current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP01937 putative periplasmic solute-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0727 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MSKKFFLSLGLVALLFSNSQAIDENLIKAAQAEGRVNSLAMPDTWANWKDTWADLKNLYDIEHSDTDMSSAQEIAKFKTEKKNASGDIGDVGASFGEIAVKQGVAQPFKTSYWDQIPTWAKDKDGNWLLAYTGTIAFIVNKDVVKDIPKTWQDLLKGNYKITVGDVSVAAQAVSAVLAANYALGGDEKDLSPALAFFNTLAKQGRLVNNDVSIANLEKGEVEVGLVWDFNGLGYRDKVGKDRYEVLIPADGSVISGYTTIINKYAKHPNAAKLAREFILSDKGQINLAKGYARPIRIDHITLPDDIKAKLLPSEQYKNARAIKDQKAWEKSAKELPQLWQEKVIVDMKLast
1 -107.000IDP01937 putative periplasmic solute-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0727 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali  100  1MSKKFFLSLGLVALLFSNSQAIDENLIKAAQAEGRVNSLAMPDTWANWKDTWADLKNLYDIEHSDTDMSSAQEIAKFKTEKKNASGDIGDVGASFGEIAVKQGVAQPFKTSYWDQIPTWAKDKDGNWLLAYTGTIAFIVNKDVVKDIPKTWQDLLKGNYKITVGDVSVAAQAVSAVLAANYALGGDEKDLSPALAFFNTLAKQGRLVNNDVSIANLEKGEVEVGLVWDFNGLGYRDKVGKDRYEVLIPADGSVISGYTTIINKYAKHPNAAKLAREFILSDKGQINLAKGYARPIRIDHITLPDDIKAKLLPSEQYKNARAIKDQKAWEKSAKELPQLWQEKVIVDMK 348
2 -79.800IDP92649 iron ABC transporter, iron-binding protein [Streptococcus pneumoniae TIGR4] SP_0243 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  15  1MKKKWMYYAACSSNESADDSS------SDKGDGGSLVVYSP-NSEGLIGATIPAFEEKYGIKVELIQAGTGELFKKLESEKEVPVADVIFGGSYTQY-TTHGELFENYTSKENDNVIKEYQNTTGYSTPYTLDGSVLIVNPDLTKGNIEGYNDLFKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIIGLSSSGVYKAVADGEMTVGLSYEDPAVKLLND--GANIKVVYPKEGTVFLPASAAIVKKSKNMENAKKFIDFIISQEVQDTLGTTTTNRPVRKNAKTSENMK------PIDKIKTLTEDYDYVIKNKSDIVKKYNEVFTDIQS 336
3 -79.000IDP05164 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_1735 [Bacillus anthracis str. Ames]  ali follow..  18  1MKKFVCTLLFSAVVTGCSSKTGNVDAKSKTTNEKKIVVYSAG-PKGLAEKIQKDFEKKTGIKVEMFQGTTGKILARMEAEKKKPVVDVVVLASLPAMGLKKDGQTLAYKEAKADKLRSEWSDDKGHYFGYSASALGIVYNTKNVKTAPEDWSDITKGEWKGKVNLPDPSGSALDFVTGYVKKNG------KDGWDLFEQLKKNEVTVANQEALDPVVTGAKDMVIAGVDY-MTYSAKAKGEPVDIVYPKSGTVISPRAAGIMKDSKNVEGAKEFIDYLLSDDVQKQISKAYLLPGRTDIKAEN--------RPNVEEIPVLNIDWKTVEKEQDEIGKQFKKVF..... 340
4 -77.800IDP91956 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005733 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MFKNFKKIAFTSSLILLAACSNQSTDEGSVDKSQEIVIYTNS-ASNGRADWLQTKASEQGYNLRLVDISGGELADRLIAEKNNAVADMVIGLNKLEFRIKAEKLLVKYSPKWADEVDSSLGDSEGYYSPIVNQPLVLIGNKDA--KMPSDWTDFTDSSYKGKYGISKLTGTSKNIFASIVSRYKDEKGELDEGWKVAKAYLKNAHVYAEGDYISSIMDNNNDLKYSMMWGSVLQNQKEREYKFQVMSPKVGVPYVTEQVGILNTSKKQALLKEFVDWFGSSELQKEWSDKFGSIPANKKALEQ---AKDELKQFANSVKPQELDWEFIGKNIDSWIEKAQLEFVEQ.. 353
5 -73.500IDP00471 gene: tbpA; thiamin transporter substrate binding subunit YPO0522 [Yersinia pestis CO92]  ali follow..  15  1MFKHIISCLLLISATSA-----------LAAEKPTLTVYTYAADWGPGPAIKQAFEAECDCQLKFVAEDGVSLLNRLRMEGKNSQADVILGDNNLVQAAEQTGLFTPSQVDTRNLTLPEP-WQNKTFVPYDYGYFAFVYNKEKLKNPPKSLHELISSKEPWKVIYQDPSTPGLGLMLWMQKVYG------DQAPQAWQQLAQKTVTVTKGEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNYAAADFSEGHYLQVEVAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMDLPAGFETL------AVPQTALQFDAKDVADNRSKWIQAWQSAVS.... 329
6 -72.300IDP00429 gene: sfuA; iron(III)-binding periplasmic protein YPO2958 [Yersinia pestis CO92]  ali follow..  13  1MKIPIPSIGHVALLASAILFASSA---NAASDEDGIIIYNAQ-HESFAKSWAEGFTKDTGIKVTLRNGKDSELGNQLIQEGSSSPADVFLTENSPAMLVDNAKLFAPLDAATQAQVAKEYRPEDGRWTGIAARSTVFVYNPAKISELPKSLMDLAKPEWKGRWAASPSGADFQAIVSAMLALKGE-----QATLEWLKAMKTNATAYGNSTVMKAVNAGQIDGGVIYHYYPFVDQAKENSGNIKLHYFKNGAFVSISGAGVLASSKHPQQAQKFVQWVTGKAGQDFLRES------NSAFEYAVGVNAASNPKLVPLKDLDPPKVEVSKLNSKKVVELMTEA...... 336
7 -70.000IDP04509 iron compound ABC transporter, iron compound-binding protein [Clostridium perfringens ATCC 13124] CPF_0440 [Clostridium perfringens ATCC 13124]  ali follow..  14  4RKKLLALTLTALVSMGVLAGCGEAKAEETGSGEKVVNVYSS-RHYDIDKQLFKDFESDTGIKVNLVDGKSDELIERMAREGDNTSADVFLTVGAENIQLNEKDLIKDISSEKINENIPS-EYRGKNWVGLTSRARIIVYNKEKVNETIKTYNDLTKDEFKGKVLTRSSSSSYNNALLSSFIQLDGA----EKAKEWAQGIVNNFARTNDRDQAKAIMAGIGDVGIMNSYYIAKMISSKVGKEIGVLFP-ENTHLNLSFGAVTKNAKNEENAVALLEYLTEEKAQKAYVDENGEFALNTKVGKSELQK------SWGEFTVQNLNYEILGESKQEATLIFDQV...... 347
8 -69.700IDP90995 hypothetical protein y1430 [Yersinia pestis KIM 10] y1430 [Yersinia pestis KIM10+]  ali follow..  19  9LMKIKVFMFAMAALTTLPAFAQLQKIVDGAKKEGKVVVYSAT-DIKAAAPLIKGFEAAYGIKVEYNDMNSTELYNRYISESGSTSGDVVWSSSMDTALKLATDYALEYLSPEQAELPKWAIWKNKAY-GSTYEPVVFIYNKRLIPDMPDTHIALAKDKFKRKVTTYDIEKSGLGFMLSVQDFKADPN-----YFTTLANIAKGGLTVSTGTMMERVSSGENLIGFNIL-GSYAETRAKTDPSLGIAYPKDYTLVLSRVTFISQKAPHQNAAKLWVDYLLSEKGQNILANQSDIPSIRKDIDGNNDID-GLTKKLGSALRPIPVDESLLEAKRLDYIKQWRTAA..... 367
9 -69.200IDP01491 ABC transporter, periplasmic substrate-binding protein VCA0603 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  1MERMMNKRILKGTLTAIAAL-----MSAHAFAGQEVTVYTA-FETDLLAKYKSAFEKENDIEIKWVRDSTGIMTAKLLAEKDNPRAEVVWGLAGSSMLLKDQGVLKPYTPKGANELRANLNDPQAQWYGNDAFFNAVCFNEAVAKQKPQSWEDLTNPVYKGHIAMPNPSGTGYMQVSAWLQNMGE-----DKAWDYMQRLDQNIAHYSGSKPCVQAGMGEVAIGISMATRGAKLKTQ--GAPLDVIVP-NGIGWESEAVGL---VKESDAAKRVVDWSVSKAANELYIESYPIVGHQDVSKQVPNYPNV-------EKVMAKMDFTQMGVDRARVLQTWSEKFDAKSE 336
10 -67.900IDP01388 iron(III) ABC transporter, periplasmic iron-compound-binding protein VC0608 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  11QKEYSMKKLLSLSAITLSVLAP------SAFAAQEVNVYSY-RQPFLIEPMFAEFTKETGIKVNVKF-AKEGIAEKLAQEGEYSPADVILTSEFSRLELTEKGLTQPLDSKVIEEIPAQYRDSGDEWFALTQRTRSVYSSRDRLGGDDFDYMDLAKPEFKGKICTRSGKHPYNIALVASIIANHGE----AEAKAWLEGVKANLARKNDRDQVRAIKEGLCDVSLGNSYYLGAMLQKSWAEAVYINFPGQGTHVNVSGMAMAKYSPNRENAQKLMEFLTGETAQKMYAEVNYEYPVKPGVQRSALVE------SWGEFKADSLPLEKIADNNAAAIKLIDEV...... 348
11 -63.100IDP04248 ABC transporter, substrate-binding protein [Clostridium perfringens ATCC 13124] CPF_1477 [Clostridium perfringens ATCC 13124]  ali follow..  16  1MKKKILATLLTGLVLGTSLVGCGKTEGAEAGKKLVVSTWGL-NEDVLKETVFEPFAKEHGVEIVLDIGNNSERLTKMKNN-PNSQIDITYLAESFAEQGVEAGIFDKLKIPNASEMNEKAKSTAGYGPAYTLNSIGIVVDPSAGIE-INSWEDLWKPELKNKIAIPDITTTNGPAMVEIAAEKAGKTDNGEAAFKELEALKPNVVKTKSSDLANMFSNGEIVAAVASDFAFGTI--SKAKPEVINVIPESGTYLNFNTININKNSKNKDLAYEFINYALSKEVQEKTAKALNESPVNKEVKLSEEETKNLTYGPVVD-NAKVIDFKFVNSVMDQWVNNWNRIM..... 347
12 -43.900IDP05035 gene: potD; spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Bacillus anthracis str. Ames] BA_1300 [Bacillus anthracis str. Ames]  ali follow..  15  1MKLTKRLAGAAISFSLVAGC---------GEKKEELNIYS---ADNFDEQVLRDFEKKYNVKINYDKYASNEEMAKLQA--GGAKYDLIQPSDYMVKTMAKMDLLAPLNIPNIENMVSNFKTPNKYSLVYTWGVTGIAYNKKYVKEAPTSWTDLWNEKYKGHVTLLNDSREVLGMGLKKNSNSTKDDAQLKTAATDLQKLLPNLLAFDTDNIKQKFITEDAWIGTVWSGDAAFIAKD--NKDVEYVVPKEGGTIWADTLAIPKGAKNKELAEKFMNYLLDEKVSVKNYESIGYSNPNEKAHHSKEYRENHMIFLTKEELDRTEWLVDVDDKLKDYDRYWTE-LKTKGK 345
13 -43.600IDP91991 spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001132 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  1MKKIYFLAGIAAIILVLWGIATHLDSKINSRDSQKLVIYN---GDYIDPELLTQFTEETGIQVQYETFDSNEAMTKIKQ--GGTTYDIAIPSEYMINKMKDEDLLVPLKIEGIENIGPEFLNQNKFSIPYFWGTLGIVYNETMVDEAPEHWDDLWKLEYKNSIMLFDGAREVLGLGLNSLSLNSKDPQQLEETVDKLYKLTPNIKAIVADEMKGYMIQNNVAIGVTFSGEASQMLEK--NENLRYVVPTEASNLWFDNMVIPKTVKNQDSAYAFINFMLKPENALQNAEYVGYSTPNLPAKEEETKEDKAFYPDVETMKHLEVYEKFDHKWTGKYSDLFLQFKMYR.. 355
14 -43.300IDP05020 gene: potD; spermidine/putrescine ABC transporter,substrate-binding lipoprotein [Clostridium difficile 630] CD1027 [Peptoclostridium difficile 630]  ali follow..  13  1MIKFKKAISLIAVGMMIVTLFTGCN--KATDSTKVLNVYN---GDYIDESLIDKFEKETGIDVQYSTYDTNEMMQKVKS--GSTHYDLVFPSDYMVEKMKNEGLLEKLNIPNMKYLDKSFLNPNEYSVAYMWGTLGILYNKKEVKDPMDSWNILWNPKYKGNIMMFDSVRDTIGITLKKLSMNSVNPKEINEAKNLLMKQKDLVLAYVNDEGKDRLLGGEVAMGMLYSGDAVTLMEQ--NPDLDYAIPKEGTNKWVDAMCVPTTAQNKKEAELFINFLLDPENAKVNAEYIGYSTPNTGALLDPEITQNPVAYPSKEVLDKCETFEDIGENIKLYDKAWIE....... 346
15 -43.200IDP01506 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VCA1113 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  1MKTFIKGLVLSAVVASS-----------QVYAEQTLNVYA---GGYLPEKSLKAFEQQEGVTINYSTFENNESMYTKLKLLKGTGYDVVFASAYFIEKMGREGLLAEIQIPNMKDAMPTVLGLNKFSLPYIWGITGLYYNSSTLPNGITKWADLWDKQYEQQVMLIDDIRDVFGMALKLNSINTKNEEEIKKAYESLVALKKNVLLYNSDAPHVPYVSGEATLGMQWNGNAYQGQVE--MPELKFVMPEEGAVLWMDNFTIPSGSKNIPLAHKFINFMYQPENQAEIVQSLGYASATKGGRAAELRDNPTIFPSDEDMKKGEFINDVGPETLAIYEKYWQR....... 339
16 -43.100IDP01418 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1424 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1MKNKLFASALCAAALFTTN---------AMAKDQELYFYN---SEYIPSEVLEDFTKETGIKVIYSTYESNESMAKLKT--QGAGYDLVVPSTYFVSKMRKEGMLQEIKLSHFKDLDPNYLNKNKFSIPYIWGATGIGINTDMLDKKSKNWGDLWDAKWAGQLMLMDDAREVFHIALSKLSPNTTNPKEIKAAYRELKKLMPNVLVFNSDFPANPYLAGEVSLGMLWNGSAYMARQE--GAPIQIIWPEKGTIFWMDSISIPAGAKNIEAAHKMIDFLLRPENAAKIALEIGYPTPVKTAHLPKEFANDPSIYPPQSVIDNGEWQDEVGEASVLYDEYFQKLKVND.. 345
17 -43.000IDP01395 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein, putative VC0704 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  1MTNFCNEWVSYSQMIKRFLSLMVLNTVCYQASALELNVYL---EDTIAPSVVEAWHKKTGVSVNLFHFDNDDERSLLMLKSVQLPFDIMVLDNVSAFIFSRQNVFEDLTAPNRANNDPMWLQACGTHVPYFWGSVGIAYRKSLFDKPPTQWSEVVDIAHRGRVGMLKDSVETLLPALYMLSPITDSIDTLRQAYRLLDAANPHILTYELSYVRSHPQTDNLHMAVSYSGDHYSLNRFFNTQDWDFSVPEGRPYLWVDCMAVNSVSPNTVQAKAFLDFLMKPDIAAINAEYIRAASPNYKARAVEHREDLSIYLPEQRLAEGIIDSELSAKNLSLRAKIISS....... 350
18 -42.200IDP05673 hypothetical protein lmo0810 [Listeria monocytogenes EGD-e] lmo0810 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKQLLIFVPVIVVALLMMLLATTMNRSEGYAGSNTLTIYN---GDYIDPSLITKFEKETGIKVIYQTFDSNEAMTKIEQ--GGTTFDIAVPSDYAISKMKEENLLIPLKLPNEKYLDPRFMDLNKYSMPYFWGTLGIIYNKEMFPDKNDTWNALFDPELKNQILLIDGAREVMGLGLNSLSLNDTNKAHLQAARDKLETMTPNVKAIVGDEIKLLMADNEAGVAVTFSGEAAEMLSE--NEDLEYVIPKDGSNLWFDNMVIPKTAKNVDGAHKFINFMLKPENAAINAEYVGYATPNAKAVEKEISSDERFYPDMDELNNLEVYDNLGKRMLSYYNELFLEFKMYR.. 356
19 -42.200IDP04270 gene: potD; spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Clostridium perfringens ATCC 13124] CPF_2226 [Clostridium perfringens ATCC 13124]  ali follow..  15  3LKKFLTCSTLLLSSLFLGCGPKKDEEATQDKNNNVLYVYN---GDYIDPELLTKFKEETGIDVKYDVYDTNEIMQKLNS--GNVSYDIVIPSDYMIEKMKEEDMLAKINIPNYKYIGEQFKNLNEYSVPYMWGTVGIIYNTKRVSDPVDSWNILWNPKYKDQVIMPDSVRDAMAVAEKKLSLNTENLDQIEAAKKELMTQKKDGLIYMVDQVKDAMVGGEASLAVAWSGDAVTMIER--NPDLAYAIPKEGSNKWFDAIAIPKNAKHKENAEKFINFLCDPENAEQNVEYIGYSTPNTAAYDEDIRDDKVAYPDEESLKNCEVFIDLPSKILRKYDEAWLEIKCV... 359
20 -41.800IDP01419 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1425 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  24MKKLATLLAGSACALSLLSGT-------AAAEDKELVFMN---GPYINSGILEQFTKETGIKVIYSTYESNETLAKLKT--HNQGYDLVVPSTYFVAKMRDEGMLQKIKLSNFKNLDSNYLDKNDYSIPHVVAITGLAVNTDMYDPNDQSWGDLWKPELKGQLMLMDDTREVFHIALRKLSGNSTDDKQIDEAYAELQKLMPNVLVFNSDNPAAPYLSGEVGLGMLWNGSAAAAQKE--GLPIKLVFPKEGGIGWVDNFAISSGAKNVDAAHKMIDFLLRPEIAEQISRDTGYLTGVKASNDKFQDVAPLFPSQEDLDRVEWQ--SAVGDKTVKYEEYFMKLKAGQ.. 366
21 -39.300IDP00421 gene: potF; putrescine transporter subunit: periplasmic-binding component of ABC superfamily YPO1331 [Yersinia pestis CO92]  ali follow..  15  1MFTQRKKWLSGVAAGLLMAASV-----SASAEEKILHIYN---SDYIAPDTLANFQKETGIKVVYDVFDSNEVLGKLMA--GSTGFDLVVPSASFLERQLSAGVFKPLKLPNEKNLDPELLDPDNKYIPYLWATTGIGYNVEKVKAVVNSWDLVLKPENLEKLKSCGVSDAPSEIFATVLNYLGLTADYTGSATDLLLKLRPNIRYFHSSQYINDLANGDICVAVGWAGDIMQASNRKNGVNVAYSIPKEGALAFFDVFAMPTDAKNQDEAYQFLNYLMRPDVIANISNHVFYANANQAATPAEVRDNPGIYPPADVRAKMFTLKVQDPKIDRVITRAWTKVKSGK.. 369
22 -39.300IDP01383 thiosulfate ABC transporter, periplasmic thiosulfate-binding protein VC0538 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  1MNRIKSTLTALLLAGSF----------QASAADQTILNSSYDIARELFVAYNPVFAEHWTVEIKQSHAGSSAQARSIL---QGLAADVVTFNQVDVQILHDKGKL----------IPANWQTLLPNASSPYYSTTAFLVRKGNPKN-IQDWSDLVRDDVKSVFPNPKTSGNARYTYLAAFAQKQFGQDNQVQQDEFLKKFLANVAVFDTGATTSFVERGIGDVLITFESEVNNIRQQYGADDYQVVVPKTSILAVAVVEKVAKRNGTYDVATEYVSYLYSEPAQRLLAEFNYRVHDAKVQA............................................... 292
23 -32.000IDP05761 hypothetical protein lmo2125 [Listeria monocytogenes EGD-e] lmo2125 [Listeria monocytogenes EGD-e]  ali follow..  12  1MKRFIVSAVLVMALSLAACGGGKDTSKSGSSDEKTLTVSVDAGYKDYVNKIKGDFEKDNDVKVKVVEKDMFETLEALPLDGPAGTADVMMSAFDRIGSLGQQGHLAEVKLGNKDDYDEKDQKQDDKIYGAIIETLVLYYNKDLLDKAPATFKDLETLSKDSRFAFTSEKGKNTGFLAGLLAGYGGNNKGSVEGITYATKWFQDVWPSADDFIQDQFVKGKAAAILGGPWSAANYKEAKINYGVAKI-PTYSPFAGGKGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMTNEVPANLKARDTAKSKND....................................... 355
24 -30.700IDP02726 maltosaccharide ABC transporter, maltosaccharide-binding protein, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA4229 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  1MKKALSLLTVSALSIGMLSACGPKDSGKKEESKADLLVWEDDKKGVGLEPAVKSFEEKYKVKVKVVEMQMTDQVKKLRLDGPAGTGDVVTLPHDQIGNAVTEGLLSEVKADDAVKIEAQTYNGKLYGLPKAIETPVFIYNKKLMPKAPETMDELFNFS-DGKYGFLALGDNFY-FANAFMAGMGGNNSGAVQGAEYLQKWYKEKLFSGGPAADGLFNEGKAASIMNGPWAFQAMEKNGIDYGVAPM-PKLKTFVGVKGWHVTSFSKQNDLATKFTEWVTNEENAKIRFEKTKEIPPVKAVMEDPIIKDN....................................... 353
25 -30.500IDP06544 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09718 [Enterococcus faecium DO]  ali follow..  15  1MKKIIVTTCLLATGFLLTACGESQS--SNESQQTTIQFMVEQERLSVINELVADFEKENDIKIKQVPVEESAFNTKIVTLARSGKLEVMEVSQDFAKVMDKDELIDQTAVQNYDGAKNLVRSEDGIAAPISGWVQGIWYDKEKLSEAPENWDDILKIAQHGIAMPTAEGTMSEQAFSQFALSNGANVLDDEEALSFYQNLSQYTMPGSNDEIKDAFMNGTAPMAIYSTYILPSVYEAGNSENIGFAIPAVYGTVSGLTISSGLDEKQKEAAEAFTAFLSQPKNMEKWSPGGAQPVNKQVVELDG............................................ 354
26 -29.400IDP00164 gene: acfC; accessory colonization factor AcfC VC0841 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  1MYFMKSKNRFLLISLLSF----------STSVFADVNLYGPGGPHVPLIKVAESFEKSQSKRVNITFGPQATWNDKAKKN-----ADILFGASEHSALAIAEGHSERFSKFNIHPV--------------FMREAIILVKKGNPKNI-KGMADLLKPGIG--IVVNDGAGVSNTSGTAV----WEDSVGRMKNVEKLQAFRSNIHVFAPNSRKAFVDGEDIDAWITWVDWAIANPTIGD------MVRMEDEYRIYRDFNVVLAKNPSSEAIDFFDYLTSKDAEAIFQHYGW........................................................ 254
27 -29.400IDP02597 putative sugar binding protein [Yersinia pestis CO92] YPO3472 [Yersinia pestis CO92]  ali follow..  17  1MKTQMIMSKVKIKSLLLLTYLAMGIPSLHAAETLQVWIRASNDSKNIYKKEADTFEKKTGIKIEYFNATTDFEQRLARAAAGNALPDLIFNDAVAIGQFVQLGIVEPIEPKNIIGGENIFDTADGKYYGVSAQTFALFVRKDWREKLPKNWQDIS--TLAKAFTFNDPDGNGKNFISSYLWQAGGDFIRPAETLSFMRGMVCDKTVATTADAIPSFRSGQSGMFFSGPYHIALFDKDPGTEAFEVIPPPTGTLAEGTTVFMMKSSQKKAAAQKFIEFMISPEGQQI.............................................................. 341
28 -29.000IDP05525 putative sugar transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD2550 [Peptoclostridium difficile 630]  ali follow..  13  9LKKLCSLAMVAIMTTTLITGCSSGNGKDSKKDGEKEKLPVENNMKEVWDPILDKFEEKNNCEVDLQIIPWDNYSEKFATAISAGEGDVGYMYAEMYPQFIESGAVEDLTNTKEDKEQSIYIKTMGGMYGMAANPGVLYYNKDILEKLPKTWEDFKRICKKGKIDQAKTFGNLNWNWYPYLWQAGGDIFNDDEAAKFLKELQAYVPEDSNEMIESVFGPGKAAFTIMLSSAATSVFDESPDLNWGFV-KKAATFGAVDHLSLMSSAKNKELAYKLIQHMLSVESMTEFHKAIPRAPITKGEPYQGDERFKEMVENDKNVYRPLVVGPHGVEIYEYLWKELQTMISGDKT 412
29 -28.900IDP05433 hypothetical protein lmo1730 [Listeria monocytogenes EGD-e] lmo1730 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKKKMFVVLALVLSLSLVMACGGSKDDANSGDSKVLNVWAMGDEAKSLKELAQKFTKDTGIEVKVQVIPWANAHDKLLTAVASKSGDVVQMGTTWMPEFVEAGALLDITKDVEKSVKTTQFDGKTYGVPWYAETRVLFYRTDLLKKVPKTWDELS--DAALKLSKRGKDMYGFAIGFIFGRQNGSPLFDKDDTVTYLDSFIKNGSALGLDASQSFGGDGIVPMFMSGPWMVNTLKDTAPDIDGKWVLPNNESSLGGANLSIFKYSDKKDDALKFMDYMSQPDVQLSWLKDTNSMPARMDAWEDDMLKNDKVFGEQMKTAEPMPLIPQFEEIAQLYGKSWEQIYRGGAD 396
30 -28.900IDP91126 extracellular solute-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00176 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  15  1MSKILKCITLAVVMLLIVTACGPNRSKESKDKPNQLTMWVGDKQMAFYKKITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGDIFFLAHDNTGSAYLQGLAAEIKLSKDEALKAMNYDNKQLALPAIVETTALFYNKKLVKNAPQTLEEVE--ANAAKLTDSKKKQYGMLFNYPFLFGNDDNSKHVVKNAERLQKWYDKGYLATHDVMIGLFKEGKVGQFVTGPWN-INEYQETFGKDLGVTLPTDGPFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVPMPNIPEMRQVWEPMGNASIFISNGKNPKQALDEATNDITQNIKILHP 415
31 -28.800IDP04377 putative maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein [Clostridium perfringens ATCC 13124] CPF_2652 [Clostridium perfringens ATCC 13124]  ali follow..  13  1MGKRTVMAATMLFAGSLVGCGGKSDSGSADGSGKELTVWSTTPEVEELNKMASKWGEENGVKVKVVE--DKSEMQAYIQAANSSKGDIMFLAHDNLGTFQKAGLLAEVPEGIINDLDAVTIDGKRYAVPIAQETSALFYNKDKVKEVPKTMEDLV--KVAEEGAGFKYDINNFYATYGFIAADGGGTPGAIKGYQFVQDLVQKDKLMPADIAKGDFLSKNTGFYISGPWDVSAFKDGGVNFGVAPMPTLFGTFLGVQTAFVSEKSQNKDLAWKLVKYLSENSGDVLLNKGNRIPVLNKYLDSAD............................................ 342
32 -28.200IDP05708 hypothetical protein lmo2839 [Listeria monocytogenes EGD-e] lmo2839 [Listeria monocytogenes EGD-e]  ali follow..  15  1MKKKSLVLLVVVLVLSAVLAACGGK--ESGSKEVTIEFMVEKERLDVINKLIADFEKENTIKIKQIPVEEDAFNTKVVTLARSGKLAVMEVSQDFAKVMDKDELID--EDKYYEGATNLVRSEDGIAAPLSGWVQGIWYNKKALADAPKNWADIEKVAKKGIAIPTAESTMSEQAFSQFALSNKANVLDAKEALQYYKDLSAYTMPGSNDEIKDAFMNGTVPMAMYSTYILPSVYEEGDPKNIGFAIPEEKGTVSGLTISAGLDDEQKKATKKFVEYLSQPENMATWSPGGAQPVNKEVVEQK............................................. 353
33 -27.800IDP92716 sugar ABC transporter substrate-binding protein [Streptococcus pneumoniae D39] YP_817037 [Streptococcus pneumoniae D39]  ali follow..  13  1MRKGTMLSVVAGLSLAILAGCSGGTNSKQASSSNDIKVWDETNEGKAWQKVVDNFNQSGKYKVVTESGSGGGYEDKVNAAITTNSLDVITLDGPNTAAYAKSKVITPLKDNNMDDVLDSIKQQNGKFYAFSESNVGVYYNKKMFKEAPWTWDEFNTIAKK-DFRINSNDEMLPYAYMPLIWSNNGSVVNEDEAVQFIQNLVKEGYT-TVSPVEKGFETGEYPMLLSGSWTIADMNTNYKDIDFGILYPKLVSPSGSWQLAVTTKSDKKEAASEFVKFATNTESSEIISLGNSVLPIRKSTIENIKDKVSEPMRFLMEQNSKTAHARPVVVAYPQVSRAFQQAM..... 404
34 -27.400IDP04242 sugar ABC transporter, sugar-binding protein [Clostridium perfringens ATCC 13124] CPF_1113 [Clostridium perfringens ATCC 13124]  ali follow..  11  1MRKKAILCMMIGATAMVGCGDKTDSTQAKDGGKVKLRMTN--NNEDTMKDMLKYLSEKLNVEIEYQFIDNSNYNTIVDTQLSAEEGDIICESPASALKHAKLGYLENVND--AKKYSDSGTDNNVYALPGISWFEGIYYNEKLFEEIPKTFDEYIE-QSLGIKPLAAGLKSWEPLLKNSMAFVTAEYLSTDAGKNFGQEYREGKVKLDGDQALEEFATGKAAMYCSGPWDLEAIMSKNPDLKLNMMFYGTKIGGPGCGFAVNSKSKNKDAAMEVLKAISTEEGQKALWENNQGGSSGTSFTLPEAFKGAEKAINAGHIYCPWNEWGDAGSAHVDYGKQMQNYLLGNQD 401
35 -26.200IDP01500 gene: malE; maltose ABC transporter periplasmic protein VCA0945 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  12MNMKNALSTVALSTLVALGSFGAH----AAIEEGQLTIWIN--GDKGYNGLAEVGKKFEDTGIKVTVAHPDALQDKFPQTAATGDGDIVFWAHDRFGGYAEAGLLVEIKPKIQEGIVDFAWDANGKIIGYAVESLSLIYNKDLVPNPPKSWEEVAELD-EGKSAIMWNLKEPYFTWPLMAADGG-NNKGVKDAMNFVKGLVDKGVIMDYSVSESAFNQGNTAMTINGPWSWGNIEKSGINYGVTTLPKFNGPFVGVLTAGISTASPNKDLAVEFIENYLLTNDGLRMVNNDKPLGAVALNSFQRELDAD....................................... 350
36 -26.100IDP05444 hypothetical protein lmo0768 [Listeria monocytogenes EGD-e] lmo0768 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKKVLLAILSMVLLLSLAACGGSSDSSKDKNGKEEIVMWGSGDQIKQLEKQIDSYNKSQKYKVKYVM--QENVEEKLLTGIAGGELDIIMWDRYQTALYAPKGVLEPLDK-KMDDFYEESVKESDKLYGLLNDNRILFYNKKLLQEAPTTWDELATAAQKNKMTQAGMSLQDVGLFNLYLMQAGGELVTSDEVLNYWDKMQNDLKVYQRGDGSDAFAAGKEAMTYNGPW-ALADYNKVEDLDYGVVPPDKGAIMGGFGLVMPKQAEHKDGAWDFMKWWTTPENGVEFAKISGWLPANKIAAEDEYFTKD....................................... 352
37 -25.400IDP06508 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN10305 [Enterococcus faecium DO]  ali follow..  12  1MKGKLIGSLLVAATGILGACGGGSSAESDSDKEVTLTFWNTASDGEILQEIVNEFNKTNNIKIEMDIMTWANLNEKLPTAISSKKADFIALNYPDFAQYVENGAVQPLDD-DKSDFKETAIELEGKQYFVQVQGMYMYWNNDLFKQAPTTWEELT--EMAPKLTDSSKNVSGFVFLYNWMLANGGKLVNDDKTLKAIQKMIHVDKTISGAEMDNLMNAGQLAIEINGPWLNNGLKANEIDYNVTTL-PKKTAILDGVGYAIPASTDKKEAVYEFLKYWNTTEIGKKWSIENGFPAYLDSVAKDEEVKNSELSKQMDYAEPYLPGFTQISAINNDIINPLIEKLLAGED 405
38 -25.300IDP91953 extracellular solute-binding lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002215 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  15  1MKFRKLACTVLASAAVLGLAAKDAGKSGGDGAKTEITWWTGDGVGTYEKSIIEAFEKANDVKVKLETIDFKSGPEKITTAIEAGTADVLFDAPGRIIQYGKNGKLAELNDLFTDDVQASKAGDKAYMYPISSAPFYMAMNKKMLEDAGWTTDDLKDKGYTPGSLFSSGQGGDQGTRAFISNLYSGSVTDEKKGLEKATGWIKDNLLFDGGADIQNFANGQTSYTILWAPAQNGIQAEASKVEVVEVFPSDEYLVNGFAVFNNKDDKKVAASKKFIQFIADDKGPKDVVRTGAFPVRTSFGKLYDDKRMETISSWTQYYSPYYNTIDGFAEMRTLWFPMLQSVSNGDEK 420
39 -24.900IDP06519 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09962 [Enterococcus faecium DO]  ali follow..  11  1MKKRVIALLNITLLFSLSACGKTNEEVTANIADPTLEVYVNGKLTNYVENAAKIYNRKTNIDLKIVNVASGTITPKLVTHEDMP--DIISMADTSAAGVLEDKYGDQFYDQKLNILRQQTSNETIIPWASDFTPALCYYQPKKFAEIISSWEEYIQKEKTGSFGIALPESGDQELFINMLAQQNQSLLDEEHAAKLIKEMIDSDIVHFYGAQDAEKAFQESAMFVAGGWYATNMSLNFPDASDKWRMPGKGAVSGGSSFYVPKDAKNPQVAQQFLTFMLTDEECLANALELGVATSNSLAYQTEAAEKK....................................... 371
40 -24.900IDP95187 gene: lmo0181; lmo0181 [Listeria monocytogenes EGD-e] CAC98396 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKKGLLLLMVVVLSVFGLSACGGGS-SSGDKTEITYYQFSAPADGKALDEMVKEFEKQNDIKVNVQTIAFNDYFTKLQTQIAGGDADAFELNYETFMQYAEKGVLADLTS-DPSTLNKQAYDADGKQYGMSFSNVVTIYNKDLFDKADWTWKDEE--AAAKKLTDAKNKVWGTSQFYKVAAQNGGSIFNEDEALTHLTNEAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPFKWDVQVE-AQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIDNNWELPATENKEILQP............................................ 350
41 -24.300IDP05678 hypothetical protein lmo1041 [Listeria monocytogenes EGD-e] lmo1041 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKKIVLIICCGLLLLLGACEDT-----PEKVQTTTIHISAAASLKDSIDDVKPLFEKANTIKLSFDFGGSGQIRERVE---SGAPIDGVLLASKKADTLIKQNLAEKTKEFAGNEL--------------------VLIEPKNVDQKTEANLEQLLNDAS-KIAIGDPESV-----------AGAYAKQTLENLNLYNAEKAKLVLATDRQVLSYVEAGNADAGFVYQTDALL----SKKVQVKAKIDEKLHDPIAYYSAQVSDSDKKEETATFLDFMNKSEAQKILEKYGFKAA..................................................... 255
42 -24.200IDP04512 gene: modA; molybdate ABC transporter, molybdate-binding protein [Clostridium perfringens ATCC 13124] CPF_2342 [Clostridium perfringens ATCC 13124]  ali follow..  12  1MRKKISLPIIMAIGMLSLLFVG----CTNNKEEKTLTVSIAASLQKPMEKIASNFEKENGVKIQYNVGGSGTLKKQIS---DGADVDLFFSANTKAKELIDEGLVNKDESYKI------------------LNNQLVLIENNDYNKPINSLEDLKNVEGKIAIGEISTVPAGQYAKESL------------EKVGAYKDIEDKLVFARSTNVKTYVENGEANLGFVYKTDALD----LKNSKIVYEVPNDYHKPIEYELCLLKNSKNNKEAKKLIEYLKGEESKKIFSEYGF........................................................ 253
43 -23.800IDP05504 gene: modA; putative molybdenum ABC transporter,substrate-binding protein [Clostridium difficile 630] CD0869 [Peptoclostridium difficile 630]  ali follow..  13  1MKKILGILGLVACLTLGTVGCNSNEKTTKSSDSVELNISAAASLKEAMAKIEEEYKKVDNVKLTVNYGASGSLQQQIE---QGAPCDLFISAGQKMKVLDEEKLLVS-----------------DTMKDLVKNDLVLISSAD---SSVSGMKDLTTDKVK-KIAVGEAESV-----------AGKYADEVLTNLNLKDKLKDKLVFAKDKEVLAWVQSGNADVGFVYFSDTVN----NDKIKVVEKTDEKTHSPITYPVSVIKASKNVDAAKKFEEFLLSESGQKIFEEFGYKKV..................................................... 269
44 -23.600IDP06507 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN11122 [Enterococcus faecium DO]  ali follow..  12  1MKKNSRIVMMGVALVSGLVLAGCGNGSASNSDKVELSINY---NGAISKKAMDNAKKEFDYKLSFKQIPANDDFTKLKASNSKSAPDITAINSNISDYLPYADKFVNLLDYDSETLAADFVE---IAMPIDIGPTALFYNVDAFAKALKDEESLMAAAKQMKEKADMPFFQSSLSLLQSKNRTMTANGQLKEIWDYAVKAEKSGYTLGSADGANSVQKGMFGGMIEASWGINDLAENGVSP---AKSPFTASNYGGSYLAVIKTSSHPKEAAEVVKYLTNEDSQRANYEELALFPSNTKVYDDSFKAAK....................................... 351
45 -23.300IDP04058 ABC transporter, solute-binding protein [Clostridium perfringens ATCC 13124] CPF_0556 [Clostridium perfringens ATCC 13124]  ali follow..  14  1MKRKVACVTAIAASAFVGCGNKEEAPKDNEKPSTEIAVFEGGFGKDYWDACIDAFEAEHDVEVKMEANPKIGDIIRPKLSSENTP-DFIYLSTNDANALIKDKALVDLSDKLKDKILPGFLDTDGFLAPLYYNVTGMWYNKALFKEVPKTWDEFFEKKAKDEYQGQAPGYNEAVIFPMLASAAGEEDPNVKKALDVFQRMADEDMVLNGTQAQVEFLNGKALFLPCGSWLEGEMKDAIEGFEFGFMPPTPYVTTTIEQMYIPAKSDQVELAKEFLAFQYTDAMVQKNAEI.......................................................... 373
46 -23.100IDP05674 hypothetical protein lmo0859 [Listeria monocytogenes EGD-e] lmo0859 [Listeria monocytogenes EGD-e]  ali follow..  16  3IRKIAIAALSVVVAGSLLTACGGGNSKSDDNGKTKVTFWANPTQVKYWDEMAKAYEKENDVTIEVSQMKESPSSATIQSAIASKTATMSENNRSFAAQLADSKAIVPLNDRNMSETMDSWKFSDGNQYVLYSNPILFAWRLDTLKELPKTYSEALEVGKKGDLSDPTAWMRWFDFFPLYDAASKGDDKAGTELLTFMSELQKNKLL-LASKATDPFETGTSIMADNGPWTFPNWDEKFPELKYNELVPNVATYADSKGVVMYAQAKEKEAAMDFLKFVYNDDKNDLLETTNLIPARDDATENEKENPELEVYAANVPYSIPAMDDAKYNDIQQIIGEEAWNPIVRGEK 420
47 -20.900IDP06546 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09092 [Enterococcus faecium DO]  ali follow..  12  3IRKLIAGVVCLAAASGFLTGCGSASSTADKEEKVTVWAWDETFNIKAVNEAKKVYENEEEIEVVTMSQDDQKLNTALASGNTEGLPNIVLIEDYRIQGYLTSDAFANLSAIVKEDFAVNKVGDKIYGVPFDSGVTANFYRTDLMAEANLKWDEYIQ-KEKTGKKIAEVNPSDLGRVRMIMQQAGEDNASLKYGLELFATLLKEDLVEQTNAGVTAIQSGAVASSPTWYSSTIQGAENQSGKWKIAPIPAQASNLGGAGWYVIKGVAGEDSAKDFLEATFNEELMGTLAKEIGLVSTMLSANEQEAYQEA....................................... 362
48 -20.600IDP91025 gene: modA; molybdate transporter periplasmic protein [Yersinia pestis KIM 10] y3037 [Yersinia pestis KIM10+]  ali follow..  15  5MKNQYGKVSYWVAGAVLLTAFS-----GPAFAADKITVFAAASLTNALQDIAVQYKQEKQVDVVASYASSSTLARQIE---QGAPADLFISADQQMDYAIDKQQIVA-----------------NTRYTLLGNELVLIAPQDSQIDK-DKKTDWKKLLEGGRLAVGDPDHV-----------AGIYAKESLENLGAWSTLAPEMARANNRSAMALVERAEAPLGIVYGSDAVA----SKKVKVVGIFPEASHKPVEYPMAIVKGHDNP-TVTAFYDYLKSPAAAVIFKNYGFTP...................................................... 262
49 -20.300IDP01422 glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein VC1549 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  1MNKVWLTGLLTATASGVFS--------ASTLAATEITWWHAMGGQETVNQLATDFNASQDYKLTPVYKGSTETLTAGIAAFRAGQANILQVFDAGAATMSSKGVAKPVQD--IAGVRNFYADNTGKMVGMNSSTPVLYYNKDMLAQAPQTYEQLE--QVAAKLAEKGQAGFAQSSRHNLPLSDKQNGYQDLMHVKKLKEWSDKGYYKDWDANQTPFERGEVAMWMGSSGSFGGLRNRVKFNLGTTYLPPTHTFIGGAALFALQGHTQDKGVAAFFAYLTKPETQMNWHKTTGYVPVTNAAYDLTKQSGYYQENPDAEVGVKQLSLPDGEWTKGYRLGYYPQ....... 392
50 -20.100IDP04389 gene: pstS; phosphate ABC transporter, phosphate-binding protein [Clostridium perfringens ATCC 13124] CPF_0617 [Clostridium perfringens ATCC 13124]  ali follow..  12  1MFKKRLIAIIGTIFIGATAMVGCNSGGSEAKSTNSVSISGSTSVGPVMEAEAEAFKTKKDVSIEINQIGSSAGIKNAM----EGVSEIGMASRDLKGEEKQAGLKEVEIAYDGIAL---ITHKNNPVKDLTLVQIKDIYTGKI-----TNWKELGGNDAPIVVVSREDGSGTRDAFQEIVGFKAEELTV------------NSQISDGSGNIKSLVQGNENAIGYI---SFSYVDDSVSAVKVDGVEATPENVLNKS-LAVYKEENLTESGKSFIDFILSEEGQDIVAKEHLIKVK.................................................... 276
51 -19.700IDP02207 putative sugar binding protein [Yersinia pestis CO92] YPO0612 [Yersinia pestis CO92]  ali follow..  10  1MKILYYIAIAIA------------SLPLMAAERLEIMVPSGSYVSFMRNTVTPEFNKLYEVNLVV------SNDEQLDTRMAAGDNNVYIGVFGYQPKLAKLGKLAYLDK-NERIDPHFLRENFGRTYYINATTQMMIYNKELFAEAPATWDEFL--LAAEKISALPPRSDGSKVMYYNVNQGQYQLLNRYNMAQFMRTMQQAQRF-APLTMEKSFFSRNIGMWLQFGFGWKATLSSAAGQDVAIAIPIHYSVLDGRAIMIFKDARKEQLSWALLNLLMRDDINLQANIALGQLPTLKALQDAPYFQSAEAQPQQLQHAILSEPFANAMEVANIILANYSKVVLKGEI 394
52 -19.400IDP01311 molybdenum ABC transporter, periplasmic molybdenum-binding protein VCA0726 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  1MPMLTRILLLLCVALNA----------PLASAKETLHIYAASSMTNAVNALVADYSQQHDVKLVTVYGGSSSLARQIE---AGAPADLFISANEEANYLVEKGLVKPNKVVTL------------------AANSLVLIRPTAQPVASFELQDAAAWQTASRLAVAQVDAV-----------AGMYAKQALQHAGVWPELESRLAQTNNRLALALVERGESPLGIVYKTDALL----SDKVTIVTAFSAQSHQPIRYPLAQLNDKA---ASAEWVAYLRSDAAQQILQRFGFESVSE................................................... 254
53 -18.500IDP04390 gene: pstS; phosphate ABC transporter, phosphate-binding protein [Clostridium perfringens ATCC 13124] CPF_0618 [Clostridium perfringens ATCC 13124]  ali follow..  10  1MNRRRVVIALSSILAMGFLLTG----CGGGSRANIIKISGSSSVGPLVEAEAEVFKKEMDITVEVNQLGSSAGIKDAI----NGTVEIGISSRDLKEKELESGIKEKPIAYDGMSV---IINNENPVQNLTMEQIRDIYTGKI-----TNWKEVGGEDTPIVLVSREDGSGTRDAFQEIVGFNSEEISP------------QAQISDGSGSIKTMVAGNKNAIGYI---SFSYVDDSVHAVSIDGVKPTAENVQNKK-LLVYKEENLNENSKKFIDFIMSKEGQEIVEEDGLISVT.................................................... 272
54 -18.000IDP91988 phosphate-binding protein PstS 1 (PBP 1) [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007640 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MKKRKKLALSLIAFWLTACLVGCA---SWIDRGESITAVGSTALQPLVEVAADEFGTIHGKTVNVQGGGSGTGLSQVQ----SGAVDIGNSDVFAEEKDGIDASALVDHKVAVAGL-ALIVNKEVDVDNLTTEQLRQIFIGEV-----TNWKEVGGKDLPISVINRAAGSGSRATFDTVIM----------------QSAMQSQEQDSNGAVKSIVSKSPGAISYL---SLTYIDDSVKSMKLNGYDLSSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGLKYIPIKE.................................................. 274
55 -17.800IDP91964 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007935 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  1MKFKSAVLLTASLAVLAACGSKNTASSPDYKLEGTLKFMTASSPLSPKDLILQRLEKETGVHIDWYQSDFAEKRNLDISSGDLP--DAIHNSDVDLMNWAKKGVIIPVEDDEKPEYKALMTAPDGHIYSFHSVNDMAWINKDWLKEMPKTTDDLIDPNGNGEIPFTFISGNGNEDFKFLFAAFD--NDNYKEGVKFIRQLQEKGLIHDWNSYIAKGHDQKFGVYFTWDKNNVTGSNES--DVLPVLAGPSGMGFARDKMVITSVNKNLELTAKWIDAQYAPLQSVQN............................................................. 382
56 -17.500IDP05439 hypothetical protein lmo2499 [Listeria monocytogenes EGD-e] lmo2499 [Listeria monocytogenes EGD-e]  ali follow..  1MKKKYLGIVAMLAAVMLVFAAANGSTKGDKEVSGSLTAVGSTALQPLVEAASKEFTNTNKAQINVQGGGSGTGLTQVQ----QGAVEIGNSDVFAEEKDGVDASKLVDHRVAVVGM-APVVNKDVGVKNITKQQLIDIFTGKT-----TNWKDVGGKDEKITIINRAEGSGTRATFEKWGL----------------KTPIKAQEQDSSGTVRKIVSETPGAISYL---AFSYIDASVVGLSLDGVEPTTNDWKIWSYEHMYTNGEPKGLTKTFLKYMTSDEVQNNIVPQLGYQSIKSMK................................................ 289
57 -17.300IDP05694 hypothetical protein lmo2007 [Listeria monocytogenes EGD-e] lmo2007 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKKKWGVIIASLCLLLGLSACGSDE-KADANEVPTLKWYPQKDTEEVMKEVNKYTEEKIGVKVEMTQIDWGDYGKRMQT-NSGENFDIAYSAAGEFVSYSQKGYLDKEGKKMKAELNDVLWEGDGNIYGVVGEQQVYVFNKNLVDKYVKNFSDL---PMLKTIKENEPSITPIGGNKDFKPAFPYEQPETLDILKSLHSFYQKGYVATSTDPWSYDKENWFVRIEKYQPYAENIWDKNTGGKYKVVTQPIANSVTGAIQAVSVTSQHPEEAVKFLDLLNTDEYLRNLVD........................................................... 350
58 -16.400IDP91442 ABC-type phosphate transport system, periplasmic component [Vibrio vulnificus CMCP6] VV1_0466 [Vibrio vulnificus CMCP6]  ali follow..  11  1MKRWWLSLLLMGGISASAQALDTPPYKKIPGVSGNLLSVGSDTLAGMTTLWVEEFKALYNINAQVQASGSSTAPPALT----EQTAQFGPMSLREVEAFERTHGYKPTALRVAIDAIGIFVHQDNPVQGLNFPQLDAIFSATL-EDFVSTWAQLIDAEWAKRQLFGRNSVSGTYGYFKKHALCGGDFKSQVNEQP------------GSASVVQSVASTLSGIGY------SGVGYRVAGVRLLPIAKQGNEFVYPSRENILTGDALSPIEAEFIKFIYSAQGQALVEKDGYVSITEEFAK............................................... 309
59 -15.700IDP92625 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19F] SpneCMD_010100009638 [Streptococcus pneumoniae str. Canada MDR_19F]  ali follow..  1MKNWASASVVALAAGLAACGNLTGNSKKAADSGDKPVI-KPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSV-SSGENYDIAFADNYIVNAQKGTELYKKEGKDLYKALDPAYIKGNGKIYAVVASSQNFAFNGTLLAKYVTSYETL---PVLKQIKEKAPDVVPFAIGKVFIPSDN-EVPRFKEHLKTLHKIPKDVATSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFQTTQVANFVISNNSKNKEKSMEILNLLNTNP.................................................................. 346
60 -15.300IDP04240 extracellular solute-binding protein [Clostridium perfringens ATCC 13124] CPF_1077 [Clostridium perfringens ATCC 13124]  ali follow..  10  4RKKALSLILSGIVCSSLILTGCGNSKEEESKETVNLTWYEPADNDIVEEEVNKYLKDKINATVDIKHIPFGDYTKKMSV-NSGEPYDLAFTCSFPYLEYARKGLLDTEGAPLKKEINKELWKGDGKIYAVIALAPMWVFDKELVEENIHSVNDLVKEKEPDFIPFYTQGDSIPLDFDDIVNPLG-ESKEMKDMLLKLREYYEAGYINQDAAVTDMKPEVKFVWKADGQPYAENIWGKSLGREVVTSSIIPPYITTGAMTAISANSKHPKKAMELLTLVNTDT.................................................................. 337
61 -14.600IDP04378 extracellular solute-binding protein [Clostridium perfringens ATCC 13124] CPF_2335 [Clostridium perfringens ATCC 13124]  ali follow..  10  1MLKFLTACAMLTTSVALTGCGADKTANAGEGETVKLTWYTPKDLDMVQEKANEYLKEKINATIDMKFIDYGDYTQKMGV-NSGEPYDLAFTCSNPYLENARKGLLETKGKEMKSVIDERFWEGDGKTYAVIGVAPMWVFTKEYVDKYIHTLEDL---PWLKVIHENEPDVTPLYITKGFSAPAY-ETDKMKSELETLQKYYDAGYINADSATAKDDKAVKFVTKADGQPYADGLWSKDLGYEVVSSPIMDTHITNGSTIAISKTSEHPEKAMEFLNLLNTDV.................................................................. 340
62 -14.300IDP04329 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1466 [Clostridium perfringens ATCC 13124]  ali follow..  11  1MLKNLLGGIIGTSSILAGCGSGGSASSSDGEGEKPVNL-PQNDGELVEEEVNKYIKDKINATVDIKHIDFGDYSQKMNV-NSGEEYDLAFTCSFPYLDNARKGLIDSHGKDLKNVIDERLWKGDGNIYAVIAGAPMWVFDKELVEQDIHSVDDLIKEKEPDFVPFYTQGDGIPIEGIEDITSGLGETEELKHLFTKLREFYEKGYINQDAAVSNMKNEVKFVWKADGQPYAENGWSQSLGREVVTSSIVSSYVTNASTTAISATSKHPEKAMELINLVNKDS.................................................................. 343
63 -13.400IDP05398 putative phosphonate ABC transporter, phosphonate-binding protein [Bacillus anthracis str. Ames] BA_3750 [Bacillus anthracis str. Ames]  ali follow..  13  2LKKFFAMSTTVVLAAGLLSGCGTKESSANKNADQFVPSQNADTLEAKAKPLEKLLSDKLNIPVKVSISTN---YNTIVEAMASKQVDVGFLPPTAYVLAHEKKAANVILQAQRFGVDDETGAPKKDLVDFYKSEFVVKKDSNI-----NSVKDL-----KGKIGYQDVSSAGYVWPAAVLLKEGVDP----------LKDVKPVTLKGHDQSLIALLNGDVDAAVVFQDARNIVKKDYPNIFDQTKIVKFTEKIPNDTISVRSDLDEKKLQDAFIEIGKNEEGHKIIKE........................................................... 284
64 -13.300IDP05622 ABC transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD0999 [Peptoclostridium difficile 630]  ali follow..  10  1MKKYISIILLVVLTMVVLVGCSPGKDNPKNKELSKVAVPDGLPAVAIAKLANENPEIKEGYETVYSIEKTPE---AISTRVMKKDADIAIVPSNMAAIAYNKTSSYNIVG------------------TVGMGSLYLVSTENI-----KDYSDL-----VGKVGCTGKGLTPDITIKSLLLQKDINYSDIK------------NYVSSASELVPLLATGKVKTGIVPEPALSALMSKNPDIKIIK-YPQSTLIVKSEFL-----RDNKDFVDSFVGQLSNEELGAYSEK........................................................... 271
65 -12.300IDP91135 hypothetical protein SAOUHSC_00137 [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00137 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  1MKRLSIIVIIGIFIITGCDWQRTSKERSKNAQNQQVIKIGYLPITHSANLMMLSQYNHPKYKLELVKFNNW---PDLMDALNSGRIDGASTLIELAMKSKQKGSNIKAVA------------------LGHHEGNVIMGQKGM-----NEFNNNGDDY---HFGIPHRYSTHYLLLEELRKQLKIKPGHFS-------------HEMSPAEMPAALSEHRITGYSVAEPFGALGEKLGKGKTL--VIPDAYCCVLVLRGELLD--QHKDVAQAFVQDYKKKQSVDIMTH........................................................... 263
66 -11.800IDP05042 putative sulfonate ABC transporter, sulfonate-binding protein [Bacillus anthracis str. Ames] BA_2921 [Bacillus anthracis str. Ames]  ali follow..  14  1MYKKFKVLSFTLAISLFLFGCEKSTASSKKEDVTVQIGIQQGLSPLLLAQKKGWFEEEFGVKVKWTEFQSGPPYFEAIA---SNRLDFGEVGNSPVISAQAAGI-------GFTEIANTSYARKGT---------GILVQKD---SKITSIKEL-----KGKKIAVAKGSSAFNLLYRALDKEGINAKDVN-------------IQLQPDEAQPAFESGSVDAWAIWDPFISLHTVNKGA---KVITDGERLNVSSPEFLIARTKEHPELVEKFLKVYEKDEAIKIYTSAKKIDA..................................................... 268
67 -11.700IDP05357 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_0382 [Bacillus anthracis str. Ames]  ali follow..  1MKKGLKVMLAALLAVGVAGCNPAKKEESASKDQKVLDWFPNTNHTGLYVAQAKDYYKKQGLDVEIIQPGDNVTAEQMIA---SGKADFAISAQENVTLARVEGI---------------------------VVSVGAIIQHNTSAFASLKKDNMTSPKFEGKRYGGWGGPAEEATLKTIMDKHQADFNKVE-------------KIILGQTDFFKSIGRDADFEWIY-YGWDGIEAKRQGKELNTIMVKDDPALDFYSPVMITSKQDKDFVKKFMS--ATTEGYNFAIKEPKEAADILIKAVPDVNKDLVQESQKWLSTKYQDDAKAWGVQKE---EVWTNYM..... 304
68 -11.600IDP91987 ABC transporter substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100008765 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  1MKKTLTLVTALVAVVLVACGQGTASKDNKEAELKKVDFTPNTNHTGLYVAKEKGYFKEAGVDVDLKLPPEESSSDLVIN----GKAPFAVYFQDYMAKKLEKGA---------------------------ITAVAAIVEHNTSGIISRKSDNVSSPKLVGKKYGTWNDPTELAMLKTLVESQGGDFEKVE------------KVPNNDSNSITPIANGVFDTAWIY-YGWDGILAKSQGVDANFMYLKDVKEFDYYSPVIIANKDNKEEARKVIQYAMEEEAADILIKNA......................................................... 271
69 -11.200IDP05563 hypothetical protein lmo2417 [Listeria monocytogenes EGD-e] lmo2417 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKKVLGLIFTLSLVLVLTACGGSSDKASSSKDDKQLVVGASNTPHAQILEQAKPILKDKGIDLKIVKYTDYVMPNKALEE-----------GDLDANYFQHKPYLELEEKEKGYKFAD---------GAIHIEPMGI-YSKKV-----KDIKDLKDG---AQVLLSNSKSDWPRVIGIFVDN---KDNPKNLKFKYDFDPAYLMTAYNNEEGDVVAINSNFVVDQGLNPSKDAIAIESKDSPYANI------------VVTTEKKKDDKNITELVKVLHSKEIQDYITKEW......................................................... 267
70 -11.100IDP91970 lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005433 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  3IKKWLGLVALATVAGLALAACGNSEKKADNATTIKIATVNRSGSEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATAD-----------GEVDLNAFQHYNFLNNWNKENGKDLVA----------DTYISPIRLYSGLNGSANKYTKVEDIPA---NGEIAVPNDATNESRALYLLQSA--DVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYKKALFKEQADENSKQWYNIIVA--ETSPKADAIKKVIAAYHTDDVKKVIEESS......................................................... 276
71 -11.100IDP05207 putative sulfonate ABC transporter,solute-binding lipoprotein [Clostridium difficile 630] CD2365 [Peptoclostridium difficile 630]  ali follow..  12  1MKLSLILFGVMGTSILTGCSSKPKEKEEAKTGKDTVGYYNCDHMTAGPVAESAGIYKDLGLNVKTV--GNGKVPEAMAA----GKMDAGYIGTKGLVGAIPKGSPITIAANNHTG-----------------GSEYLIVSKDI-----KEPKDL-----IGKKIATDMSDFLWTSDYGPETGLPTDPSKYE------------VNMDSDKDKYLALKTGKIQAFTSCDPWGSVAENDGAGKIIASTQYKEKANGKEYNCCSF--KEHPDLAKKLVEYIYTAEAAKIFAK........................................................... 268
72 -10.500IDP04366 amino acid ABC transporter, amino acid-binding protein [Clostridium perfringens ATCC 13124] CPF_1531 [Clostridium perfringens ATCC 13124]  ali follow..  10  1MKKLLFLLISIVILSILISGCSSKKI-ETKKDSNTVIIMGFKNEKGDIVDLSKEAFKRMNLKVIFQPIDWSMKETELTNGN----IDLIWNGYTMTHEREKKAFTNSY---------------------LKNRQVIVTLSNSNI----NTLNDL-----KGKTVTTQDGSSSLDTLFERPKLTKSFKNGEPVLFD------------SFNDCFMDLEAGRSDAVVCDEILAQYYIFKNDPSKFHVL--TEDLGEESYSIGLRKNSNLIDHLNKTLEDMKEDGTIAKISNKWF........................................................ 256
73 -10.300IDP05714 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_0175 [Bacillus anthracis str. Ames]  ali follow..  11  1MKKVLLSIVSGAVLLLGACSAGSDK-EVKALDEKKITVGVTGGPHEQIFEKVKEVAAKDGLEIDVKVFNDYVAPNVSLDE-----------KSLDVNSYQTKSYLDVFKAERNMKLTE----------STVTFPMGV-YSKSL-----KDVKDLKDG---DAIAVPNDPTNELRALKLFEKA--DPKATEKATAKDVIENPKNLKIVELEASQLPTQLSEVKAAAINTNFALGAKLSPAK---DSIFREGKDSPYVNWVVVRTENKDDAVVNKLKKAYQSKEVKEFIEKKF......................................................... 262
74 -10.000IDP01699 extracellular solute-binding protein [Yersinia pestis CO92] YPO3343 [Yersinia pestis CO92]  ali follow..  12  1MQMKKLSLGIMVLALISSQHVLAKNW-QEIKQSGELRILAFHDKQGQLIDMANAFGEDLKLKVNFVSTSWPTLSDDLAADK----FDIAMGGVTATPGREAQALSHAVVKNGKIALTH--------------------------CQKVNKFPTLDAIDRQNVKVIVNPGGTNQSFVDANIK-------------------AQIIRTKDNVANLQGIRNKSADIMFTDLIEGDYYQSKEPGVFCVATPEVLAGTGSYKVYMMAKD--NQPLLEEVNQWLAGKTKTLLAQK........................................................... 251
75 -9.950IDP05633 amino-acid ABC transporter,substrate-binding protein [Clostridium difficile 630] CD2177 [Peptoclostridium difficile 630]  ali follow..  14  1MKKLKLIIMFALVSALLVTGCSSGNN-KNKEEQKVIRVFAFKDKDKLKGDFWDEFAKRTNCKVEWVLTDFSGLFGLLEADK----ADAVSAQLTATPEREKKAFSDAY----------------------NYSGTNIIVRED--DTSIKSIDDL-----VGKKVGVGTGAVANEILKEKYPNDEIKIVNYSSA--------------TLKGNYQDLEMGRLD-AVVAQDVEALIAIKEQKLNLKMI--EPPIQFGACSFALQKNEKGEKWTKEINEVIEEMYKDGTLTK........................................................... 250

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.