current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP06124 hypothetical protein jhp0592 [Helicobacter pylori J99] NP_223310 [Helicobacter pylori J99], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MGNLTYYAYMYLILFVCLLPVLLVGLAWRLTRPPLKQNIPNKSLSLENLNEQIKNLQSVPALEKLKNRFNERFKICPKDKETLWLETIQNLVASEFFELEDAINFGQELENANPNYRQKIANATGLALKNKKEKGLast
1 -97.900IDP06124 hypothetical protein jhp0592 [Helicobacter pylori J99] NP_223310 [Helicobacter pylori J99]  ali  100  1MGNLTYYAYMYLILFVCLLPVLLVGLAWRLTRPPLKQNIPNKSLSLENLNEQIKNLQSVPALEKLKNRFNERFKICPKDKETLWLETIQNLVASEFFELEDAINFGQELENANPNYRQKIANATGLALKNKKEKG 135
2 -7.630IDP95017 Set165a_002 [Vibrio cholerae O1 biovar El Tor]  ali follow..  27  115LGVLGLFIFGDLLLAVIIIALFGLGLALRYHRALAKHQAITKYNEVSN....................................................................................... 162
3 -7.220IDP93894 lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005558 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  10  3.........LTQKISLLLAASVLAGCA---------TAPKPIYHWDNYQSTVYEYYKSDASPEQQIAALKESIEKSRAQGLPVPPGLHAHLGMLYG-HTDLAMTEFNTEKSAFPESTPFMDFLMSKDKGAFK... 118
4 -6.890IDP90329 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_548 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  4.........MFWLNSLVFFSLLLSACGYTVLSPHYVEKKFSLSEGIY--VCPIEGDSLGDLVSSLSYELEKRHTRSQGTSSGYVLKVSLFNETDENIGFAYTPQKPDEKPVKHFIVSNEGRLALSAKVQLIKNRT 129
5 -6.410IDP06536 gene: ezrA; septation ring formation regulator EzrA [Enterococcus faecium DO] AFK59814 [Enterococcus faecium DO]  ali follow..  1MGN----VIIGIVIAIIIVAIVVFLVSYLMKKKNQDRKEELFDLPVIEEVDDVKKMHLVGQSQNTFREWSQKWNDISTSSFAELESQIFEVENLN--AVVEAEATMDQMEKQVTEIREGLKELRETEERNSLA.. 145
6 -6.410IDP06423 gene: M5R; M5R [Monkeypox virus Zaire-96-I-16] NP_536511 [Monkeypox virus Zaire-96-I-16]  ali follow..  23...LSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMPKRKIPDPIDRLRRANLACEDDKLMIYGLPWITTQTSALSINSKPIVYKLLRSINGSQPVSLNDVLR............................... 127
7 -6.080IDP04696 gene: YPCD1.15c; hypothetical protein YPCD1.15c [Yersinia pestis CO92] YPCD1.15c [Yersinia pestis CO92]  ali follow..  25  109SGYISYIGWCYLALVIDLYSRRIVG--SAISS....................................................................................................... 142
8 -5.840IDP06267 hypothetical protein SP_1882 [Streptococcus pneumoniae TIGR4] NP_346314 [Streptococcus pneumoniae TIGR4]  ali follow..  13  1.........MDLLLAIVLIVLAFLGLVRKQIEKEFADNPRLNAEAVRTLLSANGQKPSEAKVQQVYHQIIRQQKAALANNKK..................................................... 80
9 -5.800IDP00784 pathogenicity island protein SACOL0896 [Staphylococcus aureus subsp. aureus COL]  ali follow..  206.....................................................GSPNIKGYTRRDSAYWRDIAFGVSEGERNSTLASITGYLLRRYVDPNLVYGLVSAWASVCPINQSEVNNTFKSILKKDSKNS 289
10 -5.720IDP91450 putative transposase [Vibrio vulnificus CMCP6] VV1_0385 [Vibrio vulnificus CMCP6]  ali follow..  16  109VGDVTYVRWMYLAVVIDLFARKPIV--WAMSVSP------DSKMTGKALSMAFESRGKPRGVKS....................................................................... 168

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.