current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP06216 hypothetical protein HP0408 [Helicobacter pylori 26695] NP_207206 [Helicobacter pylori 26695], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MNIFQTSLKCCVGLVLSVGVLLGDSKAFKVRVDKSLTPPFLNVLSLAFKQDMKKEVIFVITKSNKLSKKVLCDFDAFLLPETLMSGMPKKALFHKEFLFQSKENKTLYAFSLIDSQYCSKGGNYRYELEKLERWFVQKAPELAESYRVNYKNQYNKTQISQKLast
1 -122.000IDP06216 hypothetical protein HP0408 [Helicobacter pylori 26695] NP_207206 [Helicobacter pylori 26695]  ali  100  1MNIFQTSLKCCVGLVLSVGVLLGDSKAFKVRVDKSLTPPFLNVLSLAFKQDMKKEVIFVITKSNKLSKKVLCDFDAFLLPETLMSGMPKKALFHKEFLFQSKENKTLYAFSLIDSQYCSKGGNYRYELEKLERWFVQKAPELAESYRVNYKNQYNKTQISQK 162
2 -5.410IDP05183 putative lipoprotein [Bacillus anthracis str. Ames] BA_5237 [Bacillus anthracis str. Ames]  ali follow..  10  9.............VFILICLVSAGCAKDKEGEKLEYNGRALVIGVVGEKPKDTFRNVKFEEMKLEELEKKSKEVDGFLIMKAHFQEASTDQYKN-PVFFIGLQDKSYSIFITKGIEY............................................. 118
3 -5.340IDP91026 flavodoxin [Yersinia pestis KIM 10] y3142 [Yersinia pestis KIM10+]  ali follow..  4.............VGIFVGTVYGNALLVAEEAENILKDQGHEVKLFDEGT---------LEDWQHYRQHYV----LVITSTTGQGDFPDSIASLFVAVRDQVGFQPELRYGVIADNFCGAGRTFDELLQEQ............................... 114
4 -4.950IDP05623 putative mannosyl-glycoprotein endo-beta-N-acetylglucosamidase [Clostridium difficile 630] CD1034 [Peptoclostridium difficile 630]  ali follow..  11  214...........................FGIKADKAWKGKSVEISTSEHYNEKIVA------RSYNSLQDSVKDHSLFLINNKR----------YRKHGLFEAKDYISQAQALENAGYSTAEDKK-------NRIYAELLIDVIRSYNLQ---LIDNKVETK. 324
5 -4.920IDP06111 hypothetical protein jhp0421 [Helicobacter pylori J99] NP_223139 [Helicobacter pylori J99]  ali follow..  15  20....................LSKNHLSFNLLCERD-AIDFSPKLPKEIHEKFGSLVLFILTLESLMIDAQSVQFEAGFGPNNIGSVVQVGLSGIIQILIKEKNENIVLFNRCDSLELFQKEEPIAQEPKKDE----RESKEWLDSKEALFSNSKNRAILENL 159
6 -4.800IDP00275 gene: N/A; NS1 NP_056776_776-1127 [Dengue virus 2]  ali follow..  12  129.......................HNQTFLIDGPETAECPNTNRAWNSLEVEDYGFGVFTTNIWLKLKEKQDVFCDSKLMSAAIKDN--RAVHADMGYWIESALNDTIEKASFIEVKNCHWPKSHTLWSNGVLE-IIPKNLA-RPGYHTQITGPWHLGKLE.. 274
7 -4.700CPX_91687_91751 Complex of PLMN_HUMAN with STRP_STREQ [Undefined organism]  ali follow..  15 1085REQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPF---------DRSHLKLFTIKYVDVDTNE--------LLKSEQLLTASERN-LDFRDLYDPRDKAKLLYAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRP---EGENASYHLAYDKDRYTEE 1229
8 -4.660IDP00276 gene: N/A; Premembrane/Membrane protein (prM) AAA99437_115-280 [Dengue virus 3]  ali follow..  20........................GKSLLFKTASGINMCTLIAMDLGEMCDDTVTYKCPHITEVEPED---CNLTSTWVTYGTCNQAGEHRRDKRSVALAPHVGMGLDT----RTQTWMSAEGAWRQVEKVETWALRHPGFTILALFLAHYIGTSLTQ.... 150
9 -4.490IDP00266 gene: N/A; Premembrane/Membrane protein (prM) AAX48017_114-279 [Dengue virus 4]  ali follow..  20........................GRPLLFKTTEGINKCTLIAMDLGEMCEDTVTYECPLLVNTEPED---CNLTSAWVMYGTCTQSGERRREKRSVALTPHSGMGLET----RAETWMSSEGAWKHAQRVESWILRNPGFALLAGFMAYMIGQTGIQ.... 150
10 -4.440IDP93954 NS1` protein [West Nile virus] YP_006485883 [West Nile virus]  ali follow..  129.......................ANNTFVVDGPETKECPTQNRAWNSLEVEDFGFGLTSTRMFLKVRESNTTECDSKIIGTAVKNN--LAIHSDLSYWIESRLNDTLERAVLGEVKSCTWPETHTLWGDGILE-IIPVTLA-RPGYKTQNQGPWDEGRVE.. 274

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.