current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP02752 gene: grxB; glutaredoxin 2 [Francisella tularensis subsp. tularensis SCHU S4] FTT0650c [Francisella tularensis subsp. tularensis SCHU S4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MKIYLYHHCPYCIKVRLVADLSNFDYQMIILANDDEKAHIDRIGSKQVPFLEKDDGTFIKESDEICKFIAKVQNFEIAESTIDDFVKGCITDLEPHYRRIIYPRIPHHPRNECDFPTQSAKEYFINKKSQYIGDFDALLRNPPYDSIRAINQILAKIDPFIKTPFINSEKFSWDDINIFPIFFILTMSKDLLEIPTNITNYIKNIEAKTNIELYLast
1 -102.000IDP02752 gene: grxB; glutaredoxin 2 [Francisella tularensis subsp. tularensis SCHU S4] FTT0650c [Francisella tularensis subsp. tularensis SCHU S4]  ali  100  1MKIYLYHHCPYCIKVRLVADLSNFDYQMIILANDDEKAHIDRIGSKQVPFLEKDDGTFIKESDEICKFIAKVQNFEIAESTIDDFVKGCITDLEPHYRRIIYPRIPHHPRNECDFPTQSAKEYFINKKSQYIGDFDALLRNPPYDSIRAINQILAKIDPFIKTPFINSEKFSWDDINIFPIFFILTMSKDLLEIPTNITNYIKNIEAKTNIELY 214
2 -89.000IDP00895 gene: grxB; glutaredoxin 2 STM1165 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  30  1MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSRYLPESMDIVHYVDNLDGKPLLTGKRNPAIEEWLRKVNGYVNQLLLPRFAKSAFD--EFSTPAARQYFIRKKEASSGSFDNHLAHS-AGLIKKIGDDLRLLDKLIVQPNAVNGELSEDDIHLFPLLRNLTLVAG-IHWPTKVADYRDNMAKQTQINLL 210
3 -60.300IDP91217 gene: sspA; stringent starvation protein A, regulator of transcription [Francisella tularensis subsp. tularensis SCHU S4] FTT_0458 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  4VTLYTTKYCPYSLRARIALAEKKMSTDIVEAGDLEPAMIKKITPNGVFPVLM-EKDYSINNRKALLIYIDERFPAPSLLPNVVNE-RIKIRLSLDKIDNEWYPVLDQIRKHRSD-------------------------QKMLESMFKDLKESLLAMEKAFGSEFFISSGFTLADCYIAALIICLEAEGFIIDEYGAIYEYKKRLFARDSVK.. 190
4 -60.300IDP91540 gene: sspA; stringent starvation protein A [Francisella novicida U112] FTN_0549 [Francisella tularensis subsp. novicida U112]  ali follow..  12  4VTLYTTKYCPYSLRARIALAEKKMSTDIVEAGDLEPAMIKKIAPNGVFPVLM-EKDYSINNRKALLIYIDERFPAPSLLPNVVNE-RIKIRLSLDKIDNEWYPVLDQIRKHRSD-------------------------QKMLESMFKDLKESLLAMEKAFGSEFFISSGFTLADCYIAALIICLEAEGFIIDEYGAIYEYKKRLFARDSVK.. 190
5 -58.600IDP01516 gene: sspA; stringent starvation protein A VC0576 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  11MTLFSSASDMYSHQVRIVLAEKGVSFEVELVDENLPAELIELNPYKTVPTLV-DRELALYDSKIIMEYLDERFPHPPLMPVYPVARGNSRLMI----------------------------YRIERNWYSLAEKVVNGSPEVAENARNKLRNDLLTLGPVFEFEYFMSEEFSLIDCYLAPLLWRLPVLGIDLPGSKELKVYMNRVFERDSFL.. 197
6 -56.900IDP91539 gene: mglA; macrophage growth locus, protein A [Francisella novicida U112] FTN_1290 [Francisella tularensis subsp. novicida U112]  ali follow..  11  1MLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSELNIITPNGNIPTLS-TDDFAVYRLSVIIEAIEDLYPFPPMFPVFPKQRANARILLEYVNKTFLQNIIKLQSPDLDEKQANEIKMLMQRDIISTY-------------------KTIVSEREVNAESNPDAQNINVLTLIITFVFYYFIKLKISITKDKNIIKEIKELLSEPNFI.. 197
7 -56.900IDP91216 gene: mglA; macrophage growth locus, subunit A [Francisella tularensis subsp. tularensis SCHU S4] FTT_1275 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  1MLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSELNIITPNGNIPTLS-TDDFAVYRLSVIIEAIEDLYPFPPMFPVFPKQRANARILLEYVNKTFLQNIIKLQSPDLDEKQANEIKMLMQRDIISTYKKIVSEREVN-------------------AESNPDAQNINVLTLIITFVFYYFIKLKISITKDKNIIKEIKELLSEPNFI.. 197
8 -54.000IDP00943 gene: yliJ; putative glutathione S-transferase STM0862 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  2ITLWGRNNSTNVKKVLWTLEELELPYDQILAGGNQDADYLAMNPNGLVPLLKDDEDLLLWESNAIVRYLAAQYGQNRLWVDNPARRAEGEKWMDWANQTLSPAHRVILMGLVRTPPEKRD-------------------QAAIEAGIEKCDSLFALLDDLAHQPWFSGDNFGTGDIAIAPFVYNLLNVGLKWTPRPNLERWYQQLTERPAFR.. 200
9 -46.600IDP01081 putative glutathione S-transferase STM4267 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  2LTVHHLNQS--SQRILWALEELALPYQIVRYQREKPPALKKVHPLGKSPVIE-DHGMVIAESGAILEYLQDTYDSIGRFKPADAQGKQHYRFWLHYAEGSLMPLLLMRLLFTSLGKPPVPLGLRTLGGVIGKGAQKAYLNPQLETHARFIDGHLA------NHPWFAGEQLSMADIQMSFPLFALLARGG-IAHLDHINAWKARVEMRPAWQ.. 208
10 -46.000IDP00887 gene: yfcG; putative glutathione S-transferase STM2349 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  2IDLYYAP-TPNGHKITLFLEEAELAYRLLKVDIQFRPDFLAISPNNKIPAIVDGQPLSLFESGEILLYLAEKSGK--LLSGELRERHTTLQWLFWQVGGL---------------PMLGQNHHFNHFAPQAIPYAIERYQVETQRLYNVLNKRLE------TSPWLGGDHYSIADIASWPWVNAHQRQRIDLDTYPAVYNWFERIRTRPATA.. 200
11 -40.600IDP06287 glutathione S-transferase [Streptococcus pneumoniae TIGR4] NP_345997 [Streptococcus pneumoniae TIGR4]  ali follow..  11  43FQLYSLG-TPNGVKVTILLEEKEAAYDLYKIAIQFGSDFVKLNPNSKIPALLDTENVRVFESAHILLYLAEKFGA--FLPSNPVEKVEVLNWLFWQAGAA---------------FLGGGFGHFFNYAPEKLEYPINRFTMEVKRQLDLLDKELA------QKPYIAGNDYTIADIAIWSWYGQLVQGN-DASSYQNLVKWAEKIANRPAVK.. 252
12 -39.600IDP01774 putative glutathione S-transferase YghU [Yersinia pestis CO92] YPO3639 [Yersinia pestis CO92]  ali follow..  11  46LQLYSMG-TPNGQKVTILLEEKGAEYDAHLIRIQFSSGFVSINPNSKIPALMDTPPVRVFESGAILLYLADKFGH--FLPKSHAARTEALNWLFWLQGAA---------------YLGGGFGHFYHYAPVKIEYAIDRFTMEAKRQLDLLNTQLK------THEYIAGDEYTIADIAIWPWYGSLVLGFLDVKSYPHLIRWTETIAKRPAVQ.. 254
13 -24.100IDP01316 glutaredoxin, putative VC1616 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  4VVLYIKDKCPHCKDAQRYLDSKGIKYRLCNAKMERGRKELDALGARSVPVLKIGDRLM-WNHTNFERIYSS............................................................................................................................................... 75
14 -21.600IDP01801 gene: grxA; glutaredoxin 1 [Francisella tularensis subsp. tularensis SCHU S4] FTT0533c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  21  3VKIYTRNGCPYCVWAKQWFEENNIAFDETIIDDYAQRSKFVIFPISTVPQIFI-DDEHIGGFTELKANADKILNKK.......................................................................................................................................... 86
15 -20.700IDP01063 gene: grxC; glutaredoxin 3 STM3702 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  4IEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVEEMIKRSGRTTVPQIFIDAQHILDARGGLDPLLR................................................................................................................................................ 83
16 -9.610IDP00581 putative arsenate reductase YPO3070 [Yersinia pestis CO92]  ali follow..  11  4VTIYHNPRCSKSRETLALVEQQGITPQVVLYSVDKLKELLQQLGFSDARQLMRTKEDLYKTGLTQDQLLQAMADNPKLI....................................................................................................................................... 93
17 -9.390IDP00841 arsenate reductase, putative SACOL0876 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  2IKFYQYKNCTTCKKAAKFLDEYGVSYEPIDITINEFKTIIANTGVEINKLFNTHGAKY-LQTLSDDEKLELLSSDGMLV....................................................................................................................................... 92
18 -9.280IDP01300 arsenate reductase VC2165 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  3VVIYHNPKCSKSRETLALLENQGIAPQVIKYSVEELKRLYQQLGLNEVRAMMRCKEELYKEQLSDDALFAAMAEHPKLI....................................................................................................................................... 92
19 -9.230IDP01783 gene: arsC1; arsenate reductase [Francisella tularensis subsp. tularensis SCHU S4] FTT0824 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  2IKVFGINNCTSVRNTLKFFEEKDKKVEYVNLTWQEMQKIKQIGHFETIDLFNSNGKLF-FDSLSEEEAFKLLVTDALLF....................................................................................................................................... 92
20 -9.020IDP05008 putative arsenate reductase [Clostridium difficile 630] CD1777 [Peptoclostridium difficile 630]  ali follow..  13  2IKLYGYTKCSTVKKAKNWLKENNLEFEDIDMSKEELKSIYKTSGYDIKKFFNTSGMKY-VKTESDDKLLEILVSDGMLI....................................................................................................................................... 92

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.