current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP00008 gene: cysG; uroporphyrin-III C-methyltransferase BA_1445 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MGKVYIVGAGPGDPDLITVKGLKCIEKADVILYDRLVNKELLSYAKPEADLIYCGKLPNYHTMKQETINTFLIKYAKKGKIVTRLKGGDPFVFGRGGEEAEALAKQGVPFEIVPGISAGIAAPAYAGIPVTHRDASASFAIVTGHRKEDAAEEVKWGNLAKGVETLAVYMGVSNLPYICEQLMKHGKDKSTPAAIIERGTTSMQRTVVGTLGTIVDVAKKEQIQNPSMIVIGEVVRFREKIHWFEKQTESTYQVSGVLLast
1 -106.000IDP00008 gene: cysG; uroporphyrin-III C-methyltransferase BA_1445 [Bacillus anthracis str. Ames]  ali  100  1MGKVYIVGAGPGDPDLITVKGLKCIEKADVILYDRLVNKELLSYAKPEADLIYCGKLPNYHTMKQETINTFLIKYAKKGKIVTRLKGGDPFVFGRGGEEAEALAKQGVPFEIVPGISAGIAAPAYAGIPVTHRDASASFAIVTGHRKEDAAEEVKWGNLAKGVETLAVYMGVSNLPYICEQLMKHGKDKSTPAAIIERGTTSMQRTVVGTLGTIVDVAKKEQIQNPSMIVIGEVVRFREKIHWFEKQTESTYQVSGVL 258
2 -102.000IDP93866 uroporphyrinogen-III methyltransferase [Yersinia enterocolitica subsp. palearctica Y11] YP_006005134 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  47  4.GKVWLVGAGPGDAALITVKGLHAIRRAEALVYDRLVCAELLAEAPDGCEMINVGKTPNHHLVPQPQINEILVDCAQRGLNVVRLKGGDPYVFGRGGEEAEALALAEIAFEVIPGISSAIGGLAYAGIPVTHRDYASGFHVVTGHLRQGN-EPQDWATLAKLEGTLIILMGMTQLATICQQLIAGGKAPTTPAAVVMYASHQQQQVASGTLTTLADQVAAQGLSAPALIVIGDVVRLRDILAFTPEMLSINSTPSLI. 258
3 -96.400IDP04084 uroporphyrin-III C-methyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] VC2561 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  49  45.GEVALVGAGPGDPELLTVKALSYLQQADVVLYDYLVSDEIMALIPSETILVCVGKRAGHHSVPQEKTNQLLVDFARQGYRVVRIKGGDPFMFGRGGEELEVLFEAGVKFQVVPGITAAAGATAYAGIPLTHRDYAQSALFVTGHLKAQA-EDLDWSTLARGKQTLVIYMGLSNAAAIAEQLQLHGRQASTPVAIIERGTQVNQQVLIGTLQTLPSLASQ--AQSPALIVVGEVVALAAKLHWFGEQGATQQLDAAQ. 297
4 -85.000IDP05539 gene: cbiF; precorrin-4 C(11)-methyltransferase [Clostridium difficile 630] CD3426 [Peptoclostridium difficile 630]  ali follow..  29  1MNKVHFVGAGPGDKELITLKGYKLLSNADVVIYGSLVNPELLEYCKEDCQIHNSAH------MDLQEIIDVMREGIENNKSVVRLQTGDFSIYGSIREQVEDLNKLNIDYDCTPGVSSFLGAASSLGVEYTVPEISQSVIITRMEGRTPVPEKESIQSYAKHQTSMVIFLSVQEIEKVVSKLLEGGYPKDTPIAVIYKATWADEKIVKGTLSDIAVKVKENNINKTALIMVGRFLGEEYNNSKLYDKDF......... 244
5 -84.400IDP00010 uroporphyrin-III C-methyltransferase, putative BA_2144 [Bacillus anthracis str. Ames]  ali follow..  51  3.GYVYLVGAGPGDEGLITKKAIECLKRADIVLYDRLLNPFFLSYTKQTCELMYCGKMPKNHIMRQEMINAHLLQFAQEGKIVVRLKGGDPSIFGRVGEEAETLAAANIPYEIVPGITSSTAASSYAGIPLTHRNYSNSVTLLTGHAKGSL-TDHGKYNSSHNSDTIAYYMGIKNLPTICKNLRQAGKKEDTPVAVIEWGTTGKQRVVTGTLSTIVSIVKNENISNPSMTIVGDVVSLRDQIAWKEHKPLHGKKVLFT. 257
6 -84.300IDP91250 gene: lmo1201; lmo1201 [Listeria monocytogenes] NT01LM1295 [Listeria monocytogenes EGD-e]  ali follow..  46  1MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLHHPIPQDEIERILVREAATNELVVRLKAGDPYVFGRGGEEGETLHKAGIPFEVIPGITSAIGGLAYAGIPVTHRDFASSFHVITGHLKKGR-DPLDWEALARLEGTLVFLMGMTNLPNICANLLEHGQKPETGVAIVQWATRGKQLTVTGNLQTIEQKVAESGISSPALIVVGDVVSLRPQLNFFEEMPLFHTKVLLP. 256
7 -82.700IDP00533 gene: cysG; siroheme synthase YPO0158 [Yersinia pestis CO92]  ali follow..  46  213.GEVVLVGAGPGDAGLLTLKGLQQIQQADVVVYDRLVSDEVMNLVRRDAERIFVGKQSGHHCVPQEQINQILLQQAQSGKRVVRLKGGDPFIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHAKKEG--QLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPATTQVALVENGTSRHQRVVSGELSQLALLSQ--QVSSPSLIIVGSVVSLREKLNWFSSRHHDDQPKVTE. 464
8 -82.300IDP00534 gene: cysG; siroheme synthase YPO3367 [Yersinia pestis CO92]  ali follow..  45  215.GEVALVGAGPGDAGLLTLRGLQVMQQADVVLYDHLVSPEVLDLVRRDAERICVGKRAGAHSVTQEATNQLLVTLAQQGKRVVRLKGGDPFIFGRGGEELQVVAQAGIPFQVVPGVTAAAGATAYAGIPLTHRDHAQSVTFITGHCRPDG-DDLDWQTLARGRQTLAIYMGTVKAAAISQQLIAHGRSSTTPVAVIGRGTRVDQQVLIGTLAQLESLAQQ--APTPALLVIGEVVNLHHQIAWFGQQPQTESAISPS. 467
9 -81.500IDP91260 gene: nasF; uroporphyrin-III C-methyl transferase [Staphylococcus aureus subsp. aureus Mu50] NT02SA2397 [Staphylococcus aureus subsp. aureus Mu50]  ali follow..  38  7.GKVYLIGAGPGNPNYLTKKAERLIREADVILYDRLVNPLILQYANLTTEIIDVGKKPYAKHIQQEKINECIVEAARRYNKVVRLKGGDPAIFGRVQEEVDTLNNFNIAFEIVPGVTSASAAVATMQTGLTMRAVAKSVTFSTGHFKDSEENEVDVNALVN-GGTLAIYMGVKRLGKIIAQI-QQYTDIDYPIAIVFQASCFNEFVVKGRLSNIVGKLEHYAIEKPGICIIGEVVGYTENVSTTSNPT--QQFYVVS. 259
10 -81.100IDP05308 gene: hemD; porphyrin biosynthesis protein [Clostridium difficile 630] CD3420 [Peptoclostridium difficile 630]  ali follow..  52  3.GKVYLVGAGPGDYKLMTLKGLECIRKSDVIVYDRLANSSYLREAKPDCELIYVGKASSNHILPQEDINRIIAEKAKEGKIVTRLKGGDPYVFGRGGEEAETLVDEGIEFEVVPGITSAIGGLCYAGIPITHRDHASSFHVITGHLKGDDSGELNWNALANNKGTLVFLMGISNLEKISENLMKEGKDKDTPVALISWATRYNQRVVTSTLENVYETAIKEEVKPPTLIVVGSVVGLREKLNFFESKPLFGKSIAVT. 258
11 -79.500IDP91222 gene: cysG; siroheme synthase [Shigella flexneri 2a str. 301] SF3387 [Shigella flexneri 2a str. 301]  ali follow..  47  216.GEVVLVGAGPGDAGLLTLKGLQQIQQADVVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKTGG--ELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGTLTQLGELAQQ--MNSPSLIIIGRVVGLRDKLNWFSNH........... 457
12 -79.400IDP91293 gene: cysG; siroheme synthase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] SPA3343 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]  ali follow..  46  216.GEVVLVGAGPGDAGLLTLKGLQQIQQADIVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKTGG--ELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVHGVLTQLGELAQQ--VESPALIIVGRVVALRDKLNWFSNH........... 457
13 -79.300IDP91226 gene: cysG; Siroheme synthase [Escherichia coli CFT073] NT04EC4239 [Escherichia coli CFT073]  ali follow..  47  216.GEVVLVGAGPGDAGLLTLKGLQQIQQADVVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKTGG--ELDWENLAAEKQTLVFYMGLNQAATIQQKLIEYGMPGEMPVAIVENGTAVTQRVIDGTLTQLGELAQQ--MNSPSLIIIGRVVGLRDKLNWFSNH........... 457
14 -79.300IDP91305 gene: cysG; siroheme synthase STM3477 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  46  216.GEVVLVGAGPGDAGLLTLKGLQQIQQADIVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKTGG--ELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVHGVLTQLGELAQQ--VESPALIIVGRVVALRDKLNWFSNH........... 457
15 -63.000IDP93846 precorrin-3 C17-methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006908 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  20  2...LTVIGIGPGSESMMTQDAIAAIREAEIIVGYKTYTHLVKSMTQ-DKQVIKTGMC------KEIERCQAAIDLALAGHNVALISSGDAGIYGMAGLVLELVTQQQLEVRLVAGITASIAAASLLGAPLMHDFCHISLSDLMTPWE---VIEKRIIAAAQADFVICFYNPRSRHLARAFELMQPWKKAATPVGVVKAAGRKKQEKWLTTIGEM----DVEPVDMTSLVIVGNQATYCRNGLMITPR........... 237
16 -53.300IDP93856 cobalt-precorrin-2 C(20)-methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006905 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  18  3.GRLYALGVGPGASDLITVRAARLIAKLDVLYADSLALSIVREYLSPNTEIRTMSADDSEKQAVWDEVAQQLQAEVAQGRQVGFITLGDAMLFSTWVFLLERIGR-PDWLEIVPGVTSFAAIASRAALPLAMEQQSLAVMSCTAPEA-------ELERALRDHDCVVLMKVYGRFAQIQALLGRLNL--FPHALLMSEASLPGEVC----WRQLDSIAADQPLPYFSTILVNKQQLVNE................... 237
17 -34.900IDP93851 cobalt-precorrin-6Y C(5)-methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006912 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  20  2...ITVVGIGPGDADYLTPAARRAIDRAEVLVGGK----RHLATLSSDSK--------ESRLLDADLLGLLEWLDSNKHRAIVVLASGDPLLYGIGKLLAANFSAEEL--HIVPGISAIQYLCAKAALDMND------LFLTSSHGR-----EPDFDWIFQHDKVAMVTDGIIGPRAIADALQQRGL--SRTLIIGENLSQPNERIYRLPAKQVAARYD-----MNVVVILNE......................... 199
18 -29.500IDP01415 siroheme synthase component enzyme VC1363 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  214.SATTWIEFG-ADVELLSLKALRYMQQAELVLHTQDCPFVFVDLCRRDAQRQSFNS--------SVELSTLLLQAQQETQNVCVLSGSSEYALLQGKATVLKMAQQG....................................................................................................................................................... 312
19 -21.800IDP01659 tetrapyrrole (Corrin/Porphyrin) methylase domain protein [Coxiella burnetii RSA 493] CBU_1739 [Coxiella burnetii RSA 493]  ali follow..  21  4.GSLYITATPIGNREDITLRAIDTLRSVDLIA-DTRHSKKLLEHYGIKTPLL------SLHEHNEAARATLLCEKLKQGLNVALISAGTPLISDPGYRLVNAVREAGIEVVPIPGACAAIAALVASGLP------TDRFIFEGFIPSKGEVRRKKLEDLKNQRRTIIFYESVHRIVNLIDLLNEI-FGTERRATIARELTKKFETIHTATLAELKNWINENPVQEKGEFVV........................... 222

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 9 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.