current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP01902 gene: potG; putrescine transporter ATP-binding subunit [Salmonella typhimurium LT2] STM0878 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MNDVPHRPQVKTRKALTPLLEIRNLTKSFDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEPPSSGQIMLDGVDLAHVPPYQRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEITSRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGLLKAREEDGLVIDAPGLVHPLKVDADASVVDNVPVYVALRPEKIMLCESPPADGYNFAVGEVAHIAYLGDLSIYHVRLKSGQMISAQLQNAHRYRKGLPTWGDEVRLCWEADSCVVLTVLast
1 -131.000IDP01902 gene: potG; putrescine transporter ATP-binding subunit [Salmonella typhimurium LT2] STM0878 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali  100  1MNDVPHRPQVKTRKALTPLLEIRNLTKSFDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEPPSSGQIMLDGVDLAHVPPYQRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEITSRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGLLKAREEDGLVIDAPGLVHPLKVDADASVVDNVPVYVALRPEKIMLCESPPADGYNFAVGEVAHIAYLGDLSIYHVRLKSGQMISAQLQNAHRYRKGLPTWGDEVRLCWEADSCVVLTV 377
2 -126.000IDP01336 gene: potA; putrescine/spermidine ABC transporter ATPase protein VC1428 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  40  2...GEIQTLNEQHSVGKPVIRLSGISKSFDGKEIIGNLNLDVNHGEFLTILGPSGCGKTTVLRMIAGFETADQGQILLDDQDVTQVPAEQRHVNTVFQSYALFPHMTVFENVAFGLRMQKVPQSEIEPRVMEALRMVRLAEMAQRKPHQLSGGQQQRIAIARAVVNKPKVLLLDESLSALDYKLRKQMQSELKQLQRQLGITFIFVTHDQEEALSMSDRIIVMRSGKIEQDGSPREIYEDPKNLFVARFIGEINVFQATTIDRIDEKRIRVDIEGI-ESIVYYEDEVKAGDKLQVLLRPEDLRIEEIKES-EEKGIVGHVTDRTYKGMTLESVVELESGMCVMVSEFFNEDDPDVDHSIGQKVAVTWVESWEVVLND 373
3 -121.000IDP00713 spermidine/putrescine ABC transporter, ATP-binding protein SACOL1108 [Staphylococcus aureus subsp. aureus COL]  ali follow..  37  1...............MEPLLSLKSVSKSYDDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGEVIYQNKPIGNLPPNKRKVNTVFQDYALFPHLNVYDNIAFGLKLKKLSKTEIDQKVTEALKLVKLSGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELRELQSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNIVEGRMVRDYVVNI-------YGQDFECVDMGIPENKKVEVVIRPEDISLIKAEE----GLFKATVDSMLFRGVHYEICCIDNKGYEWVIQTTKK-------AEVGSEVGLYFDPEAIHIMVP 344
4 -120.000IDP01341 gene: fbpC; ferric transporter ATP-binding subunit VCA0687 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  34  2..............EKQNFVVLKNICKRFGSNTVIGNLDLEIKKGSLVTLLGPSGCGKTTVLRLVAGLEKPTSGQIFIDGEDVTERSIQQRDICMVFQSYALFPHMSLYENVAYGLKMLKLPSEEVRQRVDEALKIVDLEGMGERYVDQISGGQQQRVALARALVLKPKVLLFDEPLSNLDANLRRSMRETIRELQQRFDITSLYVTHDQAEAFAVSDTVIVMKQGDIMQIGTPQELYKAPKSMFMANFMGEANMFQGHFDGQQIHINGYAID------ADLEVTRDKPNGEYQIGVRPEAITLHTQGS----ESQACQILKSAYMGSMYEVTVKWHDQELLLQL-----NSAQFNHTLTQHAYVVFNPRGLFLLPY 349
5 -119.000IDP01671 gene: cysA; sulfate/thiosulfate transporter subunit [Yersinia pestis CO92] YPO3012 [Yersinia pestis CO92]  ali follow..  33  2..................SIEINNISKYFGRTKVLNDITLDIPSGQMVALLGPSGSGKTTLLRIIAGLENQNAGRLSFHGTDVSRLHARDRRVGFVFQHYALFRHMTVFDNIAFGLTVERPNAAAIKQKVGQLLEMVQLGHLAERFPSQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEAMEVADRVVVVSQGNIEQVGTPDEVWREPATRFVLEFLGEVNRLSGEIRGSQLFIGAHHW---------PLDLAPMHQGSVDLFLRPWEMEVSTQSSDR--CPLPVQVLEVSPRGHFWQLTVQPIGWHQDPISVVLPEG-NIDAPVRGNRYYVGGLNARLYSGNQ 352
6 -119.000IDP01669 ABC transporter ATP-binding protein [Yersinia pestis CO92] YPO3048 [Yersinia pestis CO92]  ali follow..  33  2.................IELSVDNLHLTYGDNPVLKGVSMELKRGEVVSLLGPSGSGKTTLLRAVAGLEKPSQGHIIIDGSSHSEIPAEERNLGLVFQSYALWPHKTVSENVAYPLKLRKISTSEISQRVQAVLEQLGLGALGNRHPHQLSGGQQQRVAIGRALVYNPPVILLDEPLSNLDAKLREEARVFLRELIMNLGLSALMVTHDQNEAMAISDRILLLNNGKIEQQGTPQEMYGSPSTLFTAEFMGSNNRLHGKIIDVRDGKARIEGKDWG--LWGWAGEGVTAGQEGTAVIRVERVRLGDNLDG---NQLELPLLTSMYLGDRWEYLFRTVADDFVIRA-------YGPEVRGKESCHLSLPTEHLWIFP. 354
7 -117.000IDP01490 ABC transporter, ATP-binding protein VCA0602 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  34  16MHHPNLQQHDRPQAISRSYLDIRHVVKQFGSFTALKEISLSIEKGEFVCFLGPSGCGKTTLLRAIAGLDLPTSGTIHQNQQAITFLPPEQRDFGIVFQSYALFPNLTVEENIAIGLRNQGMSVRDALEKVEQWLEMIGLATSAQKYPSQLSGGQQQRVALARALALSPGLLLLDEPLSALDAKVRTHLREEICQLQRKLGITTIMVTHDQEEALTMADRIVVMNHGVIEQVGTPQEIYQKPASRFVAEFVGTMNFIPVSMASSQQLRIAES----LIALPKIENYTPCQGEQFDLAVRPENLELVTRYN----EAIPVVIRHLEFLGAFYRVECVFQGERLAPPVYVDITQVQTMNLKAGDVRYLALRAGQLRAYRR 386
8 -111.000IDP00988 gene: yehX; putative ABC-type proline/glycine betaine transport system ATPase component STM2163 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  32  1..................MIEFNHVSKTFGDQQAVSDLNLHFSEGSFSVLIGTSGSGKSTTLKMINRLVEHDSGTIRFAGEEIRSLPELRRRMGYAIQSIGLFPHWTVAQNIATVPQLQKWSRARINDRIDELMALLGLEALRDRYPHQLSGGQQQRVGVARALAADPQVLLMDEPFGALDPVTRGALQQEMTRIHQLLGRTIVLVTHDIDEALRLADHLVLMDGGHVIQQGSPLSMLTSPENDFVQAFFGRSELGVRLLSLRSVGDYVRRHEQLS-GDALVEEMTLRDALSMFVARRCDVLPVANQQ-----GEPCGTLHFRDLLSETSPRETTV......................................... 315
9 -110.000IDP01501 maltose/maltodextrin transporter ATP-binding protein VCA0946 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  33  2.................ASVTLKNVCKAYGDVLISKNVDLEIQEGEFVVFVGPSGCGKSTLLRCIAGLEDITSGDLYIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKADKSEIKKRVDHAAEILQLSHLLDRQPKALSGGQRQRVAIGRTLVSQPNVFLLDEPLSNLDAALRVQMRSEITKLQRKLGCTMIYVTHDQVEAMTMADKIVVLDAGFVSQVGKPLELYHYPQNRFVAGFIGSMNFMSVFIEGVEKDRVQVQLSNGTTFWIPVDGTTVTRGERMSLGIRPEHLVEAEHGD----AKIEGKVMIVEKLGNETQVYMNLKGSDSDVIYRQP----DTLDVETGDTLTIGIPAHRCHLFHS 355
10 -110.000IDP02039 putative ABC transport ATP-binding subunit [Yersinia pestis CO92] YPO1198 [Yersinia pestis CO92]  ali follow..  35  1..................MIQFHQVSKYFAGKRAVDNLSLQISKGEFTVLIGTSGSGKSTTLKMINRLIEHDEGKIRFAGEEIRNYKPERRRMGYAIQSIGLFPHWTVERNIATVPQLLKWPKDRIRQRVVELLELLHLQQFCHRYPHQLSGGQQQRVGVARALAVDPEVLLMDEPFGALDPVTRSALQLEITRIHQLSGRTIVLVTHDIDEALSLADRIVLMDEGRVIQQGTPLEMLAQPANDFVRDFFGRSDLGIKLLSLGRVEQRVRCGETLA-GQPILGTTSLREALSLFVSRQTDKLPVADEH-----GQPLGVLYFADLVANKERV............................................. 312
11 -109.000IDP02079 iron ABC transporter, ATP binding subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0173c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  32  2..................MLEIKNLSKNFGKIQALENINLHVKEGEFLSILGGSGSGKSTLLRIIAKLEQASSYDL----------FSCKGEVALMFQNYALFPHLNVEKNILFALYDKK----DKNQILNHLLKTFEIEDLRYKKIDEISGGQAQRVAFARAMARGCKLLLLDEPFSNLDQNLKQDLRRELKKMIENQGITAIMVTHDIEDAYCMSDQIAFLEKGKILAHANPKELYFKPDF-KSAQILPDLNIIEEKLDL---------------------------EDEFFAWIASKNYIFGYAELKIG-NRFEAKILQKEFLGAFCRLKLLYKNIIFFILV--------SSSYDLEEKISFDIIN........ 301
12 -109.000IDP01389 iron(III) ABC transporter, ATP-binding protein VC0610 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  37  1...............MSCALLIENLTCQYDAQTVLKSLSLQVNPGEIVCLLGASGCGKTTLLKAIAGLLPLASGQLSLNCVTLDDLPPEQRNIGMIFQDYALFPHLTVAQNVGFGLD--AMPAKQKEAKIAEMLALVHLDAFAERYPHQLSGGQQQRVAIARALAYKPDLLLLDEPFSNIDTQVRHELIIEIRKIFKQQGVTAIFVTHSREEAFAFADKMAVMNRGVIEQYGTAAELYYQPSSQFVADFLGGGSYLSAKRISETQYQTALG------VVEAIARQPIAVEAECKLLLRPQQVQIRAE------EESSVTVTEQQFMGDHCRYLIDAHGTQLIA--------TSSQPLELGQAVSVNIDTQGVLAFA. 343
13 -107.000IDP00430 gene: sfuC; iron(III)-transport ATP-binding protein YPO2960 [Yersinia pestis CO92]  ali follow..  32  2.................STLELHHIGKSYQSVMVLDRIDLHVPPGSRTAIVGPSGSGKTTLLRIIAGFETPDAGKVILQGKAMFDVPAHKRGIGFVPQDGALFPHFTVAGNIGYGLKGS---QRDKERRINELMDMVALDRLSALWPHEISGGQQQRVALARALAQRPVLMLLDEPFSALDTALRASTRKAVAELLSEANIASILVTHDQTEALSFADQVAVMRAGKLAHVGPPQELYLRPVDEPTATFLGETLMLTAQLGTGLAHCALGQVK----------VDNPHRRGEARIMLRPEQITLTPLRPEQNAASCLAKVIAIDFAGFISTLTLQIISSGETIE----IKTISREDLHVGLTVGLDIMGQAHIFA.. 348
14 -104.000IDP02381 gene: proV-1; glycine betaine/L-proline ABC transporter, ATP-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2279 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  32  1..................MIQFNQVSKSYEDTKAVDSLHLEIKKGEFFVLIGPSGCGKTTTMKMINRLIETTEGSILIDGKDIQQYNINRWDIGYVLQQIALFPHMTIAENIAVVPEMRKWSKEKIKARVDELLQMVGLDPYRNRMPDELSGGQKQRIGVVRALAANPKIVLMDEPFSALDPLSREQLQKDIVQLQKKIQKTIVFVTHDMQEALSLGDRICIMKEGKVVQLDTPEGIIHNPKNEFVEEFIGNRGRPWYEGKSIEDVLPLDE----SIRIEGEALSLHSSLQEALVRLRADEVVPVEEK-----GRYVGALTSRHIVNYIVEQMKERG........................................ 315
15 -104.000IDP00760 maltose ABC transporter, ATP-binding protein, putative SACOL0192 [Staphylococcus aureus subsp. aureus COL]  ali follow..  34  2.................AELKLEHIKKTYNNNTVVKDFNLHITDKEFIVFVGPSGCGKSTTLRMVAGLESITSGDFYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLRKVNKKEIEQKVNEAAEILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRTEILKLHKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREIYDAPNCIFVAQFIGSMNMLNATVEMDGLKVGTHHFK-LHNKKFEKLKAAGYLDKEIILGIRAEDIHEEPIFQTSPETQFESEVVVSELLGSEIMVHSTFQGMELIS------KLDSRTQVMANDKITLAFDMNKCHFFDE 358
16 -103.000IDP01423 gene: ugpC; glycerol-3-phosphate ABC transporter, ATP-binding protein VC1552 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  32  5.QNSNIHLLRSAKHAEPVMLDIKQLVKTYDNHQAVKGVDLSIHQGEFIVLVGPSGCGKSSILRSIAGLESITSGEIHLAGRRVDNEKPANRDIAMVFQNYALYPHMSVYDNLAYGLKNRGVDKQTIAAKIAKVAKTLKIEEYLDRKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDAALRAHMRLEIKKLQRELGVTSVYVTHDQVEAMTLADRIVVVKQGEIEQVGTPAEVYHQPASTFVASFIGSMNFLPASIKQGQ-----LHIAGKHCYLPQF---DAMSSENITLGIRPEHASLHPLTNA---IELKLDIQVVEPLGPNQLVHGKIIGLESEQDFIAVT---AEIPLDVHQTLPIWVALEQLHLFDQ 369
17 -103.000IDP02608 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0178 [Coxiella burnetii RSA 493]  ali follow..  41  1..................MITLDRITKFYRSSPAVDSVSFEVKDGETLVLLGSSGSGKTTLMKMINRLIEPTSGTIKIEGKDVRNLSELRRSIGYVFQQIGLFPHMTIEKNITILLKLLHYPKAKRIQRAAELLEMVHLQKFAQRYSDELSGGQQQRVGVARALAADPKYLLMDEPFGALDAMTRSALQEEMIHLNQKLGKTIVFVTHDIFEAFRIADRIAVMHKGKLEQIGTKNELLNNPATEFVEQLVKQPAQQIEDLEKNR................................................................................................................. 252
18 -99.000IDP00730 amino acid ABC transporter, ATP-binding protein SACOL2453 [Staphylococcus aureus subsp. aureus COL]  ali follow..  30  1..................MLSIKHLTKIYGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQIEIDGKDVRSMNPVRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKELIKLVDLESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQNRLIQDRPNDKTVEGVMIKPITIQAE---------ATLNDAVHIMRQKRVDTIFVVDSN--NHLLGFLDIEDINQGIRGHKSLRDTMQQHIYTVQI-----DSKLQDSVRTILKRNVRNVPVVDD 347
19 -96.100IDP00696 amino acid ABC transporter, ATP-binding protein SACOL2410 [Staphylococcus aureus subsp. aureus COL]  ali follow..  36  1..................MIQLTNIHKSFNDVEVIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYVNGKTYTSKDKKRKQSGMVFQSYNLFPHKTALENVMEGLTVKKLKKDEARGKSLELLEKVGLTHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVIKDLANE-GMTMVIVTHEMRFAKEVSNNIVFIHEGMIGEQGAPEEMFNRPKTEELRRFLNVIN........................................................................................................................... 241
20 -96.000IDP02339 gene: proV; glycine betaine/L-proline transport ATP-binding protein [Yersinia pestis CO92] YPO2647 [Yersinia pestis CO92]  ali follow..  28  10LYKVFGEHPERAFKLLESGKNKEQIFAKTGLSVGVKDANLAIEEGEIFVIMGLSGSGKSTLVRLLNRLIEPTRGEVLIDGEDIAKISDRRNKISMVFQSFALMPHLNVLDNTAFGMELAGIPLLERNEKALEALRQVSLDSYANSYPDELSGGMRQRVGLARAMANNPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQGGEVVQVGTPDEILNNPANDYVRTFFRGVDITHVFSAKDIARRRPASL---------IRKTPGFGPRSALKLLQDENRDYGYVLERG--QKFIGVVSIESLKKALAEHQPLDSALLAEPAPVPADM-------PLSELISLVAQAPCAVPVI. 373
21 -95.000IDP02474 gene: pebC; amino acid ABC transporter ATP-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0922c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  33  1..................MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVNNLVLNHIEICRKYCAMVFQHFNLYPHMTVLQNLTLAMKLQKKSKKEAEETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLGKILK.......................................................................................................................... 241
22 -94.600IDP01355 amino acid ABC transporter, ATP-binding protein VC0008 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  33  1..................MIKLQNIHKRFGTSEVLKGIDLEIQRGEIVVIIGSSGTGKSTLLRCVNFLEQADQGSIRIDELTVDDVLALRRKTGFVFQNYALFAHLTARQNIAEALTVRGWKKAQAHQRAQQILDDIGLGDKGDSYPAALSGGQQQRVGIGRAMALQPELLLFDEPTSALDPEWVGEVLALMKKLATQ-HQTMLVVTHEMQFAKEVADRVIFMAEGKIVEQGSPQDIFDHPQDPRLRKFLNQVGI.......................................................................................................................... 244
23 -92.200IDP01607 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1608 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  27  2.................CDISFKNVSFYRDSRCIYDDITFTIPTNKITTILGPSGAGKTTILQLIAGLIKPTLGKICIDNAIITQLEKLRHRMGFLFQSGALFTHLSVYDNIAFPLRKNNLDEKLIRNIVLLKLQAVGLAHTINMMPSELSGGMARRVALARSIAMDPDIMMYDEPFTGQDPASFNKLLELISTLNESLNMTSIIVSHDIQESLSISDHIIIVGNKKIIASDSPENIK-NSKDQQIQNFLAGKPLDYNYHNHNDLEKNFFKKE........................................................................................................ 263
24 -92.200IDP00939 gene: glnQ; glutamine ABC transporter ATP-binding protein STM0828 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  36  1..................MIEFKNVSKHFGPTQVLHNIDLNIRQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPKVDRQEAGMVFQQFYLFPHLTALENVMFGLRVRGVKKEEAEKQAKALLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQDLAEE-GMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGSPQALIENPPSPRLQEFLQHVS........................................................................................................................... 240
25 -92.000IDP01505 amino acid ABC transporter, ATP-binding protein VCA1037 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  35  2.................KVIEFHQVSKWYGQFQALKSISLTVNKGEIVVICGPSGSGKSTLIRTVNGLESIDSGEIIVLP-ELDERTRRSGKIGMVFQHFNLFPHLTVLENLTLAIRTLKLSAQEAKERAYHFLQRVKITDQTHKYPIQLSGGQQQRVAIARSLCMQPEILLFDEPTSALDPETINEVLEVMVDLAQD-GITMMCVTHEMGFARKVAHRVMFMDEGEILEVGSPEQLFQNPTHPRTQQFLNQIL........................................................................................................................... 237
26 -91.500IDP01641 gene: artP; amino acid ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0481 [Coxiella burnetii RSA 493]  ali follow..  32  2.................NKIQVESLKKSYHGTVVLKEVSFAAKAGEVVTLLGDSGAGKSTLLRCLNLLEMPDEGRMVINDLEFHSLIALRSKVGMVFQQFHLWAHRTILQNLEAPCQVLKISKAEAVKKAECLLDQVGILAKKDDYPARLSGGQQQRAAIARALMMEPEVMLFDEPTSALDPKMITAMRDLIHELAQK-GMTIVIATHEMKFAREVAHKTVFLHEGRIVEEGQPEVMFRSPKTQVFGDFIASVG........................................................................................................................... 249
27 -90.200IDP00978 gene: yecC; putative amino-acid ABC transporter ATP-binding protein YecC STM1951 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  35  2.................SAIEVTNLVKKFHGQTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLLEQPEAGTIKVGDIIIDLIRQLRQHVGFVFQSFNLFPHRTVLENIIEGVIVKGEPKAEATALARELLAKVGLAGKESRYPRRLSGGQQQRVAIARALAMRPEVILFDEPTSALDPELVGEVLNTIRQLAQE-KRTMVIVTHEMSFARDVADRAIFMDQGQIVEQGPAKTLFADPQHPRTRQFLEKFLV.......................................................................................................................... 249
28 -90.200IDP01414 amino acid ABC transporter, ATP-binding protein VC1359 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  32  1.........MTQQLNQDFMIQIKDMNKWYGEFHVLKNINLNVKKGERIVICGPSGSGKSTMIRCINRLEEHQKGQIIVAGNELTNIELVRREVGMCFQHFNLFPHLTVLENCTLAIWVKKMPKDKAEEIAMKYLTRVRIPEQADKYPGQLSGGQQQRVAIARSLCMNPQIMLFDEPTSALDPEMVREVLDVMVELAEE-GMTMLCVTHEMGFAKEVADRVIFMDAGEIIEENNPKEFFENPQSDRTQNFLAQIL........................................................................................................................... 249
29 -89.900IDP00933 gene: gltL; glutamate/aspartate transporter STM0662 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  31  1..................MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQKGEITVNGIIVNDLAKLRSRVGMVFQHFELFPHLSIIENLTLAVKVLKRDKAAARDKGLKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMVELANE-GMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKEEFFANPSSDRAKDFLAKIL........................................................................................................................... 240
30 -89.700IDP01147 amino acid ABC transporter, ATP-binding protein BA_0639 [Bacillus anthracis str. Ames]  ali follow..  35  2..................LIEFRNVNKYYGNFQVLKDINVQVKKGEVVVVVGPSGSGKSTLLRCINQLESITDGELIVQNTEVHDMNELRRNIGMVFQHFYLYPHKTVLQNITLAIKVNKISKEEAEKTAMFYLEKVGIPEKANVYPHQLSGGQQQRVAIARGLAMQPEIMLFDEPTSALDPEMIGEVLDVMKTLAKE-GMTMVVVTHEMGFAREVADRILFMDDGKIIEDTTPAQFFASPEQERARLFLSRVL........................................................................................................................... 241
31 -89.600IDP02015 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0107 [Coxiella burnetii RSA 493]  ali follow..  29  1..................MIELRNVTKTYGGVLALSDINLRVSAGEMFGVIGKSGAGKSTLIRCVNLLERPDKGSVIVDGQVLTTLSSKRHRMGMVFQHFNLLSARTAYQNIAFPLQLLGKNPTEIRKVVLPLLELTDLTAKINAYPSQLSGGQKQRVAIARALVTNPTVLLCDEMTSALDPETTHSILQLLKNINRELNLSILLITHEMEVIKTVADRVAVLDQGRIVEENDVVSLFKRPKTEIAKKFTHSSIKVKLPEILRNRLQKTTLDEGYAL-LRIDFTEHTAETPIIDEFIRKFDLQVN........................................................................ 295
32 -89.400IDP00935 gene: modC; molybdate transporter ATP-binding protein STM0783 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  5.......................NFSQTLGTHCL--TLNETLPASGITAIFGVSGAGKTSLINAISGLTRPQKGRIALNGRVLHDLTPEKRRIGYVFQDARLFPHYKVRGNLRYGMAKSM------TGQFDKLVSLLGIEALLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLAREINIPMLYVSHSLDEILHLADKVMVLEDGQVKAFGPLEEVWGSSVMHPWLPKEQQSSILKVSVLEHHPHYAMTALALGDQHLWVN-KLNQPLQSTLRIRIQASDVSLVLQPPQQTSNVLRAKVANCYDDNGQVEVQLEIGGRTLWA--RISPWARDELNIKPGLWLYAQVKSVSIT.... 351
33 -89.100IDP01113 amino acid ABC transporter, ATP-binding protein BA_0368 [Bacillus anthracis str. Ames]  ali follow..  37  1..................MIQVRNLVKSFGSLDVLKGIDLEVNEKEVVVLIGASGSGKSTLLRCLNFLEMYDEGEIHLQGERIDNLNKVRENVGMVFQHFNLFPHMTSLENIIEAIHVKKLETANAKEIGNQLLQKVGLQDKADVTPHLLSGGQKQRIAIARALAMNPKIMLFDEPTSALDPELVGEVLQVMKELAEE-GMTMVIVTHEMNFARDVADRVIFMDDGKIVEDAPPAQFFSTPSHERAKQFLRNV............................................................................................................................ 239
34 -88.300IDP00944 gene: artP; arginine transporter ATP-binding subunit STM0891 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  32  2..................SIQLNGINCFYGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLTIAGNHFDAIRELRQNVGMVFQQYNLWPHLTVVQNLEAPCRVLGLTKDQALARAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIHELAET-NITQVIVTHEVEVARKTASRVIYMENGHIVEHGDA-GCFAHPQTEAFKNYLSH............................................................................................................................. 242
35 -88.000IDP01464 ABC transporter, ATP-binding protein VC2520 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  30  2..............SQSDLVTIKNLRFSRSQRVIFDDIDLHVPKGKVTAIMGPSGIGKTTLLRLIGGQLLPEQGEIWFDGENIPTLSRRRKKMSMLFQSGALFTDLNVFDNVAYPLREHELDEAMIKTLVLLKLEAVGLRGAAYLMPSELSGGMARRAALARAIALDPELIMYDEPFVGQDPITMGVLVELIRNLNRALGVTSVVVSHDVPEVMSIADWVYLLADGKVIAQGSPQALRDNPDPRVQQFLCGDADGPVPFRFPAQPIEQEL........................................................................................................... 263
36 -88.000IDP01758 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0728 [Coxiella burnetii RSA 493]  ali follow..  31  1.........MTAIEPSEPLIEIHGLCNEFGEQRVHDDLNLTIHRGEIVAIIGPSGCGKTTLLRSILMLRKPTAGTINVFGINILECSRAQRRWGVMFQSSALFSSLRVLENVLFPLHEYSLHSEAQTKLALLKIALVGLDRAVPKYPAELSGGMKKRAALARAMALDPELLFLDEPTTGLDAKSARELNELILHLRKTLELTFVMVTHDLDTLWQVPDRVFFLGEGKVLAALPM-DGLVHHKHPLIQDYFGSGKRTFRDKLERGVK............................................................................................................... 263
37 -87.700IDP00706 ABC transporter, ATP-binding protein SACOL0504 [Staphylococcus aureus subsp. aureus COL]  ali follow..  31  1..................MIEFRQVSKTFNKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNGQVIVDGHDITNYSDKKKDIGMIFQHFNLLNSATVFKNVAMPLILSKKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCDEATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTVKEVFSHPKTTIAQNFVSTVIQTEPSTSLIRRLNDEQVGDFKDYKIFVEETQ--VTQPIINDLIQICGREVK........................................................................ 294
38 -87.600IDP01155 Methionine import ATP-binding protein metN 2 BA_0312 [Bacillus anthracis str. Ames]  ali follow..  31  1..................MISFNNVSKVYQSVHAVEDVTLSVEKGEIFGIIGFSGAGKSTLLRLVNMLERPTAGTISIDDKDITSLSTKRQRIGMIFQSFNLFNSRTVFGNIAYPLKLAKVPKNEIKERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILICDEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEEGKLFDVFTQPKTTTTQNFVRSVINDHLPESVLA------KIQNGGQIYRLTFTGEETGQPVLSYIAKNYNVDVN........................................................................ 290
39 -87.100IDP00916 gene: metN; DL-methionine transporter ATP-binding subunit STM0247 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  31  1..................MIKLSNITKVFQQIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVQVGGQELTTLSESRRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPM-LRMEFTGQSVDAPLLSETARRFNVNNN........................................................................ 295
40 -86.500IDP01431 amino acid ABC transporter, ATP-binding protein VC1864 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  34  2..............TDVPALEIKNLHKTFGQNEVLKGISLQAQKGDVISIIGSSGSGKSTFLRCINLLETPTAGEIWVKGELIQQVQRIRSRLAMVFQSFNLWSHMTVLENVIEAVHVLGVPKAQAIEQAERLLRKVGLYERKDYYPGHLSGGQQQRAAIARALAVEPEVMLFDEPTSALDPELVGEVLGVMRDLAEE-GRTMLVVTHEMAFARDVSNHVMFLHQGKVEEQGKPEKLFKNPDSERLKQFISS............................................................................................................................. 254
41 -86.100IDP00635 gene: modC; molybdenum ABC transporter, ATP-binding protein ModC SACOL2270 [Staphylococcus aureus subsp. aureus COL]  ali follow..  32  1.....................MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQLLTDVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPS--------EHIDQLIQTLNIDHLMKQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPIIFVTHSNYEAEQMAHEIITIG......................................................................................................................................................... 201
42 -85.900IDP90824 ABC transporter ATP-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0774c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  28  1..................MIKIKNLKKYYGKELVINDVSLEIKKGEIYAIVGHSGAGKSTLLRCINGLENYQEGSLKVFDQEIKDLSQKRKDIGMIFQNFALMERKNVFENVAMPLRTHYMSEKEIAQKVNSLLEIVGLDHKNKSYPRELSGGQKQRVAIARALALNPKILLSDEATSALDPNTTKNILELISKINAEFGITVVLVTHEMDVVKDIAQKALLLEHGQIIGSGAIDELFLRPNA-KMKEFLGESDFLPEHGLN----------------IKLYFPKEVAQNSVITHMARTLNIDF---------NIVWGKI-EKLNGKALGNLVININEKDKDKV................................. 321
43 -85.100IDP02457 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1248 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  31  2...............SESLIQVRDLSTKFGKEWIHKDLNLDIPFEKISCIIGASGCGKTTLMREILMLQPIYSGKIFLLGQEISKLADNSSKMSMMFQHCALFSSLTNLQNVIFPLRQHKLPIDILTDIAIIKLKMVGLKEAFNKYPSEISGGMLKRVALARTIALDPKVVFLDEPNAGLDPYSARAMDDLILYLKEELKMSVVMITHDLSTIWHIVDDIIYMDEKRIMLHDSVEFVSQQTQYESIRKFFDSHNDGK........................................................................................................................ 252
44 -83.800IDP01340 phosphate ABC transporter, ATP-binding protein VCA0073 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  2...............KTTKFNIENLDLFYGENQALKSINLPIPTRQVTALIGPSGCGKSTLLRCLNRMNDLIEGKLTMDGQDVYDVSDLRIRVGMVFQKPNPFP-MSIYENVAYGLRAQGIKDKKHLDEVVERSLWDEVKDRLKSHAFGLSGGQQQRLCIARTIAMEPDVILMDEPTSALDPIATHKIEELMEDLKK--NYTIVIVTHSMQQARRISDRTAFFLMGELVEHDDTQVIFSNPRDDRTRGYVNG............................................................................................................................. 248
45 -83.000IDP01763 gene: ssuB; aliphatic sulfonates transport ATP-binding subunit [Yersinia pestis CO92] YPO3627 [Yersinia pestis CO92]  ali follow..  33  2........TTLTHIPQGTPITLESIGKRYGNRTVLDNLQLRITAGQFVAVVGRSGCGKSTLLRLLAGLEAASDGTLLSGNALLSHAKD---ETRLMFQEARLLPWKKVIDNVGLGLR------GHWRDEALQVLDTVGLADRANEWPAALSGGQKQRVALARALIHRPRLLLLDEPLGALDALTRIEMQGLIERLWQQHGFTVLLVTHDVSEAIALADRVLLIEEGRIGLDLAID--LPRPRRKGSAKLAALEAEVLERVLSPPQG............................................................................................................... 248
46 -79.700IDP01333 phosphate ABC transporter, ATP-binding protein VC0726 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  27  8LGYYVPPLDVNNLTDQQTAISIEHLSLYYQQSRALSDISMRIPKGQVTAFIGPSGCGKSTLLRCINRMNDLVEGEVKLHGKNIYDVPTLRRRVGMVFQRPNPFPK-SIYENVVYGLRLQGINSRALDDAAEQSLRAAALKHRLHENAFGLSGGQQQRLVIARAIAIEPEVLLLDEPTSALDPISTLTIEELIHDLKT--KYTVVIVTHNMQQAARVSDHTAFIHMGKLIEYADTDSIFTSPLKKQTEDYIT.............................................................................................................................. 269
47 -79.200IDP00717 phosphate ABC transporter, ATP-binding protein SACOL1421 [Staphylococcus aureus subsp. aureus COL]  ali follow..  26  19.VSQSHHKTPDDTNSHSVIYSTQNLDLWYGENHALQNINLDIYENQITAIIGPSGCGKSTYIKTLNRMVEKTAGKILYRDQDIFDQKYSRTNVGMVFQQPNPFPK-SIYDNITYGPKIHGIKNKKVLDEIVEAAIWDELKDRLHTNAYSLSGGQQQRVCIARCLAIEPEVILMDEPTSALDPISTLRVEELVQELKE--KYTIIMVTHNMQQAARVSDKTAFFLNGYVNEYDDTDKIFSNPSNKKTEDYIS.............................................................................................................................. 279
48 -79.200IDP00731 ABC transporter, ATP-binding protein SACOL2462 [Staphylococcus aureus subsp. aureus COL]  ali follow..  27  2..................LLEIKDLVYKASDRIILDHISLKVDKGESIAIIGPSGSGKSTFQKQICNLFSPTSGELYFKGKPYNDYDPERQRISYLMQQSDLFGE-TIEDNMIFPSLARN--DKFDRKRAKQLIKDVGLGHYQSSEVENMSGGERQRIAIARQLMYTPDILLLDESTSALDVNNKEKIENIIFKLADQ-GVAIMWITHSDDQSMRHFQKRITIVDGQISNTEELNQ............................................................................................................................................. 218
49 -78.800IDP06323 phosphate transporter ATP-binding protein [Streptococcus pneumoniae TIGR4] NP_345855 [Streptococcus pneumoniae TIGR4]  ali follow..  22  3.TYNWDEKHILTFPEEKVALSTKDVHVYYGKNESIKGIDMQFERNKITALIGPSGSGKSTYLRSLNRMNDKVTGQILYRGIDVNNVYEMRKHIGMVFQRPNPFAK-SIYRNITFAHERAGVDKQVLDEIVETSLRQAALKDDLHKSALTLSGGQQQRLCIARAISVKPDILLMDEPASALDPIATMQLEETMFELKK--NFTIIIVTHNMQQAARASDYTGFFYLGDLIEYDKTATIFQNAKLQSTNDYVSG............................................................................................................................. 264
50 -78.700IDP01150 Phosphate import ATP-binding protein pstB (Phosphate-transporting ATPase) (ABC phosphate transporter) BA_4493 [Bacillus anthracis str. Ames]  ali follow..  24  6VNVQVKNEEKIETAPKKVVFDTKNLNLWYGEDHALKDINLSIHENEVTAIIGPSGCGKSTYLKTLNRMVERTTGVIEYRERNIFPVEELRTHVGMVFQKPNPFPK-SIYENVAYGPKIHGISDKKTLDEIVEAAIWDELKDRLHDNAYGLSGGQQQRLCIARCLAIEPDVILMDEPTSALDPISTLKVEELIQELKK--DFSIVIVTHNMQQAARISDKTAFFLSGEVVEYTDTNKLFTTPSDKRTEDYIT.............................................................................................................................. 267
51 -78.700IDP00608 phosphonate ABC transporter, ATP-binding protein SACOL0127 [Staphylococcus aureus subsp. aureus COL]  ali follow..  26  2.................SQIEFKNVSKVYPNHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGEIFIQGKSITKAHGKRRNIGMIFQHFNLVKRSSVLRNVLSGRMVLGLFPKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDPLTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVFSEIYGRTIKEDEKLG........................................................................................................................ 255
52 -78.600IDP01125 ABC transporter, ATP-binding protein BA_5175 [Bacillus anthracis str. Ames]  ali follow..  27  3........................ILKDVTYKDILHIPYLQIQKEKITCIIGESGSGKSTLLRMLNDLQSPTSGIIEYNGKLISDYPPIRRDVVMLGQTPPIF-DGTIKDNLLMGLRLSEKPFPN-DDILRSALKTISLEKNLEDNADSLSGGEKQRLAFARIVLMDPPVYLLDEPTSALDSDTERRVMKQFTTLAREKKKTVIFITHSQQLPEEIADDIIEISKA---NGATRKEVLSVEGR...................................................................................................................................... 218
53 -76.800IDP01067 gene: pstB; phosphate transporter subunit STM3854 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  30  1.........MSMVETAPSKIQVRDLNFYYGKFHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKMEQRAEGEILLDGDNILDIALLRAKVGMVFQKPTPFP-MSIYDNIAFGVRLEKLSRADMDERVQWALTKAALKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLDEPCSALDPISTGRIEELITELKQ--DYTVVIVTHNMQQAARCSDHTAFMYLGELIEFSNTDDLFTKPAKKQTEDYIT.............................................................................................................................. 253
54 -70.000IDP06166 ABC transporter ATP-binding protein [Helicobacter pylori J99] NP_223403 [Helicobacter pylori J99]  ali follow..  28  1...............MSVIIAANNLCLQYQNEPVIKHANLRIKRKDFVFISGPSGSGKSTLLRSFYGDLKVFSGKLEVCNINMNNASKSRKNIGVVFQDYKLIQDYTIEQNIKLPMVICGIKKEECHLQLEKLLGHIDLRHKANRYPKELSGGEQQRVAMARAMANCPELILADEPTGNLDDYSSDKIWSLLRGMNTQLNATIVVVTHKFPKNFSAYHRKFYIEEGEVYEYS................................................................................................................................................. 223
55 -67.000IDP01157 Phosphonates import ATP-binding protein phnC BA_3749 [Bacillus anthracis str. Ames]  ali follow..  31  1..................MIEFRNVSKVYPNTKGLNNINLKIQKGEFVVMVGLSGAGKSTLLRSVNRLHEITEGEIMIEGESITAAKGKRRDIGMIFQSFNLVKRSTVLKNVLAGRTTLGLFPKEDLELAFQSLKRVNILEKAYARADELSGGQQQRVSIARALAQEAKIILADEPVASLDPLTTKQVLEDLKKINEDFGITTIVNLHSIDLARQYATRIIGLHAGEIVFDGLVEEATDEKFAEIYGDVVQKS............................................................................................................................ 249
56 -66.600IDP00547 gene: ftsE; cell division protein FtsE YPO3813 [Yersinia pestis CO92]  ali follow..  33  1..................MIRFEQVSKAYGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLLKLICGIERPSAGHIWFGGHDISRLKNRRRQIGMIFQDHHLLLDRTVYDNVAMPLIIAGASSEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRV-GVTVLMATHDTSLIARRRYPILTLSQGRMSG................................................................................................................................................... 217
57 -66.600IDP00865 gene: ftsE; cell division protein FtsE STM3570 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  33  1..................MIRFEHVSKAYGGRQALQGVTFHMRPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIFFSGHDITRLKNRRRQIGMIFQDHHLLMDRTVYDNVAIPLIIAGASGDDIRRRVSAALDKVGLLDKARNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRV-GVTVLMATHDIGLISRRSYRQLVLSDGHLHG................................................................................................................................................... 217
58 -66.500IDP02371 gene: ftsE; cell division ABC transporter, ATP-binding protein FtsE [Coxiella burnetii RSA 493] CBU_1904 [Coxiella burnetii RSA 493]  ali follow..  32  1..................MIRFANVTKNYPGHQALNNISFTLKQGEMAFLTGHSGAGKTTLLKLMMMIEAITRGQIYINNRNLSRLSKRRRRIGMIFQNPQLLYHRTVFDNVGIPLVISGYRHSEIKRRVRAALDKVGLLKKEKLYPFSLSTGEQQRIGIARAIVNKPMLVIADEPTGNLDPELSSEIMRLFEAFNAV-GVTVLIATHDLSLIAPLNYRIITLKEGRLVE................................................................................................................................................... 217
59 -65.500IDP06314 cell division ABC transporter ATP-binding protein FtsE [Streptococcus pneumoniae TIGR4] NP_345254 [Streptococcus pneumoniae TIGR4]  ali follow..  31  2.................SIIEMRDVVKKYDGTTALRGVSVSVQPGEFAYIVGPSGAGKSTFIRSLYREVKIDKGSLSVAGFNLVKIKKKRRSVGVVFQDYKLLPKKTVYENIAYAMEVIGENRRNIKRRVMEVLDLVGLKHKVRSFPNELSGGEQQRIAIARAIVNNPKVLIADEPTGNLDPDNSWEIMNLLERINLQ-GTTILMATHNSQIVNTLRHRVIAIENGRVVRDESKGEYGYD......................................................................................................................................... 229
60 -65.400IDP00729 ABC transporter, ATP-binding protein SACOL2356 [Staphylococcus aureus subsp. aureus COL]  ali follow..  27  2..................ALVVEDIVKNFGETKVLKGINFEVEQGEFVILNGASGSGKTTLLTILGGLLSQTSGTVLYNDAPLFDKQHRLEDIGFIFQSSHLVPYLKVIEQLTLVGQEAGMTKQQSSTRAIQLLKNIGLEDRLNVYPHQLSGGEKQRVAIMRAFMNNPKIILADEPTASLDADRATKVVEMIRQQIKEQQMIGIMITHDR-RLFEYADRVIELEDGKITD................................................................................................................................................... 221
61 -65.300IDP01158 ABC transporter, ATP-binding protein BA_4669 [Bacillus anthracis str. Ames]  ali follow..  31  2.................SVLEVKGLTKVYQATTALNDINFKIEEGEFVGIMGPSGSGKTTLLNLLATIDKQTSGHVLVNGEEINQMRAAKTHLGFIFQDFNLLDTLSIKENIILPLVMAKKSVNEIDAKVLEIAKFLNIEEILNKKVYEVSGGQQQRAAAARAIIHEPTLILADEPTGNLDSKSAKSLMSALQDLHEQKRVTIAMVTHDPVAA-SYCERILFIRDGEIFS................................................................................................................................................... 224
62 -65.300IDP01847 gene: ftsE; cell division ABC transporter, ATP-binding protein FtsE [Bacillus anthracis str. `Ames Ancestor`] GBAA5416 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  35  1...............................MKAIAGLTVNIKQGEFVYVVGPSGAGKSTFIKMMYREEKPSTGSINVNGLVIETLAERRRQLGVIFQDFKLLPKLTVYENVAFALEVIEEEPDAIRERVTEVLGLVGLEDRADALPSELSGGEQQRVAIARAIVNKPKVVIADEPTGNLDIETALDIMKIFTRINER-GTTIVMATHNADIVNTIRHRVIAIEGGKIVR................................................................................................................................................... 203
63 -65.200IDP02687 hypothetical protein lmo2580 [Listeria monocytogenes EGD-e] lmo2580 [Listeria monocytogenes EGD-e]  ali follow..  27  2..................TLMMKNITKNYQVIEVLKNVSLEVAQGEFVAIVGPSGAGKSTFLSIAGALLSPTEGEIAIGGKVLNDLTSKDDKVGFIFQGANLIPYLNVRDQLLVIAELSGDKGRVAKEKADELLKELGLTARENNYPESLSGGEKQRVAIARALMNDPDIILADEPTASLDASRGHKVVQMIADEVKRKNKAAIMVTHDERVL-DLVDRVIRIEDGYLKD................................................................................................................................................... 222
64 -64.800IDP00921 gene: ybbA; putative ABC transporter ATP-binding protein YbbA STM0507 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  31  2..............PAENSVEVHRLRKSVGELSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEAQHVGFVFQSFMLIPTLNALENVELPALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALA-ARCDRRLRLVNGQLQE................................................................................................................................................... 226
65 -64.800IDP01161 ABC transporter, ATP-binding protein BA_4997 [Bacillus anthracis str. Ames]  ali follow..  29  2...............TKPVVDVKNVQKVYGKSHALKGVSFSIQEGEFVGIMGPSGSGKTTLLNVISTLDKATGGVVEIAGTDITKMKQGEQKLGFIFQDFNLLENLSIYENIALPLSLQGVPSRNIGPKVEKVADMLGISAILQKYPSEVSGGQKQRSAAARALVHEPAIILGDEPTGALDSKNATSLLDAMTNLNQEQGVSIMMVTHDPFSA-SYCQRILFIQDGELYK................................................................................................................................................... 226
66 -64.800IDP02431 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_1770 [Coxiella burnetii RSA 493]  ali follow..  34  2............KKNTNYIIEVKNISKSFKKLLVLDRISFNVGEGEIIAILGKSGSGKSTLLRTIAGLIKPSSGVVLYHGEPINAPVP---GLTMVFQHFALMPWLTVLENVELGLEARGIAREERRARAIEAIDIVGLDGFESAYPKELSGGMSQRVGLARALVVDPEVLLMDEPFSALDVLTAENLRGDLINIGKTNIKSVILVTHNIEEATFLADRILVFSSGTIRSE------LPHPRNDQDPEFRRLVDDIYGLMTRP.................................................................................................................. 257
67 -64.600IDP04042 putative cell division ATP-binding protein FtsE [Clostridium perfringens ATCC 13124] CPF_0296 [Clostridium perfringens ATCC 13124]  ali follow..  36  1..................MIEFRNVSKVYNNVKALTNVNINIDKGEFVFLVGPSGAGKSTFIKMLLKEVEPSTGNIVMGNEDLSQIPYHRRKIGMVFQDFRLIPTLNVYENVAFAMRVVGASPKEIRKRVPMVLSLVGLSNKYKMFPTELSGGEQQRVSIARAIVNNPKVLIADEPTGNLDPETAKEIMELIDDINKA-GTTVVMATHAKEIVNSMKKRVIAIDKGEVVS................................................................................................................................................... 217
68 -64.600IDP02070 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_1809 [Coxiella burnetii RSA 493]  ali follow..  36  1..................MIEFKNITKVYQSYKALKGVSFLIEKGELVGIIGASGSGKTTTMNILGLLDHPTSGEYLLRNKNVAYLSPNQRHIGFIFQLFFLLPRLNALQNVGLPLTYRNLSGKRINKRALTMLERVGMAKFHHHKPSELSGGQQQRVAIARALVGKPDIILADEPTGALDSKTSQEVLDLLIQLNREEGCTVVLITHDEQIA-AQCPRVIKMHDGLIVP................................................................................................................................................... 221
69 -64.400IDP00958 gene: lolD; lipoprotein transporter ATP-binding subunit STM1218 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  35  2...............NKILLQCDNLCKRYQQTDVLHDVSFSIGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFSGQPMSKLSSAAQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEIDARAREMLHAVGLEHRATHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFELLGELNRLQGTAFLVVTHDLQLA-KRMSRQLEMRDGRLTA................................................................................................................................................... 225
70 -64.200IDP01320 ABC transporter, ATP-binding protein VC1883 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  1...............MNNLLRCHQVCKTYQQTQVLKGVSFELKRGELVSIIGSSGSGKSTLLHILGALDDASEGQVEFLGQSLHQLSSNKQHLGFVYQFHHLLADFSALENVAMPLLIGGMNVAKAKAKAQSLLERVGLGHRVAHRPSELSGGERQRVAIARALVNKPDLVLADEPTGNLDHKTALSIYDLMRELNRESGTAFLVVTHDGELA-AKMDRHMHMKDGLLTD................................................................................................................................................... 224
71 -64.000IDP00705 ABC transporter, ATP-binding protein SACOL0306 [Staphylococcus aureus subsp. aureus COL]  ali follow..  31  1..................MLKFENVTKSFKNIEAVKDTNFEINKGDIIALVGPSGSGKSTFLTMAGALQTPTSGHILINNQDITTMKQKASEIGFILQATNLVPFLTVKQQFTLLKKKNK--NVMSNEDYQQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILADEPTAALDTENAIEVIKILRDQAKQRKKACIIVTHDERLK-AYCDRSYHMKDGVLNLENETVE............................................................................................................................................. 225
72 -63.800IDP01425 ABC transporter, ATP-binding protein VC1630 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  2...............SGSMLQLIDLCKGYVFHPVLQGAELTLNQGDQLALMGESGSGKSTLLNLIAGLDSADSGEIWFPGFPMHHTSEHHDNIGQIFQQYNLLPTLNIADNIRFCRQLKGLPEDA--GLWRQILSALDLMPLLGRYPEEVSGGQQQRAAIARALYMEPKILLADEPTGSLDERNAEAVMRLLTTLTRQLNCALLLVTHSEKVA-QHMDGCIRLQGGQLHV................................................................................................................................................... 223
73 -63.400IDP01360 cell division ATP-binding protein FtsE VC0148 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  30  1.........MPALSGGDGVIRFQQVSKAYGGRQALQKVDFHLRRGEMAFLGGHSGAGKSTLLKLICAIERPTDGKISFNGHDITRIPNKRRNIGIVFQDHRLLMDRSIYDNVALPMRIESISENEIKRRVSAALDKTGLLDKARCLPSQLSGGEQQRVGIARAVVNRPTLLLADEPTGNLDPELSSRVLRLFEEFNRA-GVTILLATHDIHLVNSRQYRHLELNQGFLSEVAD................................................................................................................................................ 230
74 -63.200IDP01424 ABC transporter, ATP-binding protein VC1568 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  36  2...........KSLSPAPLVELQQICKHYTVVKALDGVDLTIRHGEFLAILGPSGSGKSTLMNVLGCLDKPTAGRYQLDGHPVDSLSTQQQKIGFVFQSFNLLEYASALDNVALPLVYAGVKAKDRRRRATELLTRVGLADRLDHKPNQLSGGQKQRVAIARALINQPQILLADEPTGALDSKSGAEIEALFNELHRE-GRTIIVVTHDNELA-KRTKRIVTIRDGQVVS................................................................................................................................................... 228
75 -62.900IDP02684 gene: lolD; lipoprotein releasing system, subunit D, ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0405 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  33  2...............NDVVLSCKNVSKKYTDIAILKDVNLEIKKGEKVAILGLSGSGKTTLLNVLGGLDKCSAGEVYLMGERFDNQSVNKKHLGFIYQLHHLLPEFTAIENVMIPLAITKYTKKESIKLANEILKKVGLDHRADHKPAELSGGERQRVAIARALVTNPNCILADEPTGNLDSQRSESIFALMQQLSDDFGTSFVIVTHDEKLA-SRMNKIYRLVDGELEL................................................................................................................................................... 226

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24