFVAKVIDVINDTKTEHVLTPMGSVIEGQFDDVMALVREIFFKFAPEYERLGITIKIDFRASKQRIKGKVSSV. 96
311 6.000e-13UniRef50_G8TJL3 Uncharacterized protein n=17 Tax=root TaxID=1 RepID=G8TJL3_NIAKG  ali  35  1MHTINASIQIVPIVLDKHPYLWVDDAIAIIQQSGIKYEVTPFATILEGTYEEVMRVIHQVNEFLYQGCAEWIANLQIQIRSTNITGEEKTGKFK 98
312 6.000e-13UniRef50_D9TTT3 Uncharacterized protein n=50 Tax=Firmicutes TaxID=1239 RepID=D9TTT3_THETC  ali  24  3....ILEINIVPVGTGASYSSFVQDAVNLLNKRGQKYTVTPTSTVIEGNTPELMKVAEEIHNPFQDGVMRVVTNIMIDERRDKPDNMEK..... 89
313 7.000e-13UniRef50_A0A2I1MAU2 Uncharacterized protein n=3 Tax=Anaerococcus TaxID=165779 RepID=A0A2I1MAU2_9FIRM  ali  32  4....SIAIQVLPETDREDIFNKVDKVIAYIDQTGLDYEVGAFETTVDGEFDELMDIIKKAHELMEEDMDGVNCYIKTSFRKDGWSIEDKTKKYR 96
314 7.000e-13UniRef50_A0A232LTZ7 Uncharacterized protein n=1 Tax=Elaphomyces granulatus TaxID=519963 RepID=A0A232LTZ7_9EURO  ali  18  18..HCTADFCLIPIGTSASVSAQIADVQRLIQKSGLSYVMHSAGTTTEGPWDKVHQVIGQAHTMLHQGILRIQSDIRVGSRTDKQTFEDKVRAV. 146
315 7.000e-13UniRef50_A0A2W4JS90 Thiamine-binding protein (Fragment) n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4JS90_9FIRM  ali  24  2...AIVAVSIAPVGEGVSVSPWVARALEVLAAQDVRYQVGPMFTTLEGDLDEILALIRQMHEAMAAGAQRVSTVIK.................. 76
316 7.000e-13UniRef50_A0A226BV10 Uncharacterized protein n=1 Tax=Natranaerobius trueperi TaxID=759412 RepID=A0A226BV10_9FIRM  ali  23  2...AFLEVSILPVGTGSSISSYIKGAINEIEEEGLKYTITPTSIVIEGDIDTLLEISKKLHKKSLERTNRVVINIQIDDRTDKTTIDRLVETAR 94
317 8.000e-13UniRef50_UPI0009EA6DB3 thiamine-binding protein n=1 Tax=Caviibacter abscessus TaxID=1766719 RepID=UPI0009EA6DB3  ali  34  2..NASVAIQILPKVDDEKLIIIVDKVIEYIKSKGLKTVVGPFETTIEGDYDELMEIIKQCQIIVNSGAPSVMSYVKINYNPNMFTISQKIDKY. 96
318 8.000e-13UniRef50_UPI00099CBE43 thiamine-binding protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI00099CBE43  ali  19  1...MLVAFSLTPIGVEAGVADYIADAVKIIRDSGLPNRPDSMYTTIEGEWDDVTDVIPQATKAVPAKAPRDQITIKADI............... 76
319 1.000e-12UniRef50_A0A2W4S4F8 Uncharacterized protein n=1 Tax=bacterium TaxID=1869227 RepID=A0A2W4S4F8_9BACT  ali  29  1...MLFSLAMFPVGGGDSLVEPVSEVIDEIDRSGLPYEVTGMDTVIEGEWDEVMPVIKRAEERLRQKHDRVYMLLAVDDHKG............ 79
320 1.000e-12UniRef50_A0A1G8LWZ8 Uncharacterized protein, MTH1187 family n=2 Tax=Bacillaceae TaxID=186817 RepID=A0A1G8LWZ8_9BACI  ali  26  2...AMADISIVPIVEEKSLGEEVAAIHEELEKHKVRYELTPMSTVIEGDIDDLFSVIQALHKPVERGWTRISTDIRIDDRRDGETMEEKKARV. 98
321 1.000e-12UniRef50_G8C234 Uncharacterized protein n=2 Tax=Saccharomycetaceae TaxID=4893 RepID=G8C234_TETPH  ali  22  1MPNCVVDLCLYPVGTEVSGSDFVARVEKRIHESGLKSSLHSAGTTIEGPWDQVMSLVGKLHEHCHENFKRIHSHIRV................. 81
322 1.000e-12UniRef50_A0A1E3NFV8 Uncharacterized protein n=1 Tax=Pichia membranifaciens NRRL Y-2026 TaxID=763406 RepID=A0A1E3NFV8_9ASCO  ali  15  2..HCLADVALTPVGPAEGFEEALASCVPILEKSGLTYVVHDGGFTIDADWQAATDLIGLLHQRLHAGFERVHSDIRIGTRTDKQTMQDKVDTV. 95
323 1.000e-12UniRef50_A0A1H6FV17 Uncharacterized protein, MTH1187 family n=1 Tax=Thermoleophilum album TaxID=29539 RepID=A0A1H6FV17_THEAL  ali  25  2...ATAELSVVPIGPDPSVSHVVAEIHRRLRQQRVRYRLHAMGTELEGETTDILALVAELHRPFELGYPRVYTVLKLDERRDR........... 84
324 1.000e-12UniRef50_A0A0G0ZBW9 Uncharacterized protein n=3 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G0ZBW9_9BACT  ali  32  1MPEASIAIQVLPKAKNGKQSKIIDEVIGFIKKQGVTCEVGPMETAMEGDLDQLLEIVRKIQLAVKKGAESLFSYIKIIYEPGGVTIGEKVTKHR 97
325 1.000e-12UniRef50_C0QRS1 Uncharacterized protein n=83 Tax=Bacteria TaxID=2 RepID=C0QRS1_PERMH  ali  20  2..SVLVEFAMFPTDKGESVSPYVSRIIKMIDESGVNYKLTPMGTVFEXXXXXXXXXXXXXXXXXXXXCNRVYSVVKFDIRKGKSRLKQKIESV. 94
326 1.000e-12UniRef50_T2IC16 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=T2IC16_CROWT  ali  19  2..KVIADICIIPIGVGVSVSEYVAVCQTIFTEANLNPQLHGYGTNVEGEWDEVMAALKLEDEKIHAGSPRISTS.................... 74
327 2.000e-12UniRef50_K9AWN3 Uncharacterized protein n=133 Tax=Bacteria TaxID=2 RepID=K9AWN3_9STAP  ali  29  1MNDTLMSIQMIPRPKGEDVIPYVDEAIRVIDESGLKYRVGPLETTIEGEMSELLILIQKMNERMVEEVESLMNQIKFYHVPEGISIETLTGKY. 95
328 2.000e-12UniRef50_A0A1M2V4K4 UPF0045 protein (Fragment) n=2 Tax=Agaricomycetes TaxID=155619 RepID=A0A1M2V4K4_TRAPU  ali  17  1.......FCLIPMGTGTSVAEYIAECARVLEKTGLK---------VKGPWTEVMQAIHACHAAVHAGAPRIATDIRIGTRVDRTGNEGKVKRV. 84
329 2.000e-12UniRef50_A0A1R1MNK7 Uncharacterized protein n=3 Tax=Desulfurobacterium TaxID=64159 RepID=A0A1R1MNK7_9BACT  ali  22  2...AVMEISVVPVGTNPCVSEYVSYAYKLLKEKGYYFQLTAMGVIVQGDVEELLQLALEIHRPFEKGALRVMTTIRIDERKD............ 82
330 2.000e-12UniRef50_C7N656 Uncharacterized conserved protein n=59 Tax=Terrabacteria group TaxID=1783272 RepID=C7N656_SLAHD  ali  27  3...CAIALQYLPMDSTSDAERVVDEVIAAIDASGLDYYVGPFETTVEGDFDSCMALLKTCLEAAAAGCKESASYVKISWRPGGRVMDDKIGKYH 98
331 2.000e-12UniRef50_A0A1H3J5M3 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1H3J5M3_9ACTN  ali  22  8.PSVIAEIQVAPSGTADDPHAHVEAAIGVLQASGLRYEVGALGTTLEGDADTVWATLRAAHEAMAAGATSGISHVKVATV--NRTMDSLTRKFR 101
332 2.000e-12UniRef50_E9ERC8 Cell wall biogenesis protein n=4 Tax=Hypocreales TaxID=5125 RepID=E9ERC8_METRA  ali  17  10.PKCLADFNLVPIGTGESIAEELAEVERLLKHTGVKHTMQTTGTVLEGTWDEVVNAIGKAHAAVHQGVAKVQSEIRIGTK.............. 90
333 2.000e-12UniRef50_A0A0F9SMI9 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9SMI9_9ZZZZ  ali  20  1...MLAELSITPLCEIEDSADWMAQVINKIDESGLKYQVTAMGTLIEDDWDSLMETIHDCQKIMLTHCPRVQTDLRIDEHLGQKSL........ 84
334 2.000e-12UniRef50_UPI00047CA64F thiamine-binding protein n=1 Tax=Arcobacter lanthieri TaxID=1355374 RepID=UPI00047CA64F  ali  26  2..SVLMSLAMFPTNTTGSKSKEVSEILNIIKDSGLKYQLTSMCTIVEAELKELLDLVNLCYLKLEKGCDRVYAVVNFDIRTGENRIESKISSV. 95
335 2.000e-12UniRef50_C1HBY0 Uncharacterized protein n=4 Tax=Eurotiomycetidae TaxID=451871 RepID=C1HBY0_PARBA  ali  16  9...............SPSVSQQIADVQRLVEKSGVKYVMHSAGTTLEGSWDAVFAVIGQAHTMLHEGIVRIQTDIRVGSRTDKQRMEDKVAVV. 88
336 2.000e-12UniRef50_UPI0009975AA0 thiamine-binding protein n=1 Tax=Salipaludibacillus agaradhaerens TaxID=76935 RepID=UPI0009975AA0  ali  19  2...........PLGAGTSVSDVVAEVHRLLKSSKLNYQLTPMSTILEGEVDDLYEILKQIQEPFNLGHKRVAMNIRIDDRRDKVSMKSKVAVV. 88
337 2.000e-12UniRef50_A0A1B7P654 Uncharacterized protein n=1 Tax=Emmonsia sp. CAC-2015a TaxID=1658172 RepID=A0A1B7P654_9EURO  ali  19  5...............SPSVSKQIADIQRLVEKSGLKYVMHSAGTTLEGSWDAVFAVIGQAHTMLHQGIVRIQTDVRVGSRIDKQSMEDKVSAV. 84
338 3.000e-12UniRef50_A0A1Q7LU13 Uncharacterized protein n=12 Tax=Archaea TaxID=2157 RepID=A0A1Q7LU13_9CREN  ali  23  9....IAEFSIHPIGSGTSVGRYVKAAIRSLAKEGLQYQVTPMATVLEPELTKILQAVEVSHAAVRRGAKRISSTLRIDQRLDKRTMVDKVTSLK 102
339 3.000e-12UniRef50_Q1AV15 Uncharacterized protein n=4 Tax=cellular organisms TaxID=131567 RepID=Q1AV15_RUBXD  ali  24  2...VVAEISIIPIGTTTSVSRYVSAAVKEIEASGLKCHLGPMGTTIEAETEEVYAALARAQAAFDLGADRAYTIIKIDERRDRRSMEDMVRSAR 97
340 4.000e-12UniRef50_UPI0009E8B6DA thiamine-binding protein n=1 Tax=Caviibacter abscessus TaxID=1766719 RepID=UPI0009E8B6DA  ali  34  2..NASVAIQILPKVDDEKLIIIVDKVIEYIKSKGLKTVVGPFETTIEGDYDELMEIIKQCQIIVNSGAPSVMPYVKINYNPNMFTISQKIDKY. 96
341 4.000e-12UniRef50_A0A1X6W4Z4 Uncharacterized conserved protein n=1 Tax=Chlamydia abortus TaxID=83555 RepID=A0A1X6W4Z4_CHLAO  ali  28  2MANALVSFETIP--RTEDAVPYIDLAVDIIRKSGVKYVVGPMDTMMEGELEQLLEIVKQVNELAKLGGGGISSVIKIHYDPKGISMAQMTERY. 93
342 4.000e-12UniRef50_A0A1W9P3F2 Uncharacterized protein n=3 Tax=unclassified Aminicenantes TaxID=910038 RepID=A0A1W9P3F2_9BACT  ali  21  2...IIAELAIFPTSEGASVSRYVKEVLKIIEKSGLNHETGGMSTTIEPDLASLFRVIEEARRLVAMKVKRIHIDLRIDHRLDKETIKTKLAA.. 93
343 4.000e-12UniRef50_A0A2E7R1Q0 Uncharacterized protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7R1Q0_9CHLR  ali  30  1...MLAEIQVXPSGTETNEYEYVEAAIDLIQESGLSYEVGALGTSIEGPSDEVWDLLRRVIESVESGAESAVAQIKIGYFPGEEKIASLTSKFR 95
344 4.000e-12UniRef50_UPI0007841CB4 thiamine-binding protein n=7 Tax=Demequinaceae TaxID=1042322 RepID=UPI0007841CB4  ali  26  1...MIAEIQVLPVGTPDDHYAHVDAAIATIEASGLSYEVGALGTTIEGTPDEVWHLLRRVHETIDAGAEGCLSVIKVSGAAGGPSVHDLVGKHR 96
345 4.000e-12UniRef50_J7L537 Uncharacterized protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=J7L537_NOCAA  ali  29  1..................MAPAVARAVKVVRDSGLPNETTSMFTSVEGEWDEVMDVVKRAVEAAGEGAGRVSLTLKADIREGVTDLRGKVEAV. 76
346 4.000e-12UniRef50_W2S7W0 Uncharacterized protein n=1 Tax=Cyphellophora europaea CBS 101466 TaxID=1220924 RepID=W2S7W0_9EURO  ali  18  42.ARCKADFCIHPIGTSPSISTYIDKIETLVKESGLQYTVHDTGTTIEGSWTDVMNLIGRAHAEMHQGVQRAHS----DDR.............. 118
347 5.000e-12UniRef50_K0IJI8 Uncharacterized protein n=2 Tax=Nitrososphaera gargensis (strain Ga9.2) TaxID=1237085 RepID=K0IJI8_NITGG  ali  21  2..TVHAEISIVPLGRDTSMSKEVAAAFDAIHKKNLKTKLTALGTQVEKNLDSVLQAVEAAHEAAKAGAKRVISTVRIDERLDKQTLQDKVKSVK 98
348 5.000e-12UniRef50_X5E1A2 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=10 Tax=Bacteroidetes TaxID=976 RepID=X5E1A2_9BACT  ali  30  6.NKINVAIQVLPEADGKIKYELVDKAIETIQKSGYRYQVCPFETVVECEFNEFPALLERIHEACEAGTQRMITNMKLQVNFEKVAIEDKMEKY. 99
349 5.000e-12UniRef50_A0A1F8NRZ5 Uncharacterized protein n=7 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1F8NRZ5_9CHLR  ali  37  10....NLAVQVLPLVDDP--YPVVDRAIAAIDASGLRYEVGPMETVMEGTLDQLAAAKAAHLACFEAGAARVVTILKIGDALEGTTIEDKVARYR 98
350 5.000e-12UniRef50_A0A0H1BST2 Uncharacterized protein n=1 Tax=Emmonsia parva UAMH 139 TaxID=1246674 RepID=A0A0H1BST2_9EURO  ali  15  13..HCTADFCLIPIGTSASVSQQVADVQRLVEKSGVKYVMHSAGTTLEGSWDAVFAVMGQAHTMLHQGIVRIQTDIRVGSR.............. 93
351 6.000e-12UniRef50_A0A1S2GLG1 Uncharacterized protein n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A1S2GLG1_9MICC  ali  26  1...MIVAFSVAPSTTDGSVHEAVAAAVKVVRDSGLPNSTSSMFTELEGEWDEVMDVVKRATEAVAAYGSRVSLVLKADIRPGYTGLTGKIER.. 92
352 6.000e-12UniRef50_A0A133ZVU8 Uncharacterized protein n=1 Tax=Gemella haemolysans TaxID=1379 RepID=A0A133ZVU8_9BACL  ali  25  44..NCSIALQILPLDNHDGRLKTIDKVIYFLQNKHSNVIITPFETVIEGEFNELMDTLKECFVLAGEDSKNIFANVKINY-GDVLTINEKIDKF. 133
353 6.000e-12UniRef50_A0A150ANS6 Uncharacterized protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A150ANS6_9BACT  ali  17  3...AIMNFAIFPIDKGDHIGEYVSKVVKHIKDSGLTYQFSPMGTVIEAEVTELLNVVDEAYKIMDPISDRIYCVMNMDYNKNKSNMKSKTES.. 93
354 7.000e-12UniRef50_A0A1Y0VQH6 UPF0045 protein n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1Y0VQH6_PEDPE  ali  35  2..NTSVAIQVLPIMEDEKLVAAVDQAIKYIKSTGVNYQVGAFETTLEGDYDQLMEIVKNITKITAAGAPQVMSYVKINYKPEGQGIHEKTDKYQ 97
355 8.000e-12UniRef50_A0A0H5RF65 Uncharacterized protein (Fragment) n=1 Tax=Spongospora subterranea TaxID=70186 RepID=A0A0H5RF65_9EUKA  ali  19  16..RIVADFCLTPVGSSPSIRKYVEMCHLVLKDFGIECHQHATGTNLRGEFEDIIEAVKQCHEKLGSDIKRVFSNLHIDWRTDKSS......... 102
356 1.000e-11UniRef50_A0A2T2XPA5 Thiamine-binding protein n=4 Tax=Sulfobacillus TaxID=28033 RepID=A0A2T2XPA5_SULTH  ali  16  2...AVAEIKIWPVGTSDSVAPYIRECFRIAEDSPLDAVLTPTSTVLDGPLSAILALADQMHAPFTLGADRVLTTITIDERLDKETMEDMVDSV. 95
357 1.000e-11UniRef50_A0A0S2HZX0 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A0S2HZX0_9BACT  ali  30  1MNKINFAIQVLPQGV-ENVYEIVDKAIAVIERSGVKYRVCPFETVLETTWDNALDILSNVKNEVLKEAPSTLINLKIQAAAGDVAIEDKTGKY. 93
358 1.000e-11UniRef50_A0A061P018 Extracellular mutant n=3 Tax=Bacillales TaxID=1385 RepID=A0A061P018_9BACL  ali  21  4.....ADVTLTPSGEGTSFSQEIAHFHEVLDRYDITYEKTSMSTIIEGEMNDLWVVLQELHKTVNRDWERISMNVRIDDRRDGKSIEGKKQSVQ 97
359 1.000e-11UniRef50_A0A087DTG9 Uncharacterized protein n=4 Tax=Bifidobacterium TaxID=1678 RepID=A0A087DTG9_9BIFI  ali  25  39..NTVAAIQVSVTGAGAEVSPYVSQAIEVIRDSGLPQETNALFTDVEGNLDDVLHVAGEAAKKLAEQGYRTSLVLHMDIRPG............ 118
360 1.000e-11UniRef50_S3AC37 Uncharacterized protein n=77 Tax=Actinobacteria TaxID=201174 RepID=S3AC37_9MICO  ali  24  1...MLVAFSVAPSGTDGSVHDAVAAAVKVVRDSGLPHRTTSMFTEIEGEWDEVFAVVKAATDAVMPFGSRVSLVLKADIRLGRTGLDGKIER.. 98
361 1.000e-11UniRef50_A0A2R6C2Q5 Uncharacterized protein n=5 Tax=Candidatus Marsarchaeota TaxID=1978152 RepID=A0A2R6C2Q5_9ARCH  ali  31  1MTKLVVSISVTPIGTDTSVSKYVREVISILQKAGLKYRVGAGFTDVEIDFETLAKLLSEFHTALKMGVKRVSTLIKISYRADKETIEAMLHS.. 96
362 1.000e-11UniRef50_A0A257AKI3 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_205 TaxID=2012510 RepID=A0A257AKI3_9ARCH  ali  21  1...MIVSITVIPVGTSPSLSQYIAKLIKMFRDEGYTFKLTDTASIFESDFEELSSLLSKIYDILYEGIDRVVTVVTIDERRDKLKLDKKIESV. 94
363 1.000e-11UniRef50_A0A1G6T5D5 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=1 Tax=Peptococcus niger TaxID=2741 RepID=A0A1G6T5D5_PEPNI  ali  30  3...ASLSLQILPKTEDDELLRIVDKVIRYLESTGLKTFTAPFDTTIEGDFDTLCQVIKRAHEIIEEGAQGVSSNMKLYYTPGIFTIDEKVSPYH 99
364 1.000e-11UniRef50_C7NBH3 Uncharacterized protein n=196 Tax=root TaxID=1 RepID=C7NBH3_LEPBD  ali  37  7..NASIAIQVLPVVGNEEIVRVVDEVIEFIKSKGLKMNVAPFETTIEGNFDELMEIVKECQVAVKAGAEGVMSYVKINYKPDILKIDEKISKY. 101
365 1.000e-11UniRef50_E0STY1 Uncharacterized protein n=1 Tax=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1) TaxID=583356 RepID=E0STY1_IGNAA  ali  26  1MP-IVVDLRIIPVGTTTSLSTYIAEVIKTLKELGIRYNIHASGTNIEIEFEQLSQVLRRLTEKLSMDIKRILIDISIDIRLDKETIENKLDSIK 97
366 2.000e-11UniRef50_D5V167 Uncharacterized protein n=14 Tax=Bacteria TaxID=2 RepID=D5V167_ARCNC  ali  18  2..SVLLEMAMFPTDYGESKSAHVAKVIDTIRKSGYSYQLTSMCTIIETEIGQALKLIEDCYKVLESDCNRVYATLTFDIRKGHSRLKTKVES.. 94
367 2.000e-11UniRef50_UPI000944FD5C thiamine-binding protein n=1 Tax=Hydrotalea flava TaxID=714549 RepID=UPI000944FD5C  ali  32  1MHQVNASIQIVPIVMDKHPYEWVDEAIAIIQQSGIDYEVGPFATVIEGKYDAVMQVIQAINEHLYQGCAEWIQNIQLQIRSSDITRIEKTQKF. 97
368 2.000e-11UniRef50_A0A0G1FN47 Uncharacterized protein n=1 Tax=Candidatus Gottesmanbacteria bacterium GW2011_GWA2_43_14 TaxID=1618443 RepID=A0A0G1FN47_9BACT  ali  38  37MPKATVSIQILPKSKDEKNLKIIDEVIDYIKSRRVSYEVGPMETTMEGDLDLLLDIVREIQLAADMGAGQLFSYIKIIYNPKGVSIREKVTKHR 133
369 2.000e-11UniRef50_A0A285NEE0 Uncharacterized protein, MTH1187 family n=3 Tax=Bacteria TaxID=2 RepID=A0A285NEE0_9AQUI  ali  20  2..SVLVEFSMFPTDKGESVSPYVSRIIKMIDQSGIPYKLTPMGTVFEXXXXXXXXXXXXXXXXXXXXCNRVYAVVKFDIRKGRSRLVQKIESV. 94
370 2.000e-11UniRef50_A0A1V4QTH5 Uncharacterized protein n=1 Tax=Planctomycetales bacterium 4484_113 TaxID=1956161 RepID=A0A1V4QTH5_9BACT  ali  23  3....LVDFTVVPLGSGSTSLSFVALVQQELEKSGLSSRLNPMSTTVEGDLGDILAFIKRLHAKLRAGYQRISTSIKIDDRFDKPHIERKMRVVK 96
371 2.000e-11UniRef50_UPI00094F7EB3 hypothetical protein n=1 Tax=Labilibacter aurantiacus TaxID=1849719 RepID=UPI00094F7EB3  ali  23  2..SVLLNFAMFPTDAGISKSKAVSQVLDMIKKSGVSYKLSPMSTTVETEMQEALEIVNKAYSLLEKDHERVYSSITIDARKGEMRMESKIEA.. 93
372 2.000e-11UniRef50_A0A1F9LQ69 Uncharacterized protein n=10 Tax=root TaxID=1 RepID=A0A1F9LQ69_9DELT  ali  23  2...ALMQLTVIPLGTGSSLSDVVAEIQSELARQGFFYVLNDMGTTIEGESEALLALAGRLAEPFKRGAMRVVTQITIDDRRDKQRLGDKTASV. 94
373 2.000e-11UniRef50_A0A1E5T0W8 Uncharacterized protein n=3 Tax=Cytophagales TaxID=768507 RepID=A0A1E5T0W8_9BACT  ali  26  1MHQINLGIQVVPIAAADQGYPIIDECIALIQKSGISYTVTPFETVLEGNYKEIMSLVHDIYERANTLSPETVINIRIHSKQNKVVAKDKTDKF. 94
374 2.000e-11UniRef50_A0A2J2H8E6 Uncharacterized protein n=4 Tax=TACK group TaxID=1783275 RepID=A0A2J2H8E6_9CREN  ali  25  1MARMVVSLSVTPLGTGTHLSAYVRAAAETLDEMGVKHKTGAGFTDIEDDYSTLAEILRRIEDRLAMGVKRVDFIIKIDRRMDELTIEGKISKV. 97
375 2.000e-11UniRef50_Q96YQ9 Uncharacterized protein n=5 Tax=Sulfolobaceae TaxID=118883 RepID=Q96YQ9_SULTO  ali  25  2..KVLVDIAVEPLGTSTSISKYVKKVFEILDRRGIRYYPAPMTTIELDDITQLGYLLKEINDELEMGVKRVVTLLKIDDRRDKESIDHKLEVIK 97
376 2.000e-11UniRef50_G6CB40 Uncharacterized protein n=268 Tax=Bacteria TaxID=2 RepID=G6CB40_9STRE  ali  26  2..KASIALQVLPLSQGIDRIAIIDQVIAYLQAQSVTMVVTPFETVLEGDFDELMRILKEALEVARQEADNVFANVKINV-GEILSIDEKLEKY. 91
377 2.000e-11UniRef50_A0A1C0B2R7 Uncharacterized protein n=11 Tax=Epsilonproteobacteria TaxID=29547 RepID=A0A1C0B2R7_9PROT  ali  20  2..SVIMSLAMFPTNKIGSKSKDVSEVLKVIKNSGLNYELTSMNTIVEKTLKELLDLIDLCYLKLDEGCDRVYISVNFDARKEGVRMKSKIESVQ 96
378 2.000e-11UniRef50_A0A1Y1W8R3 YkoF-like protein n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1W8R3_9FUNG  ali  20  3...VSGEIQMVPLGI-VSFTKYIARVKTILEESGLEHTMHDSGTNFQGEYALVSKVVEQCQSVLDNGAPRVLCYVKLGARTDKLPAAQKVQNY. 97
379 3.000e-11UniRef50_A0A1G6P463 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1G6P463_9MICO  ali  27  1...MLAEIQVSPRGNAENPYAHIEAAIAVIENAGLVYEVGAMGTTIEGTPEQVWTLLRAVHETLKAGAAGVTSHIKVGQGADGPSIIDLVGKFR 96
380 3.000e-11UniRef50_G0J554 Uncharacterized protein n=18 Tax=Cytophagales TaxID=768507 RepID=G0J554_CYCMS  ali  26  1MKNINLGIQIVPKSKNQDSYQLVDKAIAVIAASGVKYEVTPFETVMEGPEEKLMAIAKAAQEVLSAGAEEILVYYRMQIRADKVSMDEKTLPHK 96
381 3.000e-11UniRef50_UPI0009EAD106 thiamine-binding protein n=1 Tax=Bifidobacterium aesculapii TaxID=1329411 RepID=UPI0009EAD106  ali  26  47..NTVAAIQVSVTGAGSEVSPYVSQAIEVIRDSGLPQETNALFTDVEGDLDEVLHVAGEAAKKLAGQGYRTSLVLHMDIRPG............ 126
382 3.000e-11UniRef50_A0A1G6P3E8 Uncharacterized protein, MTH1187 family n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1G6P3E8_9BACT  ali  28  1....MVSFAIFPTDKGISVSEYVSKVVENVRSSGFSYKLTPMSTIVETNMEEALQIVNESYQILKPHSERIYLSLTMDIKHEGSRMEQKIQSV. 91
383 4.000e-11UniRef50_A8AAD3 Uncharacterized protein n=1 Tax=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) TaxID=453591 RepID=A8AAD3_IGNH4  ali  21  3....LVEYQVLPLGTSPSVSDLVAEAVDVIRKRNLEFRVTPMGTVVKPSLEEAGALAQEIVERLDKGVKRVVMVMRADVRFDKLDMDKKVEAV. 95
384 4.000e-11UniRef50_A0A133V6E9 Uncharacterized protein n=2 Tax=unclassified Euryarchaeota TaxID=33867 RepID=A0A133V6E9_9EURY  ali  22  2...IIAELKIVPLGVGTSLSSYVSKAVKEIKNSGVEYQVHATGTVIEPSVEKVLKVTRKAHKVLEAGAPRAITTLTFDERTDKEKMSDRVKK.. 94
385 4.000e-11UniRef50_A0A1I7G462 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1I7G462_9FIRM  ali  31  2..NTSVAIQVLPTTTEEEVIRIVDTVIDYIKSTGYNYYVGPFETTIEGDYDGMMEIVKNCQLVAAAGCPAMSTYVKIAYKPEGLTIDKKVTKHH 97
386 4.000e-11UniRef50_F8EXA0 Uncharacterized protein n=1 Tax=Treponema caldarium (strain ATCC 51460 / DSM 7334 / H1) TaxID=744872 RepID=F8EXA0_TRECH  ali  28  12.....MAIQCLPMGTKAETYAVVDSVIQMIQASGLSYEVGPFETVIEGPLPQLLELAGQVHAHMEQGVSTAASYIKLWSGTNMGTTEEKVGKYR 103
387 4.000e-11UniRef50_A0A232M1K3 Uncharacterized protein n=1 Tax=Elaphomyces granulatus TaxID=519963 RepID=A0A232M1K3_9EURO  ali  16  15...CTADFSLIPIDKSTSYSQQIADVQRLIQKSGLKFMMHSTGTTTEGPWDQVAQVIGWAHSLIHQGIARIQTDIRISTRTDKQSMEGNVAAV. 150
388 4.000e-11UniRef50_F9MV89 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=F9MV89_9FIRM  ali  37  1MNTTIA-IQVLPVASQEDLLRIVDSVIDYIASTGCNYQVGPLETTVEGDYEELLDIVKEAQLCIRQGADSVKSYVKIFYNPKDLTIDEK..... 92
389 5.000e-11UniRef50_A0A2A9CYS2 Uncharacterized protein YqgV (UPF0045/DUF77 family) n=67 Tax=Actinobacteria TaxID=201174 RepID=A0A2A9CYS2_9MICO  ali  24  1...MLIAFSVAP---TSSASPDVAAAVQVVKDSGLPYRLGSMFTEIEGEWEELMDVVRRACEAAGADAGRVSLVLKADIRPGPGQLDSKIARVQ 96
390 5.000e-11UniRef50_A0A0R1RD92 DUF77-containing protein n=13 Tax=Firmicutes TaxID=1239 RepID=A0A0R1RD92_9LACO  ali  30  1MANAVMAIQVLPEADSTELLRLVDVAIAEIDAAGMSYEVGAFETTIEGDLDNLMKLLHRIQSVTDSGAPRISNYIKLSYAPHILTTDEKLAKYR 98
391 5.000e-11UniRef50_A0A2K5AS11 Uncharacterized protein n=2 Tax=Archaea TaxID=2157 RepID=A0A2K5AS11_9ARCH  ali  24  8.....AEISIIPIGSSTSLSMYIASAIKAIRDSKRYHEVTGMGTLVEEDMDALFRAVKAARDIVEHGVKRVEILVRIDERFDKKSLREKVEAVQ 101
392 7.000e-11UniRef50_A0A017S1K4 Uncharacterized protein (Fragment) n=1 Tax=Aspergillus ruber CBS 135680 TaxID=1388766 RepID=A0A017S1K4_9EURO  ali  14  6.ANCIAEFSLIPIGSNVFFAQQIADIQRLMQQSGLKYQVHATGTTIERPWDQVSQIIGFAHTIHHQGIVWIQTDIQI................. 87
393 7.000e-11UniRef50_A0A2T2RBX0 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2T2RBX0_9ACTN  ali  16  1...MMAWFSVTPVGTSPSVTAEVARAVDAVHATGVAASTDAAGTLIEGTWEECTAGLRAACDAVLESAERVSVVAKLDVRTDRQTAADKLAA.. 92
394 7.000e-11UniRef50_A0A1G2Z5V4 Uncharacterized protein (Fragment) n=1 Tax=Planctomycetes bacterium RBG_13_63_9 TaxID=1801965 RepID=A0A1G2Z5V4_9BACT  ali  24  1............................IIARSGLDYRCHAMGSSLEGEFDQVIDVVRQCFQAMAEDCDRIECSVKLDYRKGHQRLESKVASV. 66
395 7.000e-11UniRef50_R6QNX3 Uncharacterized protein n=7 Tax=Terrabacteria group TaxID=1783272 RepID=R6QNX3_9FIRM  ali  32  2..KASVAIQVLPVSNEDELIRIVDEVIAYIKSTGLNYYVGPFETTIEGEYDELMEIVANCQKAIKAGCPSVSAYIKVVYNPEGLTIDKKVTKHH 98
396 8.000e-11UniRef50_UPI000839260D thiamine-binding protein n=2 Tax=Peptoniphilus TaxID=162289 RepID=UPI000839260D  ali  31  2..KASMAIQVLPMGGTEEVVRIVDEVIAVIKDSGLKYVVAPFETTVEGDMDEIIDLLRKCAKVMEEGANSVYCYVKLSHGKEILTIDEKIGKYQ 98
397 8.000e-11UniRef50_A0A101IX74 Uncharacterized protein n=1 Tax=Synergistales bacterium 54_9 TaxID=1641385 RepID=A0A101IX74_9BACT  ali  21  1MGKVVAEVIIVPYGTGTSLSRYVADVERVLKSYNLKTMLTPMGTILEGDLDSVLEAVKAAHQVH.............................. 65
398 8.000e-11UniRef50_A0A0Q6UUY6 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=A0A0Q6UUY6_9ACTN  ali  24  1...MIVAFSLSPVAQDPSVTEAVAAAVRVVRESGLPHETNAMFTNIEGEWDEVMAVVKRAVDVVAAVSPRVGLVLKADIRPGDGQLTAKVER.. 92
399 9.000e-11UniRef50_A0A060SGJ1 Uncharacterized protein n=13 Tax=Agaricomycetes TaxID=155619 RepID=A0A060SGJ1_PYCCI  ali  17  19...............EPSVAEYVAECVRVLEKTGLKFRIRDQSGYVEGPWSEVMQAIHACHAAVHAGAPRIATDIRIGTRVDRTGNEGKVKRV. 111
400 9.000e-11UniRef50_A0A1Q8BGH9 Uncharacterized protein n=2 Tax=Archaea TaxID=2157 RepID=A0A1Q8BGH9_9CREN  ali  21  13....IAEFSIHPIGAGTSVGQYVKAAVRAMSEPGLTLDVTPMSSVLEAEIGTILEAVEVSHRILRMGAKRISSSLRIDERLDKRKMSDKTK... 103
401 1.000e-10UniRef50_A0A1G1PXV4 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=A0A1G1PXV4_9BACT  ali  18  2...ALMEISVVPIGTSTSISKYVAASEKALKKSSVKRQITAMSTIVEASVAKLFAVAKKMHEKLAAGAKRVITNIVLDDRRDKKSSETKVASV. 96
402 1.000e-10UniRef50_E8R9R4 Uncharacterized protein n=4 Tax=Desulfurococcales TaxID=114380 RepID=E8R9R4_DESM0  ali  25  2..KLILTLRVTPIGTTTSLSDYVAEVERVFESLGLKHVLTASATIIENNVEEVSEILKAVIDVLHKGVRRILIDLSIDYRVDKLSIEGKVASV. 96
403 1.000e-10UniRef50_A0A134AHN4 Uncharacterized protein n=3 Tax=Peptoniphilus TaxID=162289 RepID=A0A134AHN4_9FIRM  ali  28  16..KASMAIQVLPVGGTKEVVRIVDEVIKVIQDSGLHYVVAPFETTVEGDMDEIIELLRKCAKVMEEGADSVYCYVKLSHGKEILSIDEKIGKYQ 112
404 1.000e-10UniRef50_A0A2N9L7C8 Uncharacterized protein n=1 Tax=Candidatus Sulfotelmatomonas gaucii TaxID=2043161 RepID=A0A2N9L7C8_9BACT  ali  16  14...MLLELSVLPKGKGRHATDTPATLAKIINSSGLYHQAKNKGTVLEGSWDQLMAVAKKCHDEALKSNSRIVTVMR.................. 86
405 1.000e-10UniRef50_A0A0E9EVY8 Uncharacterized conserved protein n=1 Tax=Chlamydia trachomatis TaxID=813 RepID=A0A0E9EVY8_CHLTH  ali  17  2.......................AEAEKILMAEGVKYKLNPMGTVIEASADKALEVIRKMQESFDKGCDRVYTVIKMDDRRDKKTMEQKIKSV. 73
406 1.000e-10UniRef50_A0A1I6KSB5 Uncharacterized protein, MTH1187 family n=1 Tax=Halomicrobium zhouii TaxID=767519 RepID=A0A1I6KSB5_9EURY  ali  24  2..TCIGFLSVAPVVEG-SMAEYVADAVDALEDFDVSYETTPMGTIVEAEDSDLFDAAHAAHE--AVDADRVETFLKIDDRTVDQSAAEKVDAV. 91
407 2.000e-10UniRef50_X0WJG8 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0WJG8_9ZZZZ  ali  22  3...............................RKDLSYQLTPMGTVIEGSLDVVLEVTRQMHEPFEKGASRVITTLKVDERRDKSTMAGKVESVR 67
408 2.000e-10UniRef50_A0A0F7HLV1 Uncharacterized protein n=16 Tax=Staphylococcaceae TaxID=90964 RepID=A0A0F7HLV1_9STAP  ali  31  4....IMAIQLLPHHPEKSYYEHVAGSIEIIEESGLTHFVGPMETTVEGSIDELMNLVKKLNRHLEEGCDQVTSNIKLIQSEKPIKIKEILSDY. 94
409 2.000e-10UniRef50_A0A1F6B3M5 Uncharacterized protein n=2 Tax=Patescibacteria group TaxID=1783273 RepID=A0A1F6B3M5_9BACT  ali  36  1MLTASIAFQVMPKADQKKIIEIIDKVIETVKTSGIKYEVGPMETTMEGELDALMEIVRKAQYSIQAGAANVFTNVKILYDPKGVTIEEKVTKHR 97
410 2.000e-10UniRef50_S3B1N2 Uncharacterized protein n=1 Tax=Streptococcus sp. HPH0090 TaxID=1203590 RepID=S3B1N2_9STRE  ali  26  2..KASIALQVLPLSQGIDRIAVIDQVIAYLQAQSVTMVVTPFETVLEGDFDELMRILKEALEVAGQGADNVFANVKINYRRD............ 84
411 2.000e-10UniRef50_A0A1N7MH28 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=2 Tax=Belliella TaxID=232244 RepID=A0A1N7MH28_9BACT  ali  25  5.HIINLGIQIVPKSKNLDSYALVDKAIEVIQNSGVNHVVTPFETVMEGEQEELMKIAMDAQEVLAAGADEVLIYYRMQIRKNKVYIVDKTGKYQ 99
412 2.000e-10UniRef50_A0A2H5ZDA3 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5ZDA3_9BACT  ali  24  1...MIAEIQCLPTPAGNEARPYAVIEAAIAARSGLRTEVGALGTTVEGPADAVWAAVRAAHECLRAGAERVVTIVKVETREGGPTIDALTGRYR 95
413 2.000e-10UniRef50_A0A098Y450 Uncharacterized protein n=2 Tax=Geodermatophilaceae TaxID=85030 RepID=A0A098Y450_9ACTN  ali  23  4..QVIAEIQVAPSGTPDDPHAFVEAAIRVIQASGLRSEVGALGTTLEGDADTVWATLRAAHDAMAAGAKAGISHVKIASV--DRTMDSLTHKFR 96
414 2.000e-10UniRef50_D5T0D0 Uncharacterized protein n=20 Tax=Lactobacillales TaxID=186826 RepID=D5T0D0_LEUKI  ali  26  5..NASIAVQVLPMTADEDIIRIVDHVIAYIEASGVTYQVGAFESTLEGDYDKLMTVLKALPLVAAEITDPVMLYTKINMVPNGLTIAQKTDKY. 99
415 3.000e-10UniRef50_G4D391 Uncharacterized protein n=20 Tax=Bacteria TaxID=2 RepID=G4D391_9FIRM  ali  31  2..NCALALQTLPVESDEEVVRIVDEVIAYIDSTGLEYYVGPFETTVEGDLEQIMEIIKFSQKAIEAGAPSVSSYIKLVYSPEKLTTDEKISKYH 97
416 3.000e-10UniRef50_A0A261F397 Uncharacterized protein n=7 Tax=Terrabacteria group TaxID=1783272 RepID=A0A261F397_9BIFI  ali  27  5MNNCSIAIQVLPM-KVADYIPDIDRVIYYLQEHFPDARVTPFETVIEGEYEECMDALRQCALIAAEGSDDIIVNAKIAY-GQILTSEEKTAKFQ 97
417 3.000e-10UniRef50_A0A239GXM8 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=1 Tax=Ekhidna lutea TaxID=447679 RepID=A0A239GXM8_9BACT  ali  27  6...IQLAIQVVPLERDGDTYQKIDAAIDVIQRSGVQYMITPMETVMQGPYEKLQEVARDAQEALAAGCKEFLVNIKMHVRLDHVTMEEK..... 93
418 3.000e-10UniRef50_A0A0G4EZ34 Uncharacterized protein n=2 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EZ34_VITBC  ali  33  1.....MSFQIVPIEDEAKQYKMIDEVIDMIKSSGVKAEVGPMATCVEGSMDQVLEIVKKAHTMLEKGCSRVLSHVSIDTKKGGVSMASKMK... 89
419 3.000e-10UniRef50_D4YKD7 Uncharacterized protein n=6 Tax=Actinobacteria TaxID=201174 RepID=D4YKD7_9MICO  ali  25  1..................MHDAVVEAVKVVGASGLPHCTDAMFTTFEGEWNEVFAVVKETTEAVARFSSRVSLVLKADIRDGRTGLDGKLER.. 75
420 3.000e-10UniRef50_A0A0R2B8K6 Uncharacterized protein n=2 Tax=Lactobacillus collinoides TaxID=33960 RepID=A0A0R2B8K6_LACCL  ali  27  33MANAVMAIQVLPKADSTEMLRLVDVAIAEIDASGLSYEVSAFETTVEGDLDDLIKLLHKIQSVTESGAASISNYIKLSYAPEILTTDEKLAKYR 130
421 4.000e-10UniRef50_D5U0Z3 Uncharacterized protein n=1 Tax=Thermosphaera aggregans (strain DSM 11486 / M11TL) TaxID=633148 RepID=D5U0Z3_THEAM  ali  23  2..KVLAVIRVIPIGTGPSIGDYVREAVKIIKNRGIKYQVTPFGTAIESSIAEVATLIDEIVERMRNGVSRIAVDVSFDIRFDKLSLEYKVKRV. 96
422 4.000e-10UniRef50_A0A1Q9NJP5 Uncharacterized protein n=2 Tax=Candidatus Heimdallarchaeota TaxID=1936272 RepID=A0A1Q9NJP5_9ARCH  ali  22  10..KVIAELTYSVIGPETSVSKYIKKAVKVIDSSEIKTLHHPMGTIIEDDIDTIFKVVKKGHEAFDEGIQRVMTRLTIDDRRDKTRMEDKVSALK 106
423 5.000e-10UniRef50_G8U1L5 Uncharacterized protein n=8 Tax=Clostridiales TaxID=186802 RepID=G8U1L5_SULAD  ali  24  1MP--VVEVKVLPIGTDESISSYIRDCYAIADSAGVNVTLTPTSTILEGSLANIFPVVEAMHRPFYHGADRVVTTMTIDDRQDKLDMVSLVTSV. 95
424 5.000e-10UniRef50_F4B9V3 Uncharacterized protein n=7 Tax=Sulfolobales TaxID=2281 RepID=F4B9V3_ACIHW  ali  22  1MNSMLVDISVEPIGTDTSISRYVKLVYEVLKAKGIKFYPAPMTTLEIDDITQLGYIIKDIDDTLAEGVKRIVTIMKIDDRRDKESIEHKLEVIK 100
425 5.000e-10UniRef50_A2BLP5 Universally conserved protein n=2 Tax=Hyperthermus butylicus TaxID=54248 RepID=A2BLP5_HYPBU  ali  26  1MPTVS--IKVIPIGVGPSLSRYIARVVALLEAKGYKPLVTPDTTVIVNDVSEIGPLVRMIHDELYMGVARVLTIIMIDERRD............ 82
426 6.000e-10UniRef50_A0A0V8RWL2 Uncharacterized protein n=3 Tax=Pyrodictium TaxID=2308 RepID=A0A0V8RWL2_PYROC  ali  26  3....IVSLKVMPMGVGTSVSRYIARVVALLEAHGYKPEVTPDTTVIVSDLSEVGAIVRMVHDELYMGVPRVVTIVMIDDRRDEASPEEMVQKV. 95
427 6.000e-10UniRef50_UPI00068457A8 hypothetical protein n=2 Tax=Bacillales TaxID=1385 RepID=UPI00068457A8  ali  30  8.....................YVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQSLNERMVEECPSIISQVKFYHVPDGITIETLTEKY. 80
428 7.000e-10UniRef50_A0A256Y131 Uncharacterized protein n=1 Tax=Archaeoglobales archaeon ex4484_92 TaxID=2012529 RepID=A0A256Y131_9EURY  ali  21  1...MIVEISVIPLGV-TSLSKYIAQIIKILDEENIKFEINPMGTVFVSKFAELGKILERIDDVLKMGSIRNYYVIKIDTKND---MDRRVKSV. 88
429 7.000e-10UniRef50_A0A1Z5SCJ3 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium IBVUCB1 TaxID=1985173 RepID=A0A1Z5SCJ3_9BACT  ali  25  3.HNVNLAIQVLPVHPQPEAYAIVDAAIDCIKASGLQYVVCPFETVIEGSYEQVMKLVDDIQTACNAGAQSLLINMKLQRSVKDIAIDDKIGKYK 98
430 1.000e-09UniRef50_A0A2R6G9U8 Uncharacterized protein n=1 Tax=Halobacteriales archaeon QS_1_68_20 TaxID=1919169 RepID=A0A2R6G9U8_9EURY  ali  18  2..SVIARFEVIPVQEG-SMSTAIAEALRALDRHPVSYRTTPTDTIIEADTAQIFAAVRDAHRAIPD--ERVITSVEVDDRRRPQDMGERVASV. 91
431 1.000e-09UniRef50_A0A2U3EJM7 Uncharacterized protein n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3EJM7_9HYPO  ali  19  623.......VCVLCVGTGKSVAEEVAEVQRVLQASGLKYTMHSAGTTVEGNWDEVLAVVGKAHTVHRRGVVRVQSSMRVGSRTDKQTAEDKVKRV. 730
432 1.000e-09UniRef50_W7I564 Uncharacterized protein n=1 Tax=Drechslerella stenobrocha 248 TaxID=1043628 RepID=W7I564_9PEZI  ali  23  27.AHVTADFCLIPIGTTASVSQYIASVQKLLATSGVKYSMHSAGTTLEGTWDE.......................................... 78
433 1.000e-09UniRef50_A0A2P8QYG2 Uncharacterized protein n=1 Tax=Campylobacter blaseri TaxID=2042961 RepID=A0A2P8QYG2_9PROT  ali  23  2..SVVVSFSIFSLYGDKSKAEEIAKVHKVLKELNVKCELNAMNSVFETELKEAFFILEKCNEAL-SDYKRVYLNANFDIKNEKLRIKQKVKSV. 94
434 2.000e-09UniRef50_A0A2M7BJL7 Uncharacterized protein n=2 Tax=Syntrophobacterales TaxID=213462 RepID=A0A2M7BJL7_9DELT  ali  24  3...ISAQISLYPLGK-ESLSEDISEFVKILRAKGLQCEVGKMSTILYGEADAVFDALKEAYSYLASRGACVMIS.................... 72
435 2.000e-09UniRef50_A0A2W2B265 Thiamine-binding protein n=1 Tax=Taibaiella soli TaxID=1649169 RepID=A0A2W2B265_9BACT  ali  27  3.HTVNLAIQMLPLRPKEETYRIVDVAIAEINKSGLKYVVCPFETVVEGPYNEVMQLLENIQACTEAGADEFIINMKLHRAAEDMKIDDKIGKYK 98
436 3.000e-09UniRef50_A0A2A3TAH6 Uncharacterized protein n=2 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2A3TAH6_9ARCH  ali  20  2...IQAEISIYPMATTTSASFYIAKAIESIQNENLRYEINSMGTILESDMDVINNAAKKMMETVHNGIDRVEVIIKIDSRRDKLKMEEKLDSIK 97
437 3.000e-09UniRef50_A0A2K2VHY8 Uncharacterized protein n=28 Tax=root TaxID=1 RepID=A0A2K2VHY8_9HELI  ali  17  10..............DGSSVSKHVIKIIDAIDKSGVAYQLTPMGTVIETEMKEALAIIELAYEQL-KDCERVYSSLKFDIRHNKNRLKTKIASV. 89
438 3.000e-09UniRef50_Q5E4V9 Uncharacterized protein n=127 Tax=Proteobacteria TaxID=1224 RepID=Q5E4V9_ALIF1  ali  29  11...VFVAFQVIPRLKEGNNFEVVDKAIEVVKAANVPYQVGAMETTMKGELNYLLEVVKKAQQCYDAGALEVITNIKIHSKTEAAT......... 93
439 3.000e-09UniRef50_R1D4V6 Uncharacterized protein n=2 Tax=Emiliania huxleyi TaxID=2903 RepID=R1D4V6_EMIHU  ali  26  4....IADIQVVPTGTEADCFKHVNAAIAVITASGLKHSVGALGTTVEGRADAVWRVAREAFDCLKSGAEKELMYLKL-YRGDHT.......... 85
440 3.000e-09UniRef50_A0A0B4CVF2 Uncharacterized protein n=343 Tax=root TaxID=1 RepID=A0A0B4CVF2_9MICO  ali  26  1...MLVAFSVAPSGTDGSVHDAVAAAVKVVRDSGLPHRTTSMFTEIEGEWDEVFAVVKAATDAVMPFGSRVSLVLKADIRPGR........... 88
441 4.000e-09UniRef50_A0A0T8CM06 Uncharacterized conserved protein n=6 Tax=Firmicutes TaxID=1239 RepID=A0A0T8CM06_STREE  ali  38  1.............................MQQSGVRYEVGAMETTLEGELDVLLDVVKRAQQCVDAGAEEVITSIKIHYRPSGVTIDEKVWKYR 67
442 4.000e-09UniRef50_A0A0X8F8L6 Uncharacterized protein n=6 Tax=Bacilli TaxID=91061 RepID=A0A0X8F8L6_9LACT  ali  26  2..HCSIALQILPYVDEKKLLEVVDKVIRYLESSPENITVSPFETTLQGDYDDLMALLKKAIQLAGEDGVEIFANVKVSYKGDVLTIEDKLSPYR 98
443 4.000e-09UniRef50_K2EUT4 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2EUT4_9ZZZZ  ali  35  1..................MIKIIDKVILMIKKSGVNYEVGPMETTMEGDLETLFQIVKKAQLCIKEGAANVFTNVKIIYNPKGVTIEQKIRKHR 78
444 4.000e-09UniRef50_A0A288QY08 UPF0045 protein n=1 Tax=Weissella soli TaxID=155866 RepID=A0A288QY08_9LACT  ali  29  1MANAAMAIQVLPNTTDTKLLEIVDAAIAAIDASGLNYEVGAFETTIEGDLDQLVALIPAIQASVAAGAEMINNYIKLAYAPEKLTTDEKLDKYR 98
445 4.000e-09UniRef50_A0A1Y2J4Y6 MTH1187/YkoF-like protein n=1 Tax=Trametes coccinea BRFM310 TaxID=1353009 RepID=A0A1Y2J4Y6_PYCCO  ali  16  13...AVADFCLVPMGTGE---PSVAD---------------GYGTNLEGPWTEVMQAIHACHAAVHAGAPRIATDIRIGTRVDRTGNEGKVKRV. 90
446 4.000e-09UniRef50_A8Q3N9 Uncharacterized protein n=11 Tax=Ustilaginomycotina TaxID=452284 RepID=A8Q3N9_MALGO  ali  14  37.........VIPIGTTTSVGAYIAECQRVLADEGIHFEVHGYGTNVEGPISAVWRALQRCHEAVHAGVERIATDIRLGTRTDKQ.......... 128
447 4.000e-09UniRef50_UPI000D7807C1 hypothetical protein n=1 Tax=Pseudomicrostroma glucosiphilum TaxID=1684307 RepID=UPI000D7807C1  ali  12  18.......VAVIPMATTPSVGIYIAECQRVLESMKAEG-INGYGTNLEGPFPLVSKAIERCHEAVHKGAPRIATDIRLGTRVDKL.......... 95
448 5.000e-09UniRef50_M0MJH9 Uncharacterized protein n=30 Tax=Halobacteria TaxID=183963 RepID=M0MJH9_HALMO  ali  25  2..TVTASLSISPVDDSDDFDAEVAAAIEALEDCDVRYETHPMETTLEANLDAVFNAAQVATE--AVDARRVATTLKIDYREESLAVEEKVDRV. 93
449 5.000e-09UniRef50_U2FJR2 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=U2FJR2_9BACT  ali  33  2..NASIAIQTLPFLEGEEMYSVIDEVIAYIKKQELVYEVGPFETTIEGELSQLIKIIEDVTRCVEKGAKSVLSYVKIHYSEEGVSISEKVEKHR 98
450 6.000e-09UniRef50_A0A2V2UGN3 Uncharacterized protein n=1 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2V2UGN3_9ARCH  ali  15  11.....AEISIVPVGTGTSISKEVAAAFEAIRKTKNTTKLTAMGTQIERNMRAILNAIEAAHEAVKSGAKRIISTIRIAERLDARRLEDEIESV. 104
451 6.000e-09UniRef50_A0A075AWR1 Uncharacterized protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075AWR1_9FUNG  ali  23  3...VIADITFLPIQKDKPTSDYIKACLKTFDRYSLISNVHAQGTNVEGEFDEIMKAVKDCFAVINMGCENIASFIQLTFAANKLSIQSRLSKVK 97
452 8.000e-09UniRef50_A0A0L6UTH7 Uncharacterized protein n=1 Tax=Puccinia sorghi TaxID=27349 RepID=A0A0L6UTH7_9BASI  ali  16  1......................................MHGYGTGLEGPWDDVMNAIKACHEAVHEGCPRVATDIRIGTRMDKQSLSQKVESV. 57
453 9.000e-09UniRef50_A0A2T0WNA3 Uncharacterized protein YqgV (UPF0045/DUF77 family) n=7 Tax=Bacteria TaxID=2 RepID=A0A2T0WNA3_9BACT  ali  26  4.KIINLGIQIIPKSQTLDAYALVDKAISVIQQSGVKYVVTPFETVMEGKQEQLMAVAMKAQDVLEAGADEVLVYYRMQIRKNDVIIEDKIGKY. 97
454 9.000e-09UniRef50_A0A2D0MWD9 Uncharacterized protein n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0MWD9_9BACT  ali  35  40MPNVNLSLQIVPINTQD-AYPVIDEAIYAIQRSGVKHEVQPFATLMEGELSELWQAVDAKAAALEAGAEELILNIQVHLKKDKVALTEKTEKFR 136
455 1.000e-08UniRef50_A0A101E9U7 Uncharacterized protein n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A101E9U7_9FIRM  ali  24  1MPSC--QFSLYPLGTGD-LSPIIDKALEQLKDMGLQYEMGNMSTVFYGSSEEVFTALKRMYEAVSMHP--VVMNFTVS................ 73
456 1.000e-08UniRef50_A0A2D5NBX8 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2D5NBX8_9FLAO  ali  30  1MDLLSANIQYIPLHAEDPM-KAVDEAIALIQSAGISYEVGAFGTSVEGNADVVKDLIHNLLK--SAISKEFLLNVQYHVGGDKLSNEEKVAKFR 91
457 1.000e-08UniRef50_D3LNT9 Uncharacterized protein n=157 Tax=Terrabacteria group TaxID=1783272 RepID=D3LNT9_MICLU  ali  21  1...MIVAFSVAPSGDTASVHXXXXXXXXXXXXSGLPHRTSSMFTEIEGEWDEVMEVVRAAVDAVSPYGSRVSLVLKADIRPGH........... 92
458 1.000e-08UniRef50_A0A0D5C3D7 Uncharacterized protein n=3 Tax=Nitrosopumilus TaxID=338191 RepID=A0A0D5C3D7_9ARCH  ali  19  2...IQAEVSIYPMATTTSASFYIAKAIESIQKENLRHQINPMGTILESDIDVINGAVKTMMETVHNGIARVEVVIKIDSRRDKVKMEEKLDSIK 97
459 1.000e-08UniRef50_A0A0W7W5R5 Uncharacterized protein n=3 Tax=Leucobacter TaxID=55968 RepID=A0A0W7W5R5_9MICO  ali  24  3...IHVHVSPTPMGDENGRYSCVEGAIRVIEQSGLEYEVGALGTTVQGPAEQLWPLMRDLHDTLAAGADRVMTHIRILEAKDDV.......... 84
460 1.000e-08UniRef50_A0A0Q0WCQ7 Uncharacterized protein n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0Q0WCQ7_9DELT  ali  21  2...VIAQLTMFPTDQGISVGSYVKKAVDRIRESGVKVIPGAMSTFETETLEEVFSIVQAARDELSKGCKRIYLSLTVDERVDKPSMETKINR.. 93
461 2.000e-08UniRef50_K0BC66 Uncharacterized protein n=31 Tax=root TaxID=1 RepID=K0BC66_9ARCH  ali  20  2...IQAEISIYPMATTTSASFYIAKAIESIQKKNLRYEINAMGTILESDIDTINSATKQMMETVHNGIARVEVIIKIDSRRDKAKMEEKLESIK 97
462 2.000e-08UniRef50_A0A222MWI7 DUF77 domain protein n=1 Tax=Campylobacter avium LMG 24591 TaxID=522484 RepID=A0A222MWI7_9PROT  ali  19  2..SVIMELCVFSISGSLSKSKEVKAILQAFDKRGIKYELNPMGTCVECNMKKATKILRLASKSI--DAQRFYIVAKFDYKGRKKSMQDKVKSVK 93
463 2.000e-08UniRef50_E3DN49 Uncharacterized protein n=2 Tax=Halanaerobium praevalens TaxID=2331 RepID=E3DN49_HALPG  ali  26  9..KAAVDIQCLPLGAKEEIYALVDQAIKVIEKAGHDYTVSAFSTTIEGDLEEIWATALEAHLAVQKAAGSVISYLKLATGPELGTTAEKLAR.. 101
464 2.000e-08UniRef50_A0A2P6VZ73 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon SW_10_69_26 TaxID=1919232 RepID=A0A2P6VZ73_9EURY  ali  30  14........................ETIEVLEDGGLEHEVGPSGTTILGGWDEGMATLERCNEALGAPETRVNTVIEVDAKPDPGDIEAKVDR.. 83
465 2.000e-08UniRef50_A0A2H6JY06 Uncharacterized protein n=1 Tax=archaeon BMS3Bbin15 TaxID=2005738 RepID=A0A2H6JY06_9ARCH  ali  21  2...ITAEVIFIPIGTSTTLSRYIKAAIEAMNDSEVRVYPRAMATELEDDLETLFSAIKKGQEIMNMGVKRVVVSLKIDIRIDKASLEKKIDS.. 94
466 2.000e-08UniRef50_S0ASB0 Uncharacterized protein n=3 Tax=Ferroplasma TaxID=74968 RepID=S0ASB0_FERAC  ali  17  2...IIADVTFYPIGKGVSVGDTIEKVVSRLKNNNIKCYPNSMATVIECNIDILMDAVKDAEKFIEMGFPRVETILRIDSRTDENSVERKMKYV. 95
467 2.000e-08UniRef50_UPI000D7FB107 hypothetical protein n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D7FB107  ali  17  5...AVADFCLIPMGTGTSVGAYIAECQRVLESLKVTYEVHGYGTNLEGPFEAVSKAIELCHEAVHK............................ 73
468 2.000e-08UniRef50_A0A0G4KFE0 Uncharacterized protein (Fragment) n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4KFE0_9PEZI  ali  14  3............VGTGVSVAKEVAEVQKLLKASGLHYQMHSAGTTVEGSWDDVFRVVGQAHALVHAGGVRVQSSMR.................. 68
469 2.000e-08UniRef50_A0A059II04 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A059II04_9RHOB  ali  28  13.....LAFQVIPRVRTGNNYEVVDRAIDVVKNANVPFVVGAMETTMRGELDQLLEIVKAAQQCLDHRAVEVITNIKIHT............... 87
470 3.000e-08UniRef50_A0A069ALF5 Uncharacterized protein n=1 Tax=Clostridioides difficile TaxID=1496 RepID=A0A069ALF5_CLODI  ali  36  14....................................CEIGAMSTTVEGDFDEVFELLKKVHKPFNLGCERVITVARVDEKAGGLTIDEKLRNHR 72
471 3.000e-08UniRef50_U1QU61 Uncharacterized protein n=3 Tax=Alloscardovia TaxID=419014 RepID=U1QU61_9BIFI  ali  28  14.NNCSIAIQVLPM-KVADYLPDIDRVIYYLQDRFPQARVTPFETVIEGEYEECMDALHQCALIAAQGSDDIIVNAKIAY-GQILSSEEKTSKF. 104
472 3.000e-08UniRef50_E1L205 Uncharacterized protein n=2 Tax=Atopobium TaxID=1380 RepID=E1L205_9ACTN  ali  28  2..QCSVAIQFLPMHSNDDVCAYVDKVIAYIASTGVKYYVAPFETTIEADLETCMRIIATCPKIGEQGCAHSMMYVKVDYDAHDTTSEQKLKPY. 97
473 3.000e-08UniRef50_A0A2E2ZQW7 Uncharacterized protein n=1 Tax=Sphingomonas sp. TaxID=28214 RepID=A0A2E2ZQW7_SPHSX  ali  17  2..KITADIRVQPVKFTTSASKMVAGHKAAFEAAGVSALPHAMGLNVQGEAGTVLGVLREILATMHSDGERAYTSITIESRADPPSIQEKIKSIQ 95
474 3.000e-08UniRef50_A0A1Y2ASD8 Uncharacterized protein n=3 Tax=Rhizoclosmatium globosum TaxID=329046 RepID=A0A1Y2ASD8_9FUNG  ali  12  4....VADFTLSPMGVGPSVSSYIALVKQVLDTQKVEYTMHSNGTNLTGEWDAVLEVVKQCRDVVHVGVARVGCSVSM................. 82
475 4.000e-08UniRef50_U7UIB8 PF01910 family protein n=2 Tax=Peptoniphilus TaxID=162289 RepID=U7UIB8_9FIRM  ali  28  2..KISIAIQVLPTTKEASVVEVVDKVIEYIESQKVNHIVTPFETVIEDDFNKAFEILKNCVKLAGDLSEQVACYSKIFYSEGILTIDEKIGKYQ 98
476 5.000e-08UniRef50_A0A2H6B8F9 Uncharacterized protein n=1 Tax=bacterium HR41 TaxID=2035436 RepID=A0A2H6B8F9_9BACT  ali  27  1..................................MRFRLHAMGTELEGETDDILAVVAEIHRPFELGYPRVYTVLKLDERRDRQTLDDKVASV. 62
477 5.000e-08UniRef50_A0A1Q3XAP0 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 46-16 TaxID=1895925 RepID=A0A1Q3XAP0_9BACT  ali  26  2MHTVNLAIQVLPLNEQAEAIRIIDVAIARIQQSGLKHVVCPFETVIEGYYPDVMKLLDDIQDCYMAGAETLIINMKLHSAVKDLHISEKTGKY. 97
478 5.000e-08UniRef50_H3ZL79 Uncharacterized protein n=3 Tax=Thermococcales TaxID=2258 RepID=H3ZL79_THELN  ali  22  3...VIIEFVIVPLG-ELSLSKYIAHVVKLLEGKRVKYQLTPMGTIIEPTLREGLKIVEEAHEAMFAGAKRVSTTRIDDRRDKDRKMEDKVKSV. 94
479 8.000e-08UniRef50_U1PRP0 Uncharacterized protein, MTH1187 family n=7 Tax=Archaea TaxID=2157 RepID=U1PRP0_9EURY  ali  23  13..SVIALLSVAPV-IEESMASHVADAVAALDEFPVSYETNPMGTVIEADDTETL-FAAAQAAHDAVDADRVSTVLKIDDRARETTAQEKVDAV. 102
480 1.000e-07UniRef50_A0A1V0U1M4 Uncharacterized protein n=2 Tax=Streptomyces gilvosporeus TaxID=553510 RepID=A0A1V0U1M4_9ACTN  ali  24  56.........................VVAQIRTRRRYQKADSMYTMIEGEWDEVMDVVKRATEAVAAKAPRVQLVLKADIWPDIQHLDGKIA... 122
481 1.000e-07UniRef50_A0A238WUU3 Uncharacterized protein, MTH1187 family n=7 Tax=Halobacteria TaxID=183963 RepID=A0A238WUU3_HALVU  ali  18  2..TVVALLSVAPVIEG-SMSGEVAKAVAALDEFDITYETNPMGTVIEADDIDTL-LAAVAAAHKAVDGDRVSTYLKVDDRTAETTAADKVAAV. 91
482 1.000e-07UniRef50_X1GS86 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1GS86_9ZZZZ  ali  25  2..................................MSYKLGPMSTSIEGEWDEVFGVIKKCRDAMRKHSNRVYIVIAVDDRAGAVRLQGKIRSV. 61
483 1.000e-07UniRef50_X1HYK4 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1HYK4_9ZZZZ  ali  23  2...IIAEFAIFPTSEGVSVSKYVKEAIKVIESSGLKHETGGMSTTIEPDLDTLFKIIE.................................... 57
484 1.000e-07UniRef50_UPI00040CE445 DUF1385 domain-containing protein n=1 Tax=Bacillus aurantiacus TaxID=254410 RepID=UPI00040CE445  ali  12  254...ATADISVVPIGDNTSDAEYLAQVKELLTEKSVTWTAYERSIVIEAPSKRLFNVLQAIHDHAKENVERVITTIRVDERRSRES......... 339
485 1.000e-07UniRef50_A0A2R6ISB9 Uncharacterized protein n=127 Tax=root TaxID=1 RepID=A0A2R6ISB9_9EURY  ali  25  2..TVIALLSVAPVVEG-SMAGEVAKAVDALEGFDVTYETNPMGTVIEDDIEELMAAATA--AHTAVDGDRVSTVLKIDDKRGRQRAREKVDAV. 91
486 2.000e-07UniRef50_X1PRH0 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1PRH0_9ZZZZ  ali  18  1................................SGLSFELTPTATVIEGDIDRLFELARKVHEPFRKDVKRVITTIKIDDRRDKTSMKYKKKSV. 63
487 2.000e-07UniRef50_A0A015NL53 Uncharacterized protein n=1 Tax=Paenibacillus darwinianus TaxID=1380763 RepID=A0A015NL53_9BACL  ali  29  1MANALLSIQIIPHTPGESVIPYVDRVIDIIKATGLPYRVAPLETTMEGDMDRLLE....................................... 56
488 2.000e-07UniRef50_G1WYG2 Uncharacterized protein n=2 Tax=Pezizomycotina TaxID=147538 RepID=G1WYG2_ARTOA  ali  28  21..HVTADFCLIPIGTTASVSQHIANIQKMIAASGIKYSMHSAGTTLEGSWEE.......................................... 71
489 2.000e-07UniRef50_A0A2R6K8M8 Uncharacterized protein n=1 Tax=Halobacteriales archaeon QS_8_65_32 TaxID=1919186 RepID=A0A2R6K8M8_9EURY  ali  22  3...IVATLSITPADDG-NFTDEIAAAIGALDDHDVSYEVDPMGTTIEAELSDLLGAVEAAHEAVS--ADRVRTVLQIDDDRERQDGAQRVAAV. 91
490 2.000e-07UniRef50_A0A1E4CRJ3 Uncharacterized protein n=430 Tax=Bacteria TaxID=2 RepID=A0A1E4CRJ3_9MICO  ali  26  38................................SGLPHRTTSMFTEVEGEWDELMALVKAAVDAVQPYGSRVSLVLKADIRPGYTGLDGKIER.. 98
491 2.000e-07UniRef50_D2RPB3 Uncharacterized protein n=13 Tax=Halobacteria TaxID=183963 RepID=D2RPB3_HALTV  ali  23  2..TVIARFEVIPVRDG-SLSDEIAQAIDALDEFDIAYELTATDTVIEAEADEVFEAVHAAHNAVE--SDRIITSLEIDYQSREQDAADRVESV. 91
492 3.000e-07UniRef50_A0A060HWA1 Uncharacterized protein n=2 Tax=Nitrososphaera TaxID=497726 RepID=A0A060HWA1_9ARCH  ali  19  3...VHAEISVIPVTGSTSMGREVALAFDAIRETGVKATLTALGTQIEAEDAVLAAIKAAHAAVKKAGTARIISSVKIDERLDKQSLEAKVRSVK 97
493 3.000e-07UniRef50_A0A099P1V2 Uncharacterized protein n=3 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A099P1V2_PICKU  ali  13  63............IGPIDSIEKALELAKPLLEASGQEYVIHDGGFTIDAEWKDAMTLVGQIHEHLHKGFVRVHSDMRVGTRTDKQTMQDKINVV. 145
494 3.000e-07UniRef50_U1Q2D0 Uncharacterized protein n=1 Tax=Halonotius sp. J07HN6 TaxID=1238427 RepID=U1Q2D0_9EURY  ali  19  2..TVIALLSVAPV-IEDSMASEVAKAVDALDAHDVSYETNPMGTVIEDDIDTLLAAVGDAHK--AVDGDRVSTFLKIDHKR............. 78
495 4.000e-07UniRef50_A0A0J8R8B3 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A0J8R8B3_COCIT  ali  14  11.NHCIADFCLIPIGTSPSVSETIADVERLVEKSGLKFLMHSCGTTLGRYMH........................................... 61
496 6.000e-07UniRef50_A0A2U2NWX4 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2U2NWX4_ENTHR  ali  15  1...MLAAFSITPLGAGDSVGDAVADAVAIVRESGLPNETNAMFTNVE............................................... 44
497 6.000e-07UniRef50_G0W9U9 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  20  7...CLADVCMVPIGTSTSVSDFVASVEIKIRESELKSTLHSAGTTIEGPWDDIMNLIG.................................... 62
498 7.000e-07UniRef50_A0A2E2Y604 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E2Y604_9FLAO  ali  32  2..SISAHVQFVPLQSREPLS-IIDKAINCIKHSGLEYEVGAFGTSIEGERSAIQKLVQQLLSF--DFCDEFLLNVQYHVGNNRLLNLEKVSKFR 90
499 7.000e-07UniRef50_UPI0004830ADA hypothetical protein n=1 Tax=Helicobacter pametensis TaxID=95149 RepID=UPI0004830ADA  ali  13  1MA-VLLELSIFSIHGEISKREEVAKVLRAWERNGIKAHLNAMGSVVEADMQEALKAIEIANSCM--DCRRYYVIAKFDCYPERENMEGRVERV. 92
500 8.000e-07UniRef50_A0A0S7Y249 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0S7Y249_9COXI  ali  23  1MMKVQAEISLYPLRQNE-LTKPIQQFIQALENNKLKVELGPMSTLITGDSQVLFRNLREAFEQLAEEYE-IVMTAKIS................ 76
501 1.000e-06UniRef50_A6D9W2 Uncharacterized protein n=1 Tax=Caminibacter mediatlanticus TB-2 TaxID=391592 RepID=A6D9W2_9PROT  ali  20  2..SVLVEFAMFPTDKGESVSEYVSRIIKMFKESNIYYQLTPMGTIFEVDIEEATQIINNAYK................................ 62
502 1.000e-06UniRef50_A0A2E9PZ85 Uncharacterized protein n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A2E9PZ85_9ACTN  ali  27  25..KAKAEFTIEPF-TEGDPGPHVKETISLAKQSGLSVEIGPFGTTVTGEQDKVFELVSELVKTMSHGASRVSLQIT.................. 98
503 1.000e-06UniRef50_B5IHQ8 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=B5IHQ8_ACIB4  ali  25  2...IIAELTITPLGEGTSVSKFVKEAFKAIRATGLKIELTPMSTVVESSIDDIFRAVK.................................... 57
504 1.000e-06UniRef50_S7REP3 Uncharacterized protein (Fragment) n=1 Tax=Gloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617) TaxID=670483 RepID=S7REP  ali  17  1......DFSLTPVGTGSHISEYIAECYRVLETTGVSYQVSLSKKC------QVCLAMQQCHSVLHQGAPRVCTAVHIETSLTKADSPHKVKKVK 88
505 2.000e-06UniRef50_M0M9C2 Uncharacterized protein n=3 Tax=Halococcus TaxID=2249 RepID=M0M9C2_9EURY  ali  18  2..SVIALLSTTP-ARSENTSEEVAGAVEALGDYDVDPTLTAMGTIIETDDGELFAAVEAAHR--AVDADRVTTKLEIDHERDR........... 80
506 2.000e-06UniRef50_A0A2X4FLX5 Uncharacterized conserved protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2X4FLX5_9CORY  ali  37  1.........................................MFTLVEGEWDEVMAVVKEATEVVAQHSPRVSLVLKADIRRGYTTLSRKVEAVR 54
507 2.000e-06UniRef50_A0A1Y5U1A9 Putative HMP/thiamine-binding protein YkoF n=47 Tax=cellular organisms TaxID=131567 RepID=A0A1Y5U1A9_9RHOB  ali  16  122...VAAQFSLYPLGEGPHM-DEIYGCIDFLKASGTFDRSKNFCTRLRGDAGPVFATLCEAFTNFGTVAGHVVLDVTVS................ 195
508 2.000e-06UniRef50_A0A161WKV5 YKOF-related family protein n=2 Tax=Clostridiaceae TaxID=31979 RepID=A0A161WKV5_9CLOT  ali  21  2...ITAEVAVYPL-KTTDATKVINDSINSIKQSNLDYQVNSMNTILNGNKEDVFNCIKTMFTEAEKSGGEVNMVVTIG................ 75
509 2.000e-06UniRef50_A0A251XFK4 Uncharacterized protein n=1 Tax=Clavibacter michiganensis subsp. michiganensis TaxID=33013 RepID=A0A251XFK4_CLAMM  ali  26  15................................SGLPNRTDAMFTTIEGDWDEVFDVVRRATEAVAPFGTRVSLVLKADIRP............. 63
510 2.000e-06UniRef50_G4EMG7 Uncharacterized protein n=2 Tax=Mycoplasma iowae TaxID=2116 RepID=G4EMG7_MYCIO  ali  27  1MKNATLSLKILRINHDKDVFKMVDDVIDIIKNSNLNYLVGPSETTIDGNIDELMNLLSSIMNFVKESSDPVFISSQFYYQKRGITLEEKIK... 93
511 2.000e-06UniRef50_M0MWJ9 Uncharacterized protein n=108 Tax=Archaea TaxID=2157 RepID=M0MWJ9_9EURY  ali  22  2..TVVALLSVAPVREG-SMAGEVAKAVDALDEFDVSYETNPMGTVIEEEVGELFAAAQA--AHEAVDGDRVSTVLKIDDRASEDSASEKVDAV. 91
512 2.000e-06UniRef50_A0A1V4ML65 Uncharacterized protein n=1 Tax=Firmicutes bacterium ML8_F2 TaxID=1775675 RepID=A0A1V4ML65_9FIRM  ali  21  6..IISCQFSYYPLATTG-VNEEVKEVLKIIVASDLQYETGAMSTIVFGESSKIFSLLEEIASKMNRQGFKYALSISIS................ 80
513 3.000e-06UniRef50_T0CXN0 Uncharacterized protein n=1 Tax=Paeniclostridium sordellii ATCC 9714 TaxID=1292036 RepID=T0CXN0_PAESO  ali  37  2...VIADIAVIPLRPEEEMYKVVDYCIEIIKHSGLKYEIGANSTTIEGNFDDVFDILKK................................... 60
514 3.000e-06UniRef50_A0A1Q2MAV6 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium SM-Chi-D1 TaxID=1851148 RepID=A0A1Q2MAV6_9BACT  ali  18  2..NVQAQISIYPL-KVDSLSEPIEQFCGVLETHGLEVQTRQMCSYLCGESDIVFKALKEAFDLV-SGKYGVVMDLKIS................ 75
515 3.000e-06UniRef50_UPI0009E3C1EC thiamine-binding protein n=2 Tax=Actinobacteria TaxID=201174 RepID=UPI0009E3C1EC  ali  33  1.........................................MFTTIEGEWDEVFDVVKRATEAVGRHGHRVSLVLKADIRPGHTGITGKVER.. 52
516 3.000e-06UniRef50_A0A0X1KUE8 Uncharacterized protein n=1 Tax=Pseudothermotoga hypogea DSM 11164 = NBRC 106472 TaxID=1123384 RepID=A0A0X1KUE8_9THEM  ali  25  7....SCQMSFYPLGT-ERIDETVNEVLKIIESSGLKHQINHMSTTLWGRPSQIAQLIERIITSMDQ--TRFVLQITIS................ 77
517 4.000e-06UniRef50_A0A1V5ZYY8 YKOF-related Family protein n=1 Tax=Synergistetes bacterium ADurb.Bin155 TaxID=1852914 RepID=A0A1V5ZYY8_9BACT  ali  26  8...ITCQVSFLPI-ESQNYKEDVTRVLSMIEKSGLDFQTGDMSTTLRGERDRIWALAQEIFEGMNPVC-RFVLDLKVS................ 80
518 4.000e-06UniRef50_D6T0M7 Conserved uncharacterized protein n=1 Tax=Gardnerella vaginalis 5-1 TaxID=682148 RepID=D6T0M7_GARVA  ali  30  2.......................ADAVQVIRDSGLKNETNAMFTNIEGEFDDVMRVVKDATMTLVSKGYRTGVILKLDIRPG............ 60
519 4.000e-06UniRef50_M0L4U2 Uncharacterized protein n=7 Tax=Natrialbaceae TaxID=1644061 RepID=M0L4U2_9EURY  ali  17  13..TVFALLRVTPV-TDDDITEDVAAAIDALEEHDVEYRTTPMATILEAEDHELFAACASAHE--AVGTAEIQTTVQVEEKREEMAAEDKIDAV. 102
520 4.000e-06UniRef50_E4UZA0 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=E4UZA0_ARTGP  ali  17  1......................................MHSAGTTIEGPWDKVLTLIGQAHTVLHEGLVRVHSDIRVGSRTDKRTMESKVASVQ 58
521 4.000e-06UniRef50_A0A2E5ZKA2 Uncharacterized protein n=2 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E5ZKA2_9ACTN  ali  22  4..RMRIEFTIEPWVEGGHP-PYVVAAVSTAEASGLDIDLGPFGTGVEGPADELYRLVPSVLEAMTAGAERVS--LQISWVPDR........... 82
522 4.000e-06UniRef50_A0A0S8ETH6 Uncharacterized protein n=1 Tax=Planctomycetes bacterium SM23_25 TaxID=1704028 RepID=A0A0S8ETH6_9BACT  ali  18  2..KVQAEVSLYPLQTQE-IGEAIDSFVNDLERAGLTVRKGNMSTTLSGNVGEVFAAMGRAFTTV-ADSGQVVLVLKVSNAPSDGAMEG...... 86
523 4.000e-06UniRef50_A0A2S7P1Q3 UPF0045 ECM15 protein n=1 Tax=Rutstroemia sp. NJR-2017a WRK4 TaxID=2070412 RepID=A0A2S7P1Q3_9HELO  ali  22  116.............................................TEGSWDEVMRLIGQAHTLVHQGVLRVQTDIRAGTRTDKQTFAEKVEKV. 165
524 4.000e-06UniRef50_A0A1I0G9K6 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=1 Tax=Natronincola peptidivorans TaxID=426128 RepID=A0A1I0G9K6_9CL  ali  20  2...IHAEVTLYPL-KTKDASAVINNSIDTLNQAGVEYNVGSMATHLHGNQEQVWNGLKRLFDE-AQRSGEVSMVVTI................. 73
525 4.000e-06UniRef50_A0A1H1D806 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=2 Tax=Tsukamurella pulmonis TaxID=47312 RepID=A0A1H1D806_9ACTN  ali  28  4....TAEFTSEPFEGEGTVPSHAERAVEVLRARGMAHDFGPLGTLVEGEAGAVLDALREALAAFTGGATRVTVQI---DRADG........... 80
526 5.000e-06UniRef50_A0A0A8GY36 Uncharacterized protein n=1 Tax=Campylobacter sp. RM16704 TaxID=1500960 RepID=A0A0A8GY36_9PROT  ali  14  2..SVLMEFSIFSISGEISKKEEVVKILKKLQKKNIDFKLHSMGTCVECNIKQALKILHLASKCM--DTKRYYINAKFDYKNRKNAIKDKIKTVK 93
527 5.000e-06UniRef50_A0A239BI98 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=2 Tax=Firmicutes TaxID=1239 RepID=A0A239BI98_9FIRM  ali  21  2...IHAEVSLYPL-KSRNAGDVINSSIDALKREGVEYNVGPMATHLHGNEEQVWSSLKKLFNE-AQGSGEVSMVVTITNAADH........... 79
528 6.000e-06UniRef50_A0A1D7XE63 YKOF-related family protein n=10 Tax=Thermoanaerobacteraceae TaxID=186814 RepID=A0A1D7XE63_MOOTH  ali  18  2...IACQLSLYPLGT-PAYTPVIKEAMAVLEQCGVEIEVNAMGTIIRGEEEAVWRAARQLFQ-VAAGRGEAVLVMTVSNR.............. 76
529 6.000e-06UniRef50_C5BX41 Uncharacterized protein n=65 Tax=Bacteria TaxID=2 RepID=C5BX41_BEUC1  ali  26  1...MLVEIHVSPSGTPEQKYAHVDAAIAVIAASGLTYEVHALGTVIEGPPDRIWSLVRDVHETFAAGADSTMTTIRLAQGKDGPTIADLVTKFR 96
530 7.000e-06UniRef50_G6Y7G3 Uncharacterized protein n=3 Tax=Mesorhizobium TaxID=68287 RepID=G6Y7G3_9RHIZ  ali  12  124.....AQFSLYVMGTGDHM-DEIYGCIDFLKQSGVYERSKHFCTKLRGDAGAIFATLNEAFCRFGPGAGHVTLDITVS................ 195
531 7.000e-06UniRef50_A0A0P1MTL1 YKOF-related Family n=3 Tax=Candidatus Kryptonia TaxID=1855361 RepID=A0A0P1MTL1_9BACT  ali  26  1MA-VAVQISLYPL-RQMDIIEPINSVIEIFKSYGLETHVGSMSTLVYGEDEQVFKALQDAYKKAAEFGEFVMV..................... 71
532 7.000e-06UniRef50_UPI0009898D22 thiamine-binding protein n=2 Tax=Vibrio TaxID=662 RepID=UPI0009898D22  ali  28  1....MVAFQVIPRVKEGNNFEVVDKAIEVVKAADVPFQIGAMETTMKGELNQLLDIIKXXXXCYDAGAVEVITNIKIHSKT............. 87
533 8.000e-06UniRef50_M1ND32 Uncharacterized protein n=2 Tax=Desulfocapsa TaxID=53318 RepID=M1ND32_DESSD  ali  19  18................................QNATFKLNDMGTLIEGKITDLFAILEKIYEPFDQGAVRVVTHITIDDRRDKIKIGDKTASV. 80
534 8.000e-06UniRef50_A0A2M7STY9 Uncharacterized protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2M7STY9_9CHLR  ali  21  2.......................KKAIEAIRDKGIRCQTNAMSTVMERDMDKLLEAVRAAYEAIKEGVKRIYMNLTMDHRFDKATLESKLGSLK 75
535 1.000e-05UniRef50_X1FL42 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1FL42_9ZZZZ  ali  23  1.........................................MGTIIEGDLEEVLRVVKKMHQTFGEGVARVVTTIKIDDRRDKLSPSGKIES.. 53
536 1.000e-05UniRef50_A0A202EDR5 Uncharacterized protein n=1 Tax=Natronolimnobius baerhuensis TaxID=253108 RepID=A0A202EDR5_9EURY  ali  17  2..SVFALLRVTPV-TDDDITEDVAAAIDALEEHDVEYETTPMATILEAEDHELFAACASAHE--AVGTAEIQTLVQVEEKREDLSTDDKIDAV. 91
537 1.000e-05UniRef50_D1CBP8 Uncharacterized protein n=1 Tax=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) TaxID=525904 RepID=D1CBP8_THET1  ali  21  2..KVTALVAVYPIGQQD--YTPVDAAIDALRESGLEVQVFPTHSTVSGDIDALFAGLKAAYQKAAEYGGTIMTT.................... 71
538 1.000e-05UniRef50_A0A1G3J4K7 Uncharacterized protein n=3 Tax=unclassified Sphingobacteriia TaxID=180495 RepID=A0A1G3J4K7_9BACT  ali  26  7...INAGIQIVPINIVDPSYAIINKAIDHIRQSGLAYTITPFETVVNGTTEQVLALIAELQLTENNGADELIINIRMHSKAGDNKFESKIS... 96
539 1.000e-05UniRef50_D9RZT4 YKOF domain protein n=6 Tax=Firmicutes TaxID=1239 RepID=D9RZT4_THEOJ  ali  17  3....TCQVSLFPLGR-EDYERVVLKSLQSLEEFDVDVDVTPLSTLIRGSEEEVWKAVRALYDAGAREGGKVVMFLTMTNRTGKGS......... 82
540 1.000e-05UniRef50_UPI000CF1BD95 hypothetical protein n=1 Tax=Helicobacter cholecystus TaxID=45498 RepID=UPI000CF1BD95  ali  14  3...VLLELSIFSIEGEVSKRSEVASVILALQKEGFSPILGEMGTVLETEMSDALRAIEVANSVMQ--AKRYYVIAKFDCYPQREKMEGRVERV. 92
541 1.000e-05UniRef50_A0A1E1KGQ4 Related to ECM15 protein, involved in cell wall biogenesis and architecture n=1 Tax=Rhynchosporium agropyri TaxID=914238 RepID=A0  ali  15  18...CIADFCLIPIGTTASVSNEVAAVQRLMKASGLSYTMHSAGTTVE............................................... 62
542 1.000e-05UniRef50_A0A0P1L924 YKOF-related Family n=4 Tax=Bacteria TaxID=2 RepID=A0A0P1L924_9BACT  ali  25  1MA-VALQISLYPL-RQMDIIEPIDKVIDVFKSYGLETHVGSMSTLVYGDDEKVFKALQEAYAKASEFGEFVMV..................... 71
543 1.000e-05UniRef50_A0A2N6NPW6 UPF0045 protein ECM15 n=1 Tax=Beauveria bassiana TaxID=176275 RepID=A0A2N6NPW6_BEABA  ali  19  10.AACYADFCLIPVGTGKSVAEEVAEVQRVIKASGLKYTMHSAGTTRER.............................................. 57
544 2.000e-05UniRef50_UPI0009DBAB59 hypothetical protein n=1 Tax=Nesterenkonia massiliensis TaxID=1232429 RepID=UPI0009DBAB59  ali  29  45.............................................VEGEWDEVFAVIKQATDAVTAVAPRVSLVVKADIRPGYTQLEGKVQRV. 93
545 2.000e-05UniRef50_A0A1W9L7I9 Uncharacterized protein (Fragment) n=1 Tax=Beggiatoa sp. IS2 TaxID=1934247 RepID=A0A1W9L7I9_9GAMM  ali  13  1................................................EWDAVFAAIKRCHEVVHEGVPRITATIKLGTRTDRQTMEDKINSVK 48
546 2.000e-05UniRef50_A0A1G2YTH5 Uncharacterized protein n=1 Tax=Planctomycetes bacterium RBG_13_60_9 TaxID=1801963 RepID=A0A1G2YTH5_9BACT  ali  23  2..RVQAEVSLYPLRTGK-LSGPVKEFCDVLRSHGLSVETRSMSTLVTGESDKLFDAVKEGFDVAAQR-----TEIVIDCR.............. 73
547 2.000e-05UniRef50_A0A0A8HQQ6 Uncharacterized protein n=328 Tax=Bacteria TaxID=2 RepID=A0A0A8HQQ6_STAHY  ali  31  1MIDTLMSIQIIPKTPGKDVIPFVDEAIAIIEKSGLKYRVGPLETTIEGDXXXXXXXXXXXXXXXXXXXXSVISQVKFYHAPEGISMSTLTEKY. 95
548 2.000e-05UniRef50_A0A2E0WG17 Uncharacterized protein n=9 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E0WG17_9CHLR  ali  29  5..KAKAEFTIEPFMEGD-PGPHVKETISLAKESGLDVEVGPFGTTVIGEQERVFELVSELVKTMGHGASRISLQVT.................. 78
549 2.000e-05UniRef50_A0A1I1U065 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A1I1U065_9ACTN  ali  21  5.....AEFTTEPFEGEGDPPAHAAVARDALRESGLEPEFGPLGTAISGDRAVLLPALSAVLERLDAGADRITLQVSIDD............... 79
550 2.000e-05UniRef50_A0A1V5FNA8 YKOF-related Family protein n=1 Tax=candidate division BRC1 bacterium ADurb.BinA292 TaxID=1852824 RepID=A0A1V5FNA8_9BACT  ali  18  4.PQIQAELSLYPL-EQQDIAKPIYEFVEALERDDLKVYIGTLSTVISGEMQRVFDAVRDAYARVARDG-RCVLVVKYLNESDKR.......... 84
551 2.000e-05UniRef50_UPI000DEB127E hypothetical protein n=1 Tax=Bifidobacterium sp. XV10 TaxID=2041614 RepID=UPI000DEB127E  ali  14  5.HQISCQISLYPLGQADYNGP-VDQVLDLVRASGLEAETNGMATIVRGESGRVFKLLEAVDARMADQGIRYVCTSTLS................ 80
552 2.000e-05UniRef50_A0A0S8EHI1 Uncharacterized protein n=3 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A0S8EHI1_9BACT  ali  22  2..RVQAEVSLYPLRTAA-LTDSIDSFVGHLRRRGLSVEVGPMSSRVGGECSDMFRALGEAFEAAGQQCDVVVSV.................... 72
553 3.000e-05UniRef50_Q0UES2 Uncharacterized protein n=3 Tax=saccharomyceta TaxID=716545 RepID=Q0UES2_PHANO  ali  14  11.......................................HANESYLEGSWDDVMKVIGQCHALLHQGVVRIQSDIRVGSRTDKQGFQDKVDAV. 66
554 3.000e-05UniRef50_A0A1V6C6B5 YKOF-related Family protein n=1 Tax=bacterium ADurb.Bin132 TaxID=1866923 RepID=A0A1V6C6B5_9BACT  ali  26  2..KVMIQVSVYPLGT-EKIGERVMDAIQAISSMGLETFTNPMSTTISCELEDGLEALGKMYRAIGQDGKAIMNV.................... 72
555 3.000e-05UniRef50_A0A1L3GI45 Uncharacterized protein n=1 Tax=Pelobacter acetylenicus TaxID=29542 RepID=A0A1L3GI45_PELAE  ali  15  2..NIQAEVSLYPL-REPSLTPAIDAFMEGLRRPGICLRSGAMSTVISGERQAVFEAVADSFARVADEHQVVLTV.................... 72
556 3.000e-05UniRef50_A0A1H3QGE5 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=2 Tax=Tindallia TaxID=69894 RepID=A0A1H3QGE5_9CLOT  ali  14  118...VNAQFSVYPLG-NQSYMKLIGDVVDLVKRADVYQESVHFCTSLEGSIANVFEALEEAFSYVSKEVGHTVMTVTLS................ 191
557 3.000e-05UniRef50_A0A0J6BIC9 Uncharacterized protein n=1 Tax=Synechococcus sp. GFB01 TaxID=1662190 RepID=A0A0J6BIC9_9SYNE  ali  22  2..KVIVDLCVVPIGVGVHLAATIA-------------------------------AIEACHQAVHAGXPRVYTTVKINTRTDKQRLEEKVASVQ 64
558 3.000e-05UniRef50_A0A2T2RIE8 Uncharacterized protein n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A2T2RIE8_9ACTN  ali  17  74...VLAEVVLECSGDATAHRQLLERALQALDGPELEVRVGPVSTAVSGGLHDVLHAVERAHGIAAQQAERAVTTVRLESRTPPLSLAER..... 159
559 3.000e-05UniRef50_A0A117KYQ6 Uncharacterized protein n=1 Tax=bacterium 42_11 TaxID=1635281 RepID=A0A117KYQ6_9BACT  ali  23  2...IRADLRILPTGDKDKVIKLVDKAINIIEASGISREVTPTCTLLMGSLDQILALVKKIHEELSK............................ 65
560 3.000e-05UniRef50_A0A2G0CG95 Uncharacterized protein n=1 Tax=Lewinella marina TaxID=438751 RepID=A0A2G0CG95_9BACT  ali  17  2..NVSVELSLYPL--TPNYEPVITDFIKRLRASDVQVATNPLSTQLTGDYDTVMKVLTEAMRPTLRGCSFVIKLLNVAIEPGRV.......... 84
561 3.000e-05UniRef50_A0A0T9HNR5 Uncharacterized protein n=1 Tax=Streptococcus pneumoniae TaxID=1313 RepID=A0A0T9HNR5_STREE  ali  34  1.............................................MEGEFDELMRILKEALEVAGQEADNVFANVKINV-GEILSIDEKLEKY. 47
562 4.000e-05UniRef50_D9S091 Uncharacterized protein n=1 Tax=Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P) TaxID=555079 RepID=D9S09  ali  18  2...ISCEVSIYPMETQNS-DQVINQALASIKDKGVTCQVGTISTYISGPPEKVWECIRTLYDAASARSKELSMVVTIS................ 75
563 4.000e-05UniRef50_A0A1G8VEH7 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=1 Tax=Actinopolyspora mzabensis TaxID=995066 RepID=A0A1G8VEH7_9ACT  ali  22  5.....AEFTTEPFEGEGDPPAHAAVARDALRESGLEPEFGPLGTAISGERAVLLPALSAVLERLDAGADRITLQVSIDDTP............. 81
564 4.000e-05UniRef50_A0A1V6YKF0 Uncharacterized protein n=1 Tax=Penicillium nalgiovense TaxID=60175 RepID=A0A1V6YKF0_PENNA  ali  16  9..HCVADFCLVPVGTSPSVSDQVADIHRMIETCGLKYVMHSAGTTLVLPW............................................ 57
565 4.000e-05UniRef50_C8XK10 Uncharacterized protein n=32 Tax=root TaxID=1 RepID=C8XK10_NAKMY  ali  30  2..RVVAEFTTEPFHGEGEPPEHAQRAWEVVQAAGLTGDFGPLGTEVQGERDTVLDALREMAAALDAGATRITVQL................... 75
566 4.000e-05UniRef50_A0A2N8J534 Uncharacterized protein n=1 Tax=Bacillus sp. UFRGS-B20 TaxID=2070341 RepID=A0A2N8J534_9BACI  ali  30  8........................KPIEVVQQSGVRYEVGAMENNFKGELDVTSSMFKRAQQSLRRRQKTMITSIKIHYQALGVTIDEK..... 77
567 5.000e-05UniRef50_A0A175RL34 Uncharacterized protein n=2 Tax=Curtobacterium luteum TaxID=33881 RepID=A0A175RL34_9MICO  ali  31  29.............................................HIGEWDEVMDVVKRATEAVAPFGTRVSLVLKADIRPGHTGLDGKVER.. 76
568 5.000e-05UniRef50_A0A1V6D5N7 YKOF-related Family protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1V6D5N7_9CHLR  ali  16  57...ITAQFSLYPL-RQSSLSQTINLALDALEDFNLKTQPGSMSTVISGTQRAVWGGLQGAFSNAASQAE-VVMVVTIS................ 129
569 5.000e-05UniRef50_UPI000A70F65F hypothetical protein n=1 Tax=Leucobacter sp. 4J7B1 TaxID=861268 RepID=UPI000A70F65F  ali  23  1.........................................MFTEIEGSWDEVFDVVRRATEAVLPFGSRVSLVMKSDIRPGFTGLDGKLER.. 52
570 6.000e-05UniRef50_W8TAC1 Uncharacterized protein n=9 Tax=Firmicutes TaxID=1239 RepID=W8TAC1_PEPAC  ali  19  9....SCQISFTPIGSVEYLSE-IRQVLDIIKDSGLEYDVGTISTVVIGGKDRVFKLISDIYEAMDDICNFTI-DVKIS................ 80
571 6.000e-05UniRef50_A0A1G1H5R0 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RBG_19FT_COMBO_42_15 TaxID=1801709 RepID=A0A1G1H5R0_9BACT  ali  27  1.........................................MGTVVEGDMEKIFELIKKCHNEVLKNSERVLTSITIDDRKGAVSINRKVAA.. 52
572 7.000e-05UniRef50_A0A151AEM5 Uncharacterized protein n=1 Tax=Halalkalicoccus paucihalophilus TaxID=1008153 RepID=A0A151AEM5_9EURY  ali  25  2..TVIALLSVAPVVEG-SMAGEVAKAVDALEEFDVSYETNPMGTVIEAETEELFAA...................................... 55
573 8.000e-05UniRef50_A0A0D5YSC3 Uncharacterized protein n=25 Tax=root TaxID=1 RepID=A0A0D5YSC3_9FLAO  ali  17  3...ISVELTLTPL--QDDFEPPIIDFIKRLRNSGLTVVENPLSTQVFGDYDKVMALLTDEIKAAFENTERVLLYMKISDRSG............ 81
574 8.000e-05UniRef50_A0A1G5S1T7 Thiamine-binding protein n=1 Tax=Acidaminobacter hydrogenoformans DSM 2784 TaxID=1120920 RepID=A0A1G5S1T7_9FIRM  ali  21  15...VGAQLALTPI-QSQDPTATVEKALEIINAYPLTVETNAMSTLITGELDTILEMVKALYQTMNAEAQ-FTLDIRLS................ 87
575 9.000e-05UniRef50_A0A2R6H3G9 Uncharacterized protein n=1 Tax=Halobacteriales archaeon QS_4_66_20 TaxID=1919174 RepID=A0A2R6H3G9_9EURY  ali  26  2..TATAFLAVSP-DTDGSMAPEVAKAVDALESFDVEYETTPMGTILEAD............................................. 47
576 1.000e-04UniRef50_A0A2T5GA94 Uncharacterized protein n=1 Tax=Brockia lithotrophica TaxID=933949 RepID=A0A2T5GA94_9THEO  ali  25  3...ISAQLQLYPL-AEEDYGTVIWKAIDRLRDRGLRVEVGPMSTLIAGEADLVWRAVRELFTFAAEG-RRIVLVATMS................ 78
577 1.000e-04UniRef50_UPI000A3D76A4 dehydrogenase n=1 Tax=Natrialbaceae archaeon JW/NM-HA 15 TaxID=1902251 RepID=UPI000A3D76A4  ali  23  2..TAIARFEIIPV-TDDRMSEQIAAALEELDEFDVSYELTPMDTVIEDDADEIFAAAAPAHDAIDQD--RVITSLEIDHQPGRQQSTDRVAAV. 91
578 1.000e-04UniRef50_A0A1F9A5E4 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_52_11b TaxID=1797830 RepID=A0A1F9A5E4_9DELT  ali  26  1.........................................MGTNVEGDLKKLIDIALKMHQPFKKGAQRVVTTLKIDDRRDKKTLSGKKKAVR 55
579 1.000e-04UniRef50_A0A0S8BTT9 Uncharacterized protein n=3 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A0S8BTT9_9PROT  ali  18  1MSTISVQVSLYPL-RQPHVGPTISRMLEVFRARGLEVRPGTMSTVITGDADSVLDGLKNSFKSAAALGD-VVMVATIS................ 76
580 1.000e-04UniRef50_UPI000A0128FA hypothetical protein n=1 Tax=Brachybacterium squillarum TaxID=661979 RepID=UPI000A0128FA  ali  21  39.....................................RTTTTHTEIEGEWDEVFETVRKATEAVAPYGSRISLVPKADIRPGHTGLEGKLDR.. 94
581 1.000e-04UniRef50_A0A2G6K7Z2 Uncharacterized protein n=1 Tax=Ilumatobacter coccineus TaxID=467094 RepID=A0A2G6K7Z2_9ACTN  ali  18  1MNHV--EFTIEPFVEG-SPGRHVTAPAKVLREHGVNVEIGPFGTSCVVADDDTAQVVSTVNEALRHGADRISIEIRAG................ 76
582 1.000e-04UniRef50_UPI0008365C26 hypothetical protein n=1 Tax=Rubripirellula obstinata TaxID=406547 RepID=UPI0008365C26  ali  17  1...MLADFSIWTL-DDPAMHDDMQLVRETLDERGLEYTMNRMSTSVEGSLTQISESIEACRQKLAVKHNRLLIQITFDDDRSK........... 79
583 1.000e-04UniRef50_A0A2N5Z6B8 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5Z6B8_9BACT  ali  20  2..NIIIDIAYYPLL--DKYSKAVDDFLKQLDNSGISYQTGATSTLVHGDYDRIMPVVNAIMKDLMKIYPSVFS-LRIS................ 74
584 1.000e-04UniRef50_UPI0009B5FC33 hypothetical protein n=1 Tax=Leuconostoc pseudomesenteroides TaxID=33968 RepID=UPI0009B5FC33  ali  24  4....SIAVQVLPMTANEDVIKIVDHVIAYIDASGVNYQVGA..................................................... 41
585 1.000e-04UniRef50_A0A2R6M862 Uncharacterized protein n=1 Tax=Halobacteriales archaeon SW_6_65_15 TaxID=1919201 RepID=A0A2R6M862_9EURY  ali  23  2..SVIARLEVIP-AREGNMSEAVASAVEALDRFDVSYETTPTDTVIEADPSEVFAAAETAHRAVAD--ERVITSLEVDEHRG............ 79
586 2.000e-04UniRef50_A0A1B1U586 Uncharacterized protein n=3 Tax=Campylobacterales TaxID=213849 RepID=A0A1B1U586_9HELI  ali  14  2..SVLMEFNVFSIAGAVSKRKEVAKLLKSLKDKGIEFSLNPMGTIVECEMQKALEILNFATQNV--DAQRFYVIAKFDCYNQRKDL........ 84
587 2.000e-04UniRef50_A6TN13 Uncharacterized protein n=27 Tax=Clostridia TaxID=186801 RepID=A6TN13_ALKMQ  ali  24  2...IHAEVALYPL-KTNRASETINNSISTLENQGIEYEVGPMATHFHGSEEQVWNGLRSLF-GEAQQAGEVSMVVTITNAAD............ 78
588 2.000e-04UniRef50_A0A1F3K319 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3K319_9BACT  ali  25  3.KQVTAEMSFFPVQTGDYKSE-INKAIEIIRGFNLEYKIGLLSTTVRGDQTLIFKMVYKVFSSMDEQCKFVLSV.................... 74
589 2.000e-04UniRef50_A0A1H3G6P7 Uncharacterized conserved protein YqgV, UPF0045/DUF77 family n=1 Tax=Modestobacter sp. DSM 44400 TaxID=1550230 RepID=A0A1H3G6P7_9  ali  21  4....VAEFTTEPFVGEGPAPAHAIETLHVVQESGVICEFGPLGTSLTGEDDTLLPVLGQVLAAFAHGATRVSLQVRIDD............... 80
590 2.000e-04UniRef50_A0A2N6AQ07 Uncharacterized protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2N6AQ07_9FIRM  ali  16  10.....AQISFAPLGTEDIESP-VNEVLEIIGSSGMEHEIGAMSTIIWGSPGDLSAMIEKIQTRMN-GKTNYIMDIRIS................ 80
591 2.000e-04UniRef50_A0A2H5XYX3 Uncharacterized protein n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H5XYX3_9BACT  ali  20  2..TVAATVAVYPLRQLD--YRAIDAAIAALQQSGLAVDVQPMHTELSGPIEEVFTALRQAFQSAASYGVTIMTV.................... 71
592 2.000e-04UniRef50_UPI000D65C17A hypothetical protein n=1 Tax=Moorella sp. Hama-1 TaxID=2138101 RepID=UPI000D65C17A  ali  19  3....SAEVSLYP-QKTTRASEIINESLQSLAQQGVNYQVGPISTEIHGSEEQVWSGIRSLFNKASS-AGEVNMVVTFS................ 74
593 2.000e-04UniRef50_R1GRJ5 Uncharacterized protein n=1 Tax=Grimontia indica TaxID=1056512 RepID=R1GRJ5_9GAMM  ali  30  138.NHVMLAFQVIPRLKEGNNFEVVDKAIEVVKAANVSY......................................................... 173
594 3.000e-04UniRef50_G0L3R0 Uncharacterized protein n=24 Tax=Flavobacteriia TaxID=117743 RepID=G0L3R0_ZOBGA  ali  22  2..NISVELTFSPL--QDDFEEHIINFIKKLRASGLTVLENPLSTQVYGEYDEVMDLIKEAFELMDKG----LLYMKVSDRSD............ 81
595 3.000e-04UniRef50_C4FKK9 Uncharacterized protein (Fragment) n=1 Tax=Sulfurihydrogenibium yellowstonense SS-5 TaxID=432331 RepID=C4FKK9_9AQUI  ali  17  4....LVEFSMFPTDKGESVSPYVSRIIKMIDESRIPYRLTPMG................................................... 42
596 3.000e-04UniRef50_A0A1F8U2R8 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWB2_37_7 TaxID=1797677 RepID=A0A1F8U2R8_9FIRM  ali  16  9....SCQLSFIPI-QSENYLADIDMVLRRITASGLEYSIGEMSTIIKGGKANILKLISDLYDLMTPKCSFVI-DIRIS................ 80
597 3.000e-04UniRef50_A0A097AS77 Uncharacterized protein n=1 Tax=Thermoanaerobacter kivui TaxID=2325 RepID=A0A097AS77_THEKI  ali  46  2...........PVVSEEDIYPIVDKVIEYIKSTGVKYVVGPMETTMEGEL............................................ 40
598 4.000e-04UniRef50_I0GLP8 Uncharacterized protein n=2 Tax=Caldisericum exile TaxID=693075 RepID=I0GLP8_CALEA  ali  18  3...ITAQFSIYPL-KVENYGDYVYDTVRIVKSFGLDVTVGPTSSVTYGDSELIFKAFNEVMRQFEGKVHFVFV..................... 71
599 4.000e-04UniRef50_A0A2D9PU69 Uncharacterized protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A2D9PU69_9ACTN  ali  29  8..QIAAEFTIEPFVEGA-PGPHVRAAIDVAESAGLTVEVGPFGTAVSGTSETVLDTVDAVRAAIANGATRVSLQLTV................. 82
600 4.000e-04UniRef50_A0A1A5ZTT3 Uncharacterized protein n=1 Tax=Kwoniella dejecticola CBS 10117 TaxID=1296121 RepID=A0A1A5ZTT3_9TREE  ali  11  7...AVADFCLIPMGPQPSVGPEIAEVQRVLEKSGLEYKL....................................................... 43
601 5.000e-04UniRef50_Q98JV6 Mll1759 protein n=2 Tax=Mesorhizobium TaxID=68287 RepID=Q98JV6_RHILO  ali  12  215......QFSLYVMGIGDHM-DEIYGCIDFLKQSGVYDRSKNFCTKLRGDTGAIFSALNEAFCRFGPGAGHVTLDVTVS................ 285
602 5.000e-04UniRef50_A0A0S8HMP9 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A0S8HMP9_9DELT  ali  17  12..HISAQISLYPL-KQQRLSPVIEEAWRILEENSLDLQKGGMSTVVSGPAEMVFNAIQEVFMRSAEKGS-LSMVVTFS................ 85
603 7.000e-04UniRef50_A0A1N6QFC5 YKOF-related Family n=2 Tax=Alkalispirochaeta TaxID=2024958 RepID=A0A1N6QFC5_9SPIO  ali  18  124...VSAHFSLYPLG-DPGYMTTIARAISSVQDDGVFGGAKHFCTRLEGDLSKVFSSILKTFETAAASTPHVVLHLTAS................ 197
604 7.000e-04UniRef50_A0A1H2TDW0 Thiamine-binding protein n=1 Tax=Tepidimicrobium xylanilyticum TaxID=1123352 RepID=A0A1H2TDW0_9FIRM  ali  25  4MAKITCEIAFVPIVSEDYISS-VDKVLDIIRSYDLEHNIGIMSTTVRGDINKIHKLIFEIYDKMDQECK-FTMDIKLS................ 80
605 7.000e-04UniRef50_I6Z4H8 Uncharacterized protein n=1 Tax=Melioribacter roseus (strain JCM 17771 / P3M-2) TaxID=1191523 RepID=I6Z4H8_MELRP  ali  18  1MAKMTCEFAFVPV-QSHDYIAEVETVLDIIRECGLEYNIGEMSTIIKGESDKIFALMERIYNDRYDKSKFIISV.................... 75
606 7.000e-04UniRef50_A0A147JXH4 Uncharacterized protein n=1 Tax=Hadesarchaea archaeon DG-33-1 TaxID=1775755 RepID=A0A147JXH4_9EURY  ali  17  8...IIAELVVTSLGTETGLSDYVAKAVGKVKRAGVKYQLHPMGTVFEADLKTSFRIIEAAH................................. 67
607 7.000e-04UniRef50_A0A086YYF8 YKOF domain-containing protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A086YYF8_9BIFI  ali  16  6..RISCQLSLYPLAQADYTSP-VGQVLELIKTSGLAYETNDMATIVRGEPQVVFALLASIDDLMARTSTSYSLNATIS................ 80
608 7.000e-04UniRef50_A0A0Q1HBM3 Uncharacterized protein n=36 Tax=Bacteria TaxID=2 RepID=A0A0Q1HBM3_9FLAO  ali  18  2..NISVELTFSPL--QDDFEEHIINFIKKLRASNLTVLENPLSTQVFGEYNQVMQVIEAAFELMDKG........................... 68
609 8.000e-04UniRef50_J5QDZ9 Uncharacterized protein n=2 Tax=Trichosporon asahii var. asahii TaxID=189963 RepID=J5QDZ9_TRIAS  ali  11  172...AVADFCLIPMGTEPSVGPQIAECQRVLEKSGLEYN........................................................ 207
610 9.000e-04UniRef50_A0A0Q9RYW8 Uncharacterized protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q9RYW8_9ACTN  ali  26  2.........................................SQSSHSGEWDEVMAVVKRAVDVVAEVSPRVGLVLKADIRPGDGQLTAKVERV. 54
611 9.000e-04UniRef50_A0A1B6A9Y8 YKOF-related Family protein n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1B6A9Y8_9BACI  ali  21  2...ISCQVALYPLATKE-FDQVIVEALDALKEEGLTIEVGSMSTIFKGPDDLVWKAVRLLFDTAKQNGQQIVLNTQIS................ 78
612 9.000e-04UniRef50_UPI0009E4F2EA hypothetical protein n=1 Tax=Bacillaceae TaxID=186817 RepID=UPI0009E4F2EA  ali  24  37..............................EEKGLKYQLTPTSTVVKGDIDQLWEVAKDMHQE............................... 69
613 1.000e-03UniRef50_A0A1V8M8A3 Uncharacterized protein n=2 Tax=Methyloprofundus sedimenti TaxID=1420851 RepID=A0A1V8M8A3_9GAMM  ali  16  2...IQAEVSLYPL-KELDIATDINDFLNQLKSTGLDVEFGRMSSIVSGELPQVFDGLKEAFQKIADKKQSVLI-IKVS................ 74
614 1.000e-03UniRef50_A4CIU9 Uncharacterized protein n=264 Tax=root TaxID=1 RepID=A4CIU9_ROBBH  ali  23  2..KISVELTLSPL--QDNYEPEIIRFIKALRDSGLTVLENPMSTQVYGEYDRVMEVLGR................................... 56
615 1.000e-03UniRef50_A0A2V6UMU1 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6UMU1_9BACT  ali  20  3...VSAQIAIYPL-RHDRLTPAVTAVSRALETAGLRPEVGSMSTIVTGETATVFSALEEAFTKAATLGHVVMTV.................... 72
616 1.000e-03UniRef50_A0A090WQ92 Ribosyl nicotinamide transporter PnuC-like n=1 Tax=Jejuia pallidilutea TaxID=504487 RepID=A0A090WQ92_9FLAO  ali  20  2..KISVELTLTPL--QDNFEPAIIHFIKKLRASNLKVLENPLSTQVYGDYDEVMRLLTSEIKEAFELVERGLLYMKISDRHD............ 81
617 1.000e-03UniRef50_UPI0009E887CF hypothetical protein n=1 Tax=Curtobacterium oceanosedimentum TaxID=465820 RepID=UPI0009E887CF  ali  28  50..........................................FSAHEGKWDEVMDVVKRATKAVGAYGTRMSLVLKADIRPGHTGIDGKLER.. 100
618 1.000e-03UniRef50_UPI00082ADA79 hypothetical protein n=1 Tax=Clostridiales bacterium MCWD3 TaxID=1766203 RepID=UPI00082ADA79  ali  21  6.KIATCQISFTPIV-STNYIEDINKVLDIIKSYEVDYNVGMMSTTIKGNKETLLKIINQIFNTMYEVCS-FTMDVKLS................ 80
619 1.000e-03UniRef50_A7NH95 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A7NH95_ROSCS  ali  22  11....TAQVSLYPL-RQEHLSPAIDAALALWRERGLDVRPGAMSTLIAGEEATVWE....................................... 60
620 1.000e-03UniRef50_I4DBA0 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=I4DBA0_DESAJ  ali  18  4.....AEVSIYP-QKTNSPGQVINNSINSLSNENIQYKVGSLSTHIDGNDEQVWNGIKKVFDA-AKTSGEVSMVVTIS................ 74
621 1.000e-03UniRef50_UPI0009ECE27E hypothetical protein n=1 Tax=Domibacillus aminovorans TaxID=29332 RepID=UPI0009ECE27E  ali  28  19..............................EEKGLKYQLTPTSTVVEGDIDQLWEVAKDMHQ................................ 50
622 1.000e-03UniRef50_S2DX92 Uncharacterized protein n=1 Tax=Indibacter alkaliphilus LW1 TaxID=1189612 RepID=S2DX92_9BACT  ali  25  1.............................................MEGTQEELLLVAQKAQDALKAGADEVLIYFRMQIRKEDVTIEDKIGKY. 50
623 0.002UniRef50_A0A0L6U4V5 Uncharacterized protein n=1 Tax=Acetobacterium bakii TaxID=52689 RepID=A0A0L6U4V5_9FIRM  ali  20  8...MSCQISFIPL-KNSNVNASVDQIIELIKKSNLDYRIGMMSTELRGNRELILELINTLLDYATENTQFI-LDVRFS................ 80
624 0.002UniRef50_A0A1A9GPE6 Uncharacterized protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1A9GPE6_9ACTN  ali  27  7..............................................SGEWDEVMAVVKRAVDVVAEVSPRVGLVLKADIRPGDGQLTAKVERV. 54
625 0.002UniRef50_A0A094G5N5 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4518 (FW-2643) TaxID=1420913 RepID=A0A094G5N5_9PEZI  ali  17  10.PICVADFSLSPLATTASISNEIAAVQQLMKASGLSYSMHSAGTTV................................................ 55
626 0.002UniRef50_E9UQU6 Putative DNA-binding protein n=42 Tax=Actinobacteria TaxID=201174 RepID=E9UQU6_9ACTN  ali  21  2..RVEAEFTTEPFRGEGEPPEHATAALEAAREAGLECDFGPLGTSVRGERDAVLATLADVVAALDHGADQITFQVRV................. 77
627 0.002UniRef50_A0A2X2WFL0 Domain of uncharacterized function DUF77 n=1 Tax=Clostridium perfringens TaxID=1502 RepID=A0A2X2WFL0_CLOPF  ali  53  8..............................................................CIEEGAGRVVSIVKIDYKKGGVTMDEKVGKYR 39
628 0.003UniRef50_A0A1M3NSB7 HMP/thiamine-binding protein n=1 Tax=Rhizobiales bacterium 65-9 TaxID=1895816 RepID=A0A1M3NSB7_9RHIZ  ali  13  123.....AQISLYPLGGEGHMAR-IGACIDFLKAVGVYDKPKHFCSKLRGDASVLFAAIERSFIDFAPAQAHVVLSLTVS................ 194
629 0.003UniRef50_UPI000D761882 hypothetical protein n=1 Tax=Prauserella sp. YIM 121212 TaxID=1477506 RepID=UPI000D761882  ali  32  48...........................................TDIEGEWDEVMDVVKRVVEAAGEGAPRVGLVLEADIRPGEGRLGATVERV. 98
630 0.003UniRef50_A0A2W7A7I9 Uncharacterized protein n=1 Tax=Cyanobium sp. TaxID=2164130 RepID=A0A2W7A7I9_9CYAN  ali  14  47..........................................................ACHALHAMGCNRIFTNVKVNIRTDRQTLEDKVASV. 83
631 0.003UniRef50_A0A1I0A7B4 YKOF-related Family n=2 Tax=Natronincola peptidivorans TaxID=426128 RepID=A0A1I0A7B4_9CLOT  ali  16  10...ASCEITYFPI-KSEDYIGDINKVLKIIEAYPVEVTVGILSTTIRGNSQIIFQLIQEIYSNMAEEGRHFTISMMMS................ 83
632 0.004UniRef50_A0A0Q9LRL0 Uncharacterized protein n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q9LRL0_9MICO  ali  27  2..RVRVEFTTEPFGEDDDVPAHVTAAADALREAGLAPDLGPLGTSVDGEAEAVVPAVADAMAALAGGATRMTLTL................... 76
633 0.004UniRef50_A0Z794 Uncharacterized protein n=1 Tax=marine gamma proteobacterium HTCC2080 TaxID=247639 RepID=A0Z794_9GAMM  ali  18  4....SAELSLYPLTGDVDTS--VLAFIDDLHSSGISVVTNTMSTQISGEWDAVMSAINVALKQSSQRTNRQVLVVK.................. 74
634 0.004UniRef50_UPI000BE44EF7 hypothetical protein n=1 Tax=Geodermatophilus sabuli TaxID=1564158 RepID=UPI000BE44EF7  ali  20  1.............................MQASGLRYEVGALGATLEGEADEVWATLRAAHEAMAAGATGGLSHIKVASV--NRTMDSLTHEFR 64
635 0.004UniRef50_R1IN00 Uncharacterized protein n=3 Tax=Vibrionaceae TaxID=641 RepID=R1IN00_9GAMM  ali  20  1.............................................MKGELDYLLEVVKKAQQACDAGAVEVITNIKIHSKTDAAT......... 41
636 0.004UniRef50_A0A2J6WEQ1 Uncharacterized protein n=1 Tax=Caldisericum exile TaxID=693075 RepID=A0A2J6WEQ1_9BACT  ali  30  1..................MYEKDDKAVKVIITSGLKYEVSANSTTIEVNLYVLFEGIKMC.................................. 42
637 0.005UniRef50_D7CSE8 YKOF domain protein n=2 Tax=Truepera TaxID=332248 RepID=D7CSE8_TRURR  ali  11  104.AEVACQFSLYPMGTAAYMDAIYDQIKAARSRPGLRVTPQHFCTRLEGPLPQVFAELRRAFDAAAERTPHVVIHATL................. 179
638 0.005UniRef50_A0A0L6CDU2 Uncharacterized protein n=1 Tax=Luteipulveratus halotolerans TaxID=1631356 RepID=A0A0L6CDU2_9MICO  ali  18  2..RVRCEVTTEPFHGEGPLPPHVVAVADAFTAAGLTPDLGPLGTSASGDVSAVAAVLRDVTAAFEAGAARVSVQVRADD............... 80

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;