current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP00438 gene: terE; tellurium resistance protein YPO0299 [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDASVFMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNRTGAGDGDDEQIKIDLKKVPADVKKIIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGELYRNNDEWKFKAVGQGFAGGLSALASQHGVSVLast
1 -101.000IDP00438 gene: terE; tellurium resistance protein YPO0299 [Yersinia pestis CO92]  ali  100  1MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDASVFMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNRTGAGDGDDEQIKIDLKKVPADVKKIIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGELYRNNDEWKFKAVGQGFAGGLSALASQHGVSV 191
2 -96.200IDP00027 tellurium resistance protein BA_0400 [Bacillus anthracis str. Ames]  ali follow..  53  2ASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRDGQNDFDLDVSIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGDNRTGEGEGDDESIKVDLKNVPAHIERICFTITIYDGEGRSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVGELYRHAGEWKFNAIGSGFQGGLASLCNNFGLDV 193
3 -94.600IDP00028 tellurium resistance protein BA_0401 [Bacillus anthracis str. Ames]  ali follow..  57  1MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYGGSDFDLDASAFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDNRTGEGEGDDEQLVVDLKKVPADVHRIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCELYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA 194
4 -82.400IDP00026 tellurium resistance protein, putative BA_0399 [Bacillus anthracis str. Ames]  ali follow..  42  1MPIILEKGQKIDLTKGQPKVAKLQVGLGWDPIGQSGPNVDCDASVVMLEGDR-FLNKNDLVYFGNKLSTCGSIIHSGDNLTGEGAGDDETIFVELHKVPSRINRLVFVVNIYDCVNRRQDFGMIRNAYIRIQNPQTGEELARYNLSDNYAGKTTLIAGEMYRHGSEWKFSAVGEGTQDNLSEIVSRY.... 197
5 -74.200IDP00030 tellurium resistance protein, putative BA_0926 [Bacillus anthracis str. Ames]  ali follow..  34  1MIHTLVRGQKIDVTNNHLEIRGLLVDLTWNA----PMNMDVDASAFLVGFNGKITKEEDFVFYGQPYSSCRSVQLNQNE----TNGSKQRFSIDFTHIKDEVQKIVFSITIHNAEEKKQALRDVSHIQLKISNAQSGLEIIHFPITYPFTDESAIIVGELYRHGGGWKFNPIGAGYFGGLAALCTSFGIEI 183
6 -49.900IDP00437 gene: terA; putative tellurite resistance protein YPO0295 [Yersinia pestis CO92]  ali follow..  34  1...........................................................MVFYGQPVTDDSTIRLSGQ-------GVNTAFSVNLQAINHDVQKIAFTATCDGN----QTLSQLGNLSIQVEL--NGSVLMKGDVETQGRQEAALILGELYRRNTEWKFRFVAQGFNGGLKPLAEHFGVVV 119
7 -7.800IDP00080 gene: yneC; putative inner membrane protein NT01ST5073 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  1..........................................................................................MTVILFGIIRGLMMHVTLVEINVHDDKVEQFIDVFRQNHLGSIKEPG--NLRFDVLQDPQVLTRFYIYEAYVDEQAVAFHKTTPHYKTCVEQLEP...... 93
8 -5.550IDP04447 putative type II secretion protein [Yersinia pestis CO92] YPO0690 [Yersinia pestis CO92]  ali follow..  16  138ADARLIDGSRINVAISPIALDGTALSIRKFSKNKRRLEDLVDMGAM---------SSDMANFLIIAASCRVNIIISGGTGSGKTT---------LNALSKYISEDERVITLEDAAELNLEQPHVVRMETRLAGLENTGQITMRDLVINSLRMRPIIIGECRGEETFEMLQAMNTGHNGSMSTL........ 305
9 -5.510IDP93898 fimbrial protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005443 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  10  19..............................VFASAANAGVIKVTGSIAANPCVIKTTSETQNVTMPAIFESDLSKLNA--GGVIDKSAKPIKFELETCPALTSNAVVTFSGTSASDAFSLGSTVKGVALKLFDNQDSNGSATSTTVLGTQTEQTLEYKL--------KYVKTADKFVEGAVDTTINFDIA. 173
10 -5.420IDP05486 putative lipoprotein [Bacillus anthracis str. Ames] BA_4573 [Bacillus anthracis str. Ames]  ali follow..  10  100..........................................................................................................................ELEHIDIKASKAGYVVVETKEKEIDGEITLQKKVQYAIGKEEDGWKIEEV................... 149

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.