current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP05362 conserved domain protein [Bacillus anthracis str. Ames] BA_1821 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MKRKILTLFTLICLALPIQASAYTFQSLPTASKSKQWYIEIDKSHSTNKQAVQTKQGVYDTYNLLVKNIGNDVSNVSVEILDNTPVSKATINPITLNNNVSKSHTSSDYMAFPLDPNSHNFKVIITWEEKNFSYNGHPVNESKQMKETFVFNEELast
1 -90.800IDP05362 conserved domain protein [Bacillus anthracis str. Ames] BA_1821 [Bacillus anthracis str. Ames]  ali  100  1MKRKILTLFTLICLALPIQASAYTFQSLPTASKSKQWYIEIDKSHSTNKQAVQTKQGVYDTYNLLVKNIGNDVSNVSVEILDNTPVSKATINPITLNNNVSKSHTSSDYMAFPLDPNSHNFKVIITWEEKNFSYNGHPVNESKQMKETFVFNEE 154
2 -19.500IDP05503 putative lipoprotein [Bacillus anthracis str. Ames] BA_4863 [Bacillus anthracis str. Ames]  ali follow..  15  1MKRALFFFISIFFLG------SCSIWYVTFSSESKSWTGQYKGHIKDDS----------EDGMFTFRYKGGDGNTEFKNLEIAINGAFSTMTQTSENHKGAKIEMKSSCVSCAPLSKDEPIEIVIKWDDKY--------------EEKMVLKRK 124
3 -10.200IDP05488 putative LPXTG-motif cell wall anchor domain protein [Bacillus anthracis str. Ames] BA_4789 [Bacillus anthracis str. Ames]  ali follow..  18  1MKKVSVLPAFIITFVCMLAFLVMPYGNASAKLADGTYDINYVIQKAENDSASMANDYFEKPAKLIVKN-GEMRVQVPMNHSAWITEFKAPENGNFVDAKVVSKDESADKREFKVDDLSKPAAVKI............................. 126
4 -9.900IDP90095 ZZZ_0011 [Escherichia coli 042]  ali follow..  1LMTIKCLLLAVMVCPFFITACSDAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLFLQASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLH-IDRNEGTKYVGVVAGYYPFPGKQ.................... 142
5 -9.510IDP05175 hypothetical protein lmo1656 [Listeria monocytogenes EGD-e] lmo1656 [Listeria monocytogenes EGD-e]  ali follow..  11  1MNRKMRLLKGLMAFIV--GISIIATPIITVYAASNKVAISMNRRAVNGA-----TNGKYHSLN-SAKGFGNSNPNSTVTLHKEKFGIDDYFGRVSISSGKNYFYKNKTKE---ANAKSSKYYLKAEKAMDWYTVKIEGTISN............ 143
6 -9.170IDP05698 hypothetical protein lmo2186 [Listeria monocytogenes EGD-e] lmo2186 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKKVLVFAAFIVLFSFSFLSTGLTAQA---ALKDGTYSVDYTVIQGDSDSASMANDYFDKPATVTVNG-GK--STVSLQVNHSKWITGLWVEGNAVSVTSKNASSDTRKVSFPVSTLSNPVNAKI............................. 119
7 -9.040IDP05417 conserved domain protein [Bacillus anthracis str. Ames] BA_4788 [Bacillus anthracis str. Ames]  ali follow..  1MFKQFKMIIAVFAVLFTFIATLGLQDAKAATKADGKYNIAFTVWKGDKDESSRMNRYFESPATLTVKN-GKQYVSFKVKDSTSIKSFQVEKDGQFVETTVLSENKKDNTREFEVADLSKKLNGKVK............................ 128
8 -8.740IDP05463 spore coat-associated protein [Bacillus anthracis str. Ames] BA_1288 [Bacillus anthracis str. Ames]  ali follow..  12  3LKKKLGMGIASAVLGAALGTFAFFSDKEVSNNTFATGTLDLALNPSTVVNVSNLKPGDTVEKEFKLENKGTLDIKKVLLKTDYNVEDVKK................................................................ 95
9 -8.600IDP91936 hypothetical protein SpneCM_03100 [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003100 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  1MKKTFFLLVLGLFCLLPLSVFAIDF-------KINSYQGDLYIHADNTAEFRQK-EEDFKGQIVGLGRAGKMPSGFDIDPHPKVQAAKNGAELADVTSEVTEEADGYTVRVYNPGQEGDIVEVDLVWN.......................... 125
10 -8.540IDP05159 gene: calY; camelysin [Bacillus anthracis str. Ames] BA_1290 [Bacillus anthracis str. Ames]  ali follow..  18  3LKKKLGMGVASAALGLSLGTFAYFSDKEVSNNTFAAGTLDLTLDPKTLVDIKDLKPGDSVKKEFLLKNSGS................................................................................... 76

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.