current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP02139 gene: gmk; guanylate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4009 [Bacillus anthracis str. `Ames Ancestor`], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDGVDYFFKEREEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQVKKAFPEGVFIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIDMMDAYDYVVENDQVELACERIKAIVVGEHCRRERVAKYYKEMTEGLLast
1 -100.000IDP02139 gene: gmk; guanylate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4009 [Bacillus anthracis str. `Ames Ancestor`]  ali  100  1MRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDGVDYFFKEREEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQVKKAFPEGVFIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIDMMDAYDYVVENDQVELACERIKAIVVGEHCRRERVAKYYKEMTEGL 205
2 -98.700IDP01611 gene: gmk; hypothetical protein lmo1827 [Listeria monocytogenes EGD-e] lmo1827 [Listeria monocytogenes EGD-e]  ali follow..  64  2..TERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSREVFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGIFIFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIKGIVETEHLKTERVIHRYKKMLEGL 204
3 -98.500IDP06283 gene: gmk; guanylate kinase [Streptococcus pneumoniae TIGR4] NP_346174 [Streptococcus pneumoniae TIGR4]  ali follow..  61  2..ADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTREEFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVFIFLTPPDLDELQDRLVGRGTDSAEVIAQRIEKAKEEIALMREYDYAIVNDQVPLAAERVKCVIEAEHFCVDRVIGHYQEMLPKS 204
4 -94.800IDP90539 gene: gmk; guanylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC2708 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  41  22.SMGKGTLYIVSAPSGAGKSSLIAALLEQNPTAMKVSVSHTTRGMRPGEQDGVHYHFVEKEHFIELIGKGEFLEYAEVFGNYYGTSRVWIENTLNKGIDVFLDIDWQGARQIRSQMPEAKSIFILPPSKEELERRLNTRGQDSDAVIAKRMGEAKSEISHYSEYDYVIINDDFDVALMDFKAIIRAERLKQDKQAAKYSAMLSAL 226
5 -94.000IDP90623 gene: gmk; guanylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1177c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  36  2..KLQGFVLLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREGEKNGIHYHFISHEEFQKGIDSDHFLEWARVHENFYGTSLKHTQNALDNGKIVVFDIDVQGFKIARKKMADIVSVFITTKNKDELKKRLIKRNTDTIIQLEKRLQNASDEMKELSEYDYLIINDELKQSYEALRAILIAHKFRTKGQN.......... 195
6 -93.600IDP06121 gene: gmk; guanylate kinase [Helicobacter pylori J99] NP_223024 [Helicobacter pylori J99]  ali follow..  39  2..NNDFNLLILSGPSGAGKSTLTKYLQEKIPK-THFSLSTTTRKPREGEVDGLHYNFVSEEEFKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPNACSVFISTKNQEILKERLLLRGTDSKETIEKRLINAYKEMQCLESFDYLIINEDLEKSKEIILSIAKTLVHRLKAFN.......... 193
7 -79.900IDP92045 guanylate kinase, putative [Toxoplasma gondii ME49] TGME49_042730 [Toxoplasma gondii ME49]  ali follow..  37  100LRDTAPRILVVAGPSGVGKGTLVKRIFAKWPQAFGFSISHTSRQPRPGETHGKEYFFCSREEFEKLKKEGHFVESAEFSGNCYGTSFAAVDNVRRGERICLLEIDMAGVLQIQSTAQEANFVFIQPPSIEELKARLRGRRTENEEHIAKRLAAAQRELALAKEFDFYLTNDNLEDAWQKLEAQLVQWYGPVFKKAAGPGEKRSRL 308
8 -13.100IDP05086 deoxynucleoside kinase family protein [Bacillus anthracis str. Ames] BA_0014 [Bacillus anthracis str. Ames]  ali follow..  15  7YDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPKEMHGRYENRLNINEYDILKDGDSIEPIIKKIGHFLKQTR................. 218
9 -12.800IDP92081 thymidylate kinase, putative [Toxoplasma gondii ME49] TGME49_106970 [Toxoplasma gondii ME49]  ali follow..  13  4FTPKRGCLVVFEGIDRSGKSTQARLAYERLTKE-----AELIRFPDRTTPIGQVLDRFLANASWSSDGQHPQVPPPQLTHLLFAANRARILRALGEGRTVLVDIAYTVGAERGLLAPDAVFFLDVAPQETQKRGGYGDEVYEKLA-TQERVYQVYRQFDNLPYWRRIASSLSIEELHEKLFEQLKS................... 245
10 -12.700IDP01125 ABC transporter, ATP-binding protein BA_5175 [Bacillus anthracis str. Ames]  ali follow..  14  18LQIQKEKITCIIGESGSGKSTLLRML-------------NDLQSPTSGIINGKLISDYPPIQLRRMLGQTPPIFDGTIKDNLMGLRLSEKPFPNDDILRSALKTSLSGGEKQRLAFARIV---LMDPPVYLLDEPTSALDSDTERRVMKQFTTLAREKKKT----VIFITHSQQLPEEIADDIIEISKANGATRKEVLSV..... 215
11 -12.700IDP01671 gene: cysA; sulfate/thiosulfate transporter subunit [Yersinia pestis CO92] YPO3012 [Yersinia pestis CO92]  ali follow..  15  23LDIPSGQMVALLGPSGSGKTTLLRIIAGENQNAGRLSFHGTDVSRLHARDRRVGFVFQHYALFRHMTVFDNIAFGLTVLPRRERPNAAAIKQKVGQLLEMVFPSQLSGGQKQRVALARAL---AVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELK----FTSVFVTHDQEEAMEVADRVVVVSQGNIEQ............ 217
12 -12.300IDP00988 gene: yehX; putative ABC-type proline/glycine betaine transport system ATPase component STM2163 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  22LHFSEGSFSVLIGTSGSGKSTTLKMIVEHDSGTIRFAGEEIRSLPVLELRRRMGYAIQSIGLFPHW----TVAQNIATVPQLQKWSRARINDRIDELMALLYPHQLSGGQQQRVGVARAL---AADPQVLLMDEPFGALDPVTRGALQQEMTRIHQLLGRT----IVLVTHDIDEALRLADHLVLMDGGHVIQ............ 215
13 -12.000IDP02381 gene: proV-1; glycine betaine/L-proline ABC transporter, ATP-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2279 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  13  23LEIKKGEFFVLIGPSGCGKTTTMKMIIETTEGSILIDGKDIQQYNINELRWDIGYVLQQIALFPHM----TIAENIAVVPEMRKWSKEKIKARVDELLQMV---ELSGGQKQRIGVVRALAIVLMDEPFSALDPLSREQLQKDIVQLQKKIQKT-----------IVFVTHDMQEALSLGDRICIMKEGKVVQ............ 217
14 -12.000IDP02039 putative ABC transport ATP-binding subunit [Yersinia pestis CO92] YPO1198 [Yersinia pestis CO92]  ali follow..  14  22LQISKGEFTVLIGTSGSGKSTTLKMIIEHDEGKIRFAGEEIRNYKPEDLRRRMGYAIQSIGLFPHW----TVERNIATVPQLLKWPKDRIRQRVVELLELLYPHQLSGGQQQRVGVARAL---AVDPEVLLMDEPFGALDPVTRSALQLEITRIHQLSGRT----IVLVTHDIDEALSLADRIVLMDEGRVIQ............ 216
15 -11.900IDP01763 gene: ssuB; aliphatic sulfonates transport ATP-binding subunit [Yersinia pestis CO92] YPO3627 [Yersinia pestis CO92]  ali follow..  16  33LRITAGQFVAVVGRSGCGKSTLLRLLAGLEAASDGTLLSGNALLSHAKDETRLMF------------QEARLLPWKKVIDNVLGLRGHWRDEALQVLDTVGLA-ALSGGQKQRVALARAL---IHRPRLLLLDEPLGALDALTRIEMQGLIERLWQQHGFT----VLLVTHDVSEAIALADRVLLIEEGRIGL............ 214
16 -11.700IDP90611 gene: tmk; thymidylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC2016 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  2....NAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLV---ENVIKPALARGEWVVGDQAYQGGGRLGDFKPDLTLYLDIDPKLGLERARGRGRIEKMDISFFERARERYLELANSDDSVVMIAAQSIEQVTADIRRALQDWLSQVNR............ 211
17 -11.700IDP00731 ABC transporter, ATP-binding protein SACOL2462 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  23LKVDKGESIAIIGPSGSGKSTFQKQI-------------CNLFSPTSGELKGKPYNDYDPEELRQRIQQSDLFGETIEDNMIFPSLARNDKFDRKRAKQLIKDVNMSGGERQRIAIARQL---MYTPDILLLDESTSALDVNNKEKIENIIFKLADQ-----GVAIMWITHSDDQSMRHFQKRITIVDGQISN............ 212
18 -11.500IDP00730 amino acid ABC transporter, ATP-binding protein SACOL2453 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  23LDIQSGEFIAFIGTSGSGKTTALRMIIEATEGQIEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHM----TIKENIVLVPKLLKWTKEEKDKRAKELIKLVYPAELSGGQQQRIGVVRAL---AAEQDIILMDEPFGALDPITRDTLQDLVKTLQRKLGKT----FIFVTHDMDEAIKLADKICIMSEGKVVQ............ 216
19 -11.500IDP01490 ABC transporter, ATP-binding protein VCA0602 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  55LSIEKGEFVCFLGPSGCGKTTLLRAIAGDLPTSGTIHQNQQAITFLPPEQRDFGIVFQSYALFPNL----TVEENIAIGLRNQGMSVRDALEKVEQWLEMI---QLSGGQQQRVALARAL---ALSPGLLLLDEPLSALDAKVRTHLREEICQLQRKLG----ITTIMVTHDQEEALTMADRIVVMNHGVIEQ............ 245
20 -11.400IDP01464 ABC transporter, ATP-binding protein VC2520 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  27LHVPKGKVTAIMGPSGIGKTTLLRLIGG-------------QLLPEQGEIDGENIPTLSRRKLYRLFQSGALFTDLNVFDNV-ELDEAMIKTLVLLKLEAVMPSELSGGMARRAALARAI---ALDPELIMYDEPFVGQDPITMGVLVELIRNLNRALG----VTSVVVSHDVPEVMSIADWVYLLADGKV.............. 221
21 -11.400IDP01336 gene: potA; putrescine/spermidine ABC transporter ATPase protein VC1428 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  38LDVNHGEFLTILGPSGCGKTTVLRMIAGETADQGQILLDDQDVTQVPAEQRHVNTVFQSYALFPHM----TVFENVAFGLRMQKVPQSEIEPRVMEALRMV---QLSGGQQQRIAIARAV---VNKPKVLLLDESLSALDYKLRKQMQSELKQLQRQLG----ITFIFVTHDQEEALSMSDRIIVMRSGKIEQ............ 228
22 -11.300IDP05129 gene: adk; adenylate kinase [Clostridium difficile 630] CD0091 [Peptoclostridium difficile 630]  ali follow..  19  2..EMDNMRIILLGPPGAGKGTQAVGIVEKYNDIFRKNIKEGTELGKKAKEYMDQGLLVPDELTVGLVTDRISQEDCKNGFMLDGFPRDIFLKNAGISLDKVVNIEVDKSILVSRAVGRRIHVEFNPPKVEGV-GELYQRADDNEETVSKRIQVYLDETKPLVDY--IKGDQAIDKVFEDIVAALGSGK................. 221
23 -11.300IDP02096 gene: prk; phosphoribulokinase 1 [Yersinia pestis CO92] YPO0178 [Yersinia pestis CO92]  ali follow..  17  2..STKHPVIAVTGSSGAGTTTTSLAFRKIFQQLAQIEGDSFHRYTRPEMDAHISYFGPEANDFGQLEQSAEYSKHGTGRSRKYLPGTFTPWEPLPEPTDVLF---YEGLHGGVVTEHHDVLVGVVPIVNLEWIQKLVRRGHSREAVMDRSMDDYINYITPQFSRTHINFQ................................... 206
24 -11.300IDP01902 gene: potG; putrescine transporter ATP-binding subunit [Salmonella typhimurium LT2] STM0878 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  40LTIYKGEIFALLGASGCGKSTLLRMLAGEPPSSGQIMLDGVDLAHVPPYQRPINMMFQSYALFPHM----TVEQNIAFGLKQDKLPKAEITSRVNEMLGLV---QLSGGQRQRVALARSL---AKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVG----VTCVMVTHDQEEAMTMAGRIAIMNRGKFVQ............ 230
25 -11.300IDP01341 gene: fbpC; ferric transporter ATP-binding subunit VCA0687 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  27LEIKKGSLVTLLGPSGCGKTTVLRLVAGEKPTSGQIFIDGEDVTERSIQQRDICMVFQSYALFPHM----SLYENVAYGLKMLKLPSEEVRQRVDEALKIV---QISGGQQQRVALARAL---VLKPKVLLFDEPLSNLDANLRRSMRETIRELQQRFD----ITSLYVTHDQAEAFAVSDTVIVMKQGDIMQ............ 217
26 -11.200IDP02608 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0178 [Coxiella burnetii RSA 493]  ali follow..  15  24FEVKDGETLVLLGSSGSGKTTLMKRLIEPTSGTIKIEGKDVREYNLSELRRSIGYVFQQIGLFPHM----TIEKNITILLKLLHYPKAKRIQRAAELLEMVYSDELSGGQQQRVGVARALAYLLMDEPFGALDAMTRSALQEEMIHLNQKLGKT-----------IVFVTHDIFEAFRIADRIAVMHKGKLEQ............ 218
27 -11.200IDP00713 spermidine/putrescine ABC transporter, ATP-binding protein SACOL1108 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  25IDIESGYFYTLLGPSGCGKTTILKLIAGEYPDSGEVIYQNKPIGNLPPNKRKVNTVFQDYALFPHL----NVYDNIAFGLKLKKLSKTEIDQKVTEALKLV---EMSGGQKQRVAIARAI---VNEPEILLLDESLSALDLKLRTEMQYELRELQSRLG----ITFIFVTHDQEEALALSDFLFVLKDGKIQQ............ 215
28 -11.200IDP01471 phosphoribulokinase VC2613 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  2..SAKHPIIAVTGSSGAGTTTTSEAFRKMFNMMAWVEGDSFHRFTRPEMDVHISYFGPQANDFPTLEEFRQYGKVGTGQVRRY-PGTFTPWQSLPENSDVLF---YEGLHGGVVDGDVNVLIGMVPIVNLEWIQKYVRRGHSREAVMDRSMDDYLKFITPQFSRTHINFQ................................... 206
29 -11.100IDP01891 gene: prkB; putative phosphoribulokinase [Salmonella typhimurium LT2] STM3464 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  2..SAKHPVIAVTGSSGAGTTTTSLAFRKIFAQLAEVEGDSFHRYTRPEAGRHISYFGPEANDFSLLEHTIEYGQTGKGQSRKYLPGTFTPWQPLPEPTDVLF---YEGLHGGVVTPQHDVLVGVVPIVNLEWIQKLIRRGHSREAVMDRSMDDYINYITPQFSRTHINFQ................................... 206
30 -11.100IDP91820 gene: adk; adenylate kinase [Escherichia coli str. K-12 substr. MG1655] b0474 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  3........IILLGAPGAGKGTQAQFIMEKYGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQKEAGINVDYVLEFDVPDELIVDRIVGRRVHVKFNPPKVEGK-EELTTRKDDQEETVRKRLVEYHQMTAPLIGY......................................... 181
31 -11.100IDP06247 gene: adk; adenylate kinase [Streptococcus pneumoniae TIGR4] NP_344771 [Streptococcus pneumoniae TIGR4]  ali follow..  14  3........LLIMGLPGAGKGTQAAKIVEQFHDMFRAAMANQTEMGVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLGYPRDKTLAELGIELEGVINIEVNPDSLLERLSGRETFHKVFNPPVDYKEEDYYQREDDKPETVKRRLDVNIAQGEPIIAH--IEGNQDINDVFSDIEKVLTNLK................. 212
32 -11.100IDP01607 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1608 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  24FTIPTNKITTILGPSGAGKTTILQLIAKPTLGKICIDNAIIEKNTKETQLEKL------RHRMGFLFQSGALFTHLSVYDNI-NLDEKLIRNIVLLKLQAVMPSELSGGMARRVALARSI---AMDPDIMMYDEPFTGQDPASFNKLLELISTLNESLN----MTSIIVSHDIQESLSISDHIIIVGNKKIIA............ 221
33 -11.000IDP00333 gene: coaE; Dephospho-CoA kinase FTT1487 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  1MNFINTYPIGITGGIASGKSTATRILKEK----LNLNVVCADTISREITKKPSVIKKI-AEKFGDEIVMNKQINRAMLRAIITESKNKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKVIVIKADLETRIRRLMERDGKNRQQAVAFINLQISDKEREKIADFVIDNTTNQELESKLITTINE................... 198
34 -11.000IDP02079 iron ABC transporter, ATP binding subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0173c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  23LHVKEGEFLSILGGSGSGKSTLLRIIA---------KLEQASSYDLFSCKGEVALMFQNYALFPHLNVEKNILFALYDKKDKNQILNHLLKTFEIEDLRYKKIDEISGGQAQRVAFARAM---ARGCKLLLLDEPFSNLDQNLKQDLRRELKKMIENQG----ITAIMVTHDIEDAYCMSDQIAFLEKGKILA............ 199
35 -11.000IDP00480 gene: adk; adenylate kinase YPO3118 [Yersinia pestis CO92]  ali follow..  16  3........IILLGAPGAGKGTQAQFIMEKYGDMLRAAVKAGSELGLKAKEIMDAGKLVTDELVIALVKERITQEDCRDGFLLDGFPRTIPQKEAGIKVDYVLEFDVPDELIVERIVGRRVHVKFNPPKVEDK-EELTIRKDDQEATVRKRLIEYHQQTAPLVSY......................................... 181
36 -11.000IDP04500 gene: adk; adenylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC0986 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  3........IILLGAPGAGKGTQAQFIMEKFGDMLRAAIKAGTELGKQAKAVIDAGQLVSDDIILGLIKERIAQADCEKGFLLDGFPRTIPQKEMGINVDYVIEFDVADDVIVERMAGRRAHVVYNPPKVEGK-EDLVIREDDKEETVRARLNVYHTQTAPLIEY......................................... 181
37 -10.900IDP02287 gene: adk; adenylate kinase [Francisella tularensis subsp. tularensis SCHU S4] FTT1161 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  16  3........IILLGAPGAGKGTQAKIIEQKYNDMIRETIKSGSALGQELKKVLDAGELVSDEFIIKIVKDRISKNDCNNGFLLDGVPRTIPQDKLGVNIDYIVEVDVADNLLIERITGRRIHTKFNPPKVADK-EPLITRTDDNEDTVKQRLSVYHAQTAKLIDF......................................... 181
38 -10.900IDP02339 gene: proV; glycine betaine/L-proline transport ATP-binding protein [Yersinia pestis CO92] YPO2647 [Yersinia pestis CO92]  ali follow..  16  49LAIEEGEIFVIMGLSGSGKSTLVRLL-------------NRLIEPTRGEVDGEDIAKISDSALRTVFQSFALMPHLNVLDNLAGIPLLERNEKALEALRQV---ELSGGMRQRVGLARAMAILLMDEAFSALDPLIRTEMQDELVKLQAKHQRT-----------IVFISHDLDEAMRIGDRIAIMQGGEVVQ............ 245
39 -10.900IDP02015 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0107 [Coxiella burnetii RSA 493]  ali follow..  14  26LRVSAGEMFGVIGKSGAGKSTLIRCV-------------NLLERPDKGSVDGQVLTTLSSKVLRQVFQHFNLLSARTAYQNLLGKNPTEIRKVVLPLLELTYPSQLSGGQKQRVAIARAL---VTNPTVLLCDEMTSALDPETTHSILQLLKNINRELN----LSILLITHEMEVIKTVADRVAVLDQGRIVEE........... 222
40 -10.800IDP01758 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0728 [Coxiella burnetii RSA 493]  ali follow..  14  31LTIHRGEIVAIIGPSGCGKTTLLRSILM-------------LRKPTAGTIFGINILECSRAEALSMFQSSALFSSLRVLENV--LHSEAQTKLALLKIALVYPAELSGGMKKRAALARAM---ALDPELLFLDEPTTGLDAKSARELNELILHLRKTLE----LTFVMVTHDLDTLWQVPDRVFFLGEGKVLA............ 228
41 -10.800IDP92034 adenylate kinase, putative [Toxoplasma gondii ME49] TGME49_024900 [Toxoplasma gondii ME49]  ali follow..  15  32.LAKPEGRYIFIGAPGSGKGTQSVKLKKSHCDMLRHAVATGTEYGKQAKAKLDAGELVSDEIVLGLIDEKLKTPECRRGFILDGFPRDNLLKQKNQKLDGVLYFDVPDNILVERVSGRRIHVTYHPPKVAGL-EPLHHRKDDNEATLKKRLDVFHKETVPVIEH--MDAAKDSTAVTKEMYDFVGKHHKSF.............. 255
42 -10.700IDP02457 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1248 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  26LDIPFEKISCIIGASGCGKTTLMREILM-------------LQPIYSGKILGQEISKLADNPIKRMFQHCALFSSLTNLQNV-KLPIDILTDIAIIKLKMVYPSEISGGMLKRVALARTI---ALDPKVVFLDEPNAGLDPYSARAMDDLILYLKEELK----MSVVMITHDLSTIWHIVDDIIYMDEKRIML............ 225
43 -10.600IDP04119 adenylate kinase [Bacillus anthracis str. Sterne] BAS0131 [Bacillus anthracis str. Sterne]  ali follow..  16  3........LILMGLPGAGKGTQAEQIVAKYNDMFRAAMKAETEMGLQAKSFIDKGALVPDEVTIGIVRERLSQEDCVRGFLLDGFPREEIMKDLGKKIDYVLNINVDSGLLLKRLTGRRIHLEFNAPAKADV-GELYQRSDDNEETVANRLDVNIKQTKPLLDF--INGEQDINKVFADIDVLIGG................... 214
44 -10.500IDP00916 gene: metN; DL-methionine transporter ATP-binding subunit STM0247 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  26LHVPAGQIYGVIGASGAGKSTLIRCV-------------NLLERPTEGSVGGQELTTLSESELTKIFQHFNLLSSRTVFGNLDNTPKEEIKRRVTELLDLVYPANLSGGQKQRVAIARAL---ASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLT----ILLITHEMDVVKRICDCVAVISNGELIEQ........... 222
45 -10.500IDP01155 Methionine import ATP-binding protein metN 2 BA_0312 [Bacillus anthracis str. Ames]  ali follow..  14  26LSVEKGEIFGIIGFSGAGKSTLLRLV-------------NMLERPTAGTIDDKDITSLSTKELRKIFQSFNLFNSRTVFGNLAKVPKNEIKERVNELLKFVYPEQLSGGQKQRVGIARAL---ATSPDILICDEATSALDPETTTEILNLLKKVNREYN----LTILLITHEMHVVKEICHRVAVMEKGKVIEE........... 222
46 -10.400IDP00935 gene: modC; molybdate transporter ATP-binding protein STM0783 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  19ETLPASGITAIFGVSGAGKTSLINAISRPQKGRIALNHDAENGICLTPEKRRIGYVFQDARLFPHYKVRGNLR---------YGMAKSMTGQFDKLVSLLGIE-SLSGGEKQRVAIGRAL---LTAPELLLLDEPLASLDIPRKRELLPYLQRLAREIN----IPMLYVSHSLDEILHLADKVMVLEDGQVKAF........... 210
47 -10.400IDP00325 gene: coaE; dephospho-CoA kinase Cj1530 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  3......NAFFVTASIACGKSTFIEIA-----NSLGFKSISADKIAHKILDENALELEKIFSPFKNLLKKEKKIDRKILGEIVFNNKEAQMQILDKENKAFFVEIPLFFESGAYENLGKVIVIYT---PKELSLKRIMQRDKLSLEAAKARLDSQIDIEEKLKKADFIIKNTSYADFRQECVKVIQE................... 195
48 -10.400IDP00706 ABC transporter, ATP-binding protein SACOL0504 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  26FTVNRNDIFGVIGYSGAGKSTLVRLV-------------NHLEAASNGQVDGHDITNYSDKMMRDIFQHFNLLNSATVFKNLSKKSKTEIKQRVTEMLEFVFPDELSGGQKQRVAIARAL---VTNPKILLCDEATSALDPATTASILTLLKNVNQTFG----ITIMMITHEMRVIKDICNRVAVMEKGKVVET........... 222
49 -10.300IDP06310 gene: coaE; dephospho-CoA kinase [Streptococcus pneumoniae TIGR4] NP_345452 [Streptococcus pneumoniae TIGR4]  ali follow..  16  3......KIIGITGGIASGKSTVTNFLRQ-----QGFQVVDADAVVHQLQKPGGRLFEALVQHFQEIILENGELNRPLLASLIFSNPDELREQLAQTEEIFFMDIPLLFEQDYSDWFAETWLVYV---DRDAQVERLMKRDQLSKDEAESRLAAQWPLEKKKDLASQVLDNNNQNQLLNQVHILLEG................... 194
50 -10.300IDP02511 gene: sufC; ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_1359 [Coxiella burnetii RSA 493]  ali follow..  15  22LTINAGEVHAIMGPNGSGKSTLASVLAGREDYAIV-DEDLFELSPEDRAAKGLFLAFQYPVEIPGVNNLYFLKTAVNSIRKTRGEAPFDAIDLMGLVKEKLALVDMEGFSGGEKKRNEILQMLMLDPRLAILDETDSGLDIDALQTVAKGVNSLRNK................................................ 194
51 -10.300IDP01389 iron(III) ABC transporter, ATP-binding protein VC0610 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  25LQVNPGEIVCLLGASGCGKTTLLKAIAPLASGQLSLNCVTLDDGKRPPEQRNIGMIFQDYALFPHLTVAQNVG---------FGLDAMPAKQKEAKIAEMLALVQLSGGQQQRVAIARAL---AYKPDLLLLDEPFSNIDTQVRHELIIEIRKIFKQQG----VTAIFVTHSREEAFAFADKMAVMNRGVIEQ............ 217
52 -10.200IDP02375 gene: engB; GTPase EngB [Bacillus anthracis str. `Ames Ancestor`] GBAA4701 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  13  26........IALAGRSNVGKSSFINKILNRK------KLVRISSKP--GKTQTLNFFLINEMMHFVDVPGYGYAKVSKTERAAWGKMIETYFTTREQLDAAVLVVDLRDVMMYDFLKHYDIPTIIIATKADKIPK----------GKWQKHLKVVKETLDIESGDEVVLFSSETGLGKEEAWKAIHK................... 191
53 -10.100IDP00635 gene: modC; molybdenum ABC transporter, ATP-binding protein ModC SACOL2270 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  19IDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKAD-QLLTDTAKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHI----DQLIQTLNIDHLMKQYPMTLSGGEAQRVALARAL---STKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQ----IPIIFVTHSNYEAEQMAHEII..................... 198
54 -10.100IDP01501 maltose/maltodextrin transporter ATP-binding protein VCA0946 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  24LEIQEGEFVVFVGPSGCGKSTLLRCIAGEDITSGDLYIGEQRMNDVEPSKRGVGMVFQSYALYPHL----NLYDNMSFGLKLSKADKSEIKKRVDHAAEIL---ALSGGQRQRVAIGRTLVVFLLDEPLSNLDAALRVQMRSEITKLQRKLGCT-----------MIYVTHDQVEAMTMADKIVVLDAGFVSQ............ 214
55 -10.100IDP00127 gene: sufC; cysteine desulfurase ATPase component NT01ST1705 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  22LEIRPGEVHAIMGPNGSGKSTLSATLAGREDYEVT-GKDLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRAYRGQASLDRFDFQDLMEEKIALLKMPEDLLTRKKRNDILQMAVLEPELCILDESDSGLDIDALKIVAEGVNALRDDKRAF----IIVTHYQRILDYIKPDYVH..................... 217
56 -10.100IDP01505 amino acid ABC transporter, ATP-binding protein VCA1037 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  24LTVNKGEIVVICGPSGSGKSTLIRTV-SIDSGEIIVLPELDERTRRSGKIG-QHFNLFPHLTVLENLTLAPIRTLKLSAQEAKERAYHFLQRVKITDQTHKYPIQLSGGQQQRVAIARSL---CMQPEILLFDEPTSALDPETINEVLEVMVDLAQD-----GITMMCVTHEMGFARKVAHRVMFMDEGEILEV........... 214
57 -10.000IDP01835 gene: coaE; dephospho-CoA kinase [Coxiella burnetii RSA 493] CBU_0152 [Coxiella burnetii RSA 493]  ali follow..  17  2......LRIGLTGGIGSGKSTVANYFAE-----LGAPVIDADQIAHEITKPDQAAFKQIINHFNAVLTKGKFLNRTKLRELIFENPRQWLENLLIKAPYCILAIPLLAEASQSVDFIDRILVVDAPETLQI--QRTKSRDQLSDQQIQLILQSQSPREKRLAIADDVIVNDTIPILRKAVFQL...................... 189
58 -10.000IDP02756 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_2038 [Coxiella burnetii RSA 493]  ali follow..  13  38LHVSPGEIIGITGTNYSGKTTLLEFILGFHT-------------PTKGEIDGKNIENYDKMILREKIAARGQIFRGTLLENITMFRPERAKQALELSDHFGLSVGGGCSEILSRGVVQVVSTLISKPKILLSDEANALLDLKTDQLFLKILQSLKKRPSTLALADRLYELDSILKTHSNGRSL...................... 240
59 -9.940IDP01660 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0776 [Coxiella burnetii RSA 493]  ali follow..  12  24FAIKRGQIVGLIGPNGAGKTTLLKSILGLTNYSGELNVLGLNPRSDRVKLMHHLCFIADVAILPRWIKVENLIE---FVEGVHPNFNREKALGFLNKTNIKMHQKVKELSKGMIVQLHLALVMAIDVEILVLDEPTLGLDILYRKNFFHTILNDYYNEKRTIIIATHQVEE-IESILTNLIMIDRGELLLESSMEEIAERF.... 220
60 -9.860IDP06058 gene: coaE; dephospho-CoA kinase [Helicobacter pylori J99] NP_223488 [Helicobacter pylori J99]  ali follow..  17  5......NAIALTGGIGTGKSTTLKILES-----QGYKILDADKIAHQLLQEHRL-----AQRFGSDILEKDILNRKKLGAIVFQNANEKACELEKNHQAYFLDIPLFFEVGGKKRYPVSRVVLIYAPRALQIE-RLLERDKLKEAEILQRLACQMDIEQKRAMSDYIIDNSSLKDLNKQVERFLKT................... 194
61 -9.830IDP00760 maltose ABC transporter, ATP-binding protein, putative SACOL0192 [Staphylococcus aureus subsp. aureus COL]  ali follow..  16  25LHITDKEFIVFVGPSGCGKSTTLRMVAGESITSGDFYIDGERMNDVEPKNRDIAMVFQNYALYPHM----TVFENMAFGLKLRKVNKKEIEQKVNEAAEIL---ALSGGQRQRVALGRAIVVFLMDEPLSNLDAKLRVQMRTEILKLHKRLNTT-----------TIYVTHDQTEALTMASRIVVLKDGDIMQ............ 215
62 -9.760IDP01669 ABC transporter ATP-binding protein [Yersinia pestis CO92] YPO3048 [Yersinia pestis CO92]  ali follow..  15  24MELKRGEVVSLLGPSGSGKTTLLRAV-------------AGLEKPSQGHIDGSSHSEIEERNLGLVFQSYALWPHKTVSENVYPISTSEISQRVQAVLEQL---QLSGGQQQRVAIGRAL---VYNPPVILLDEPLSNLDAKLREEARVFLRELIMNLG----LSALMVTHDQNEAMAISDRILLLNNGKIEQ............ 220
63 -9.700IDP91389 Type II secretory pathway, component ExeA [Vibrio vulnificus CMCP6] VV1_1437 [Vibrio vulnificus CMCP6]  ali follow..  17  40..DMGEGIVKVTGEVGTGKTMVCRMLIDQLSDKVNLVYLPNPV--------------LSGHELQMAIAREMGLKTYD--VSLVPLIQDCLIGMRQRGMRTVLLVD---AQALPLEAMEALRLFIAQHELRQFRQRITFSIEEGVAFIDSRLAKA................................................... 205
64 -9.620IDP00151 gene: mshM; MSHA biogenesis protein MshM VC0403 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  21  40..EMGEGVSKLTGEVGTGKTMVCRMLLTHLGDEVALIYLPNPM--------------LSGEELRQAVAAELQLDVASP-VRVVEQIQTRLIELHQQGKRVVALVD---AQALSDEALETLRLFLAQHHLRQFRQRITFNQAETEVYIESRLQKA................................................... 205
65 -9.580IDP00717 phosphate ABC transporter, ATP-binding protein SACOL1421 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  57LDIYENQITAIIGPSGCGKSTYIKTLNR---------VELVPSVKTAGKIRDQDIFFQQPNPFPKSIYDN-ITYGPKIHGIKNKKVLDEIVEKSLRGAAIWDELSLSGGQQQRVCIARCL---AIEPEVILMDEPTSALDPISTLRVEELVQELKEKYT------IIMVTHNMQQAARVSDKTA..................... 249
66 -9.560IDP01423 gene: ugpC; glycerol-3-phosphate ABC transporter, ATP-binding protein VC1552 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  44LSIHQGEFIVLVGPSGCGKSSILRSIAGESITSGEIHLAGRRVDNEKPANRDIAMVFQNYALYPHM----SVYDNLAYGLKNRGVDKQTIAAKIAKVAKTL---KLSGGQRQRVAMGRAIVLFLFDEPLSNLDAALRAHMRLEIKKLQRELGVT-----------SVYVTHDQVEAMTLADRIVVVKQGEIEQ............ 234
67 -9.550IDP06094 gene: engB; ribosome biogenesis GTP-binding protein YsxC [Helicobacter pylori J99] NP_224193 [Helicobacter pylori J99]  ali follow..  11  27........MVILGRSNVGKSTFINTLLGK-------NLAKSSATP--GKTRLANFFSTTWEDKENALTTTFNV-YAKVSKSLKKEWEGFLWELLSVRVSIKLFIHLIDARHLDLEIDKNAKENIQALLRPDQAYLSLFTKFDKLNKNEQHRLFLNAPKPFLINTIHFNALSSKYPTLEIVRQTLLK................... 201
68 -9.530IDP00430 gene: sfuC; iron(III)-transport ATP-binding protein YPO2960 [Yersinia pestis CO92]  ali follow..  15  24LHVPPGSRTAIVGPSGSGKTTLLRII-----AGFETPDAGKVILQGKAMFDGTTYVPAHKRGIGFVPQDGALFPHFTVAGNIYGLKGSQRDKERRINELMDM--EISGGQQQRVALARAL---AQRPVLMLLDEPFSALDTALRASTRKAVAELLSEANIA----SILVTHDQTEALSFADQVAVMRAGKLAH............ 216
69 -9.530IDP02084 gene: adk; adenylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0639c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  17  4.......LFLIIGAPGSGKTTDASLIAQADATNIHYSTGDLLRAASGSELGKTIDSFISKGNLVPLDVVINTIVYALKAAPTKTIIIDGYPRSVEQMMEFDKVLSEQNEICLK-------GVIEVRVSEEVAKERVLGRNRDNEEVFYNRMKVYTEPLNEILDF--IDGERTIEPIVADMKELIKK................... 188
70 -9.490IDP00099 gene: ynhD; putative ATP-binding component of a transport system NT02SF1983 [Shigella flexneri 2a str. 2457T]  ali follow..  15  22LDVRPGEVHAIMGPNGSGKSTLSATLAGREDYEVT-GKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDG................................................ 194
71 -9.440IDP93923 urea ABC transporter ATPase protein UrtD [Yersinia enterocolitica subsp. palearctica Y11] YP_006005730 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  15  30LQIRRGEVRCVIGPNGAGKSTFFKLLTGEHTPSRFFNRRLNTLAPFQRIRMGMSIKFQIPGIFPELTVEQHLQLSLSHLRPEVSSQAVSVDELLERKLSAEYHQLAGNLSHGKKQWLEIAMAVSLQPTLLMLDEPVAGLSIDETYLTGELIKQMQGD-----GLTLMVVEHDMTFVRQIASQVT..................... 213
72 -9.380IDP00863 gene: ccmA; heme exporter protein STM2254 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  22FTVEAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQP--GIKTRLTARENLHFFHPGDGARLPEALAQA--GLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQ................................................ 174
73 -9.380IDP01066 gene: ccmA; heme exporter protein STM3819 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  22FTVDAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQP--GIKTRLTARENLHFFHPGDGARLPEALAQA--GLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQ................................................ 174
74 -9.320IDP02474 gene: pebC; amino acid ABC transporter ATP-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0922c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  22LSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVS-NLVLNHKNKIEICRKYCAMHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSL---CTKKPYILFDEPTSALDPETIQEVLDVMKEISHQSNTT----MVVVTHEMGFAKEVADRIIFMEDGAIVEE........... 217
75 -9.310IDP91081 ABC transporter, ATP-binding/permease protein [Clostridium difficile 630] CD2817 [Peptoclostridium difficile 630]  ali follow..  19  375AEVKSGQMVAIVGPTGAGKTTLINLLMRFYD-------------VKKGAIDGVDIRDMKRKDLRSMVLQDTWLFNGTIFENIYGRFGATKEEILPDGYNMFLNEEASNISLGEKQLLTIARAFISDPSILILDEATSSVDTRLELMLQKAMRNLMNRLSTIRNADLILVMNN................................. 563

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.