current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP06445 gene: H3L; H3L [Monkeypox virus Zaire-96-I-16] NP_536520 [Monkeypox virus Zaire-96-I-16], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MAAAKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFIELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISFFGLFDINVIGLIVILFIMFMLIFNVKSKLLWFLTGTFVTAFILast
1 -135.000IDP06445 gene: H3L; H3L [Monkeypox virus Zaire-96-I-16] NP_536520 [Monkeypox virus Zaire-96-I-16]  ali  100  1MAAAKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFIELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISFFGLFDINVIGLIVILFIMFMLIFNVKSKLLWFLTGTFVTAFI 324
2 -30.500IDP04456 hypothetical protein [Yersinia pestis CO92] YPO1382 [Yersinia pestis CO92]  ali follow..  13  14....................................VYINLKERTDRNEHIKKELEKVCFPPEKIIRFEAIR-----------------AGSGFIGCAKSHLAVLKMAQENNW-----RNILILEDDMVFEDDDRTNNFLSKLNNIHWDAAFLSASYYIVNAIDDN---------FFKVNFAYLANSYLVNNHYYEKLINNYTESYGLDSNWL-KIMKIDNWYGIYPVIGYQRTDISDIEYKEIDRTHQFTRT---FDKMKAYGSK.......................................................... 224
3 -6.670IDP04295 gene: nuoA; NADH dehydrogenase I, A subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0031 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  25  71......................................................................................................................................................................................................................................................................................IAVLFLVFDLELAFIIMIIFLVVLFLGLIKGALEW........... 131
4 -6.350IDP95198 gene: wagK; WagK [Acinetobacter baumannii] AHB32695 [Acinetobacter baumannii]  ali follow..  10  1MNNNKIALVVI---ALEDAMTIQSLLSFEEKLEHLLIVNNGPAVIDENSAVLTSLAQKHHHVVLEN------------------------QVQNKPLSWIY--------NDFIQQYDADYYVLFDDDTEINIEYQNMLFTAQDIDIELPKIISMSDKAQYYPLVDGVIEQKDGIISNAKEVFSIGSGLVISKGVKEYFI--ENKMELFDSHFALYGVDFSFFRKINRIKQKSKVFNISSRSYINHSLSRAEKETSEWRDKERLYDLVLTLKYYYSYAELRILKLFLRKILGGKIKDALLILSTAFN-HPRCSTNRKDIY..... 287
5 -5.410IDP01691 gene: tolR; tolR protein [Coxiella burnetii RSA 493] CBU_1575 [Coxiella burnetii RSA 493]  ali follow..  32  8..............................................................................................................................................................................................................................................................................................EINVVPYIDVMLVL-LVIFMITAPLL............ 32
6 -5.400IDP04061 gene: YPCD1.07; hypothetical protein YPCD1.07 [Yersinia pestis CO92] YPCD1.07 [Yersinia pestis CO92]  ali follow..  18  8.........................................................................................................................................................................................................................................................................................VFPPFSINIANIFVLTYLSSVLLL-----MLWKILNIYIYGLM 62
7 -5.380IDP95204 gene: wahC; WahC [Acinetobacter baumannii] AHB32284 [Acinetobacter baumannii]  ali follow..  14  1MSINNVCV-LLSTMDNKIPLFLKKNSGVA-------VVINQTKDLDFVGFNNIVF----------------------------------HNFNEKGLSKSR--------NRAILLANSKYCCIADDDIYYVDDYKEKIIKSFDAIPDADVL--VFQIYTPEGLPYKKYKNYIFKMNKFSIMKVSSIEIIFNREAILSKNIRFDERFGLGSLFKS------EENIFLADCLKNGLNIYAVNENLVFHPFESSGKI--------------------INDNFFYDRGAVFFRIYGFFIANLLYFYFSFKKSSNLILMYKGLF..... 249
8 -5.240IDP02444 hypothetical protein YPO2224 [Yersinia pestis CO92] YPO2224 [Yersinia pestis CO92]  ali follow..  16  3.....................................................................................................................................................................................................................................................................................................YLLIFLLVLVVFVISVTL............. 20
9 -5.210IDP06124 hypothetical protein jhp0592 [Helicobacter pylori J99] NP_223310 [Helicobacter pylori J99]  ali follow..  29  1..........................................................................................................................................................................................................................................................................................MGNLTYYAY-MYLILFVCLLPVLLV---LAWRLT........ 31
10 -5.210IDP06139 gene: exbD_1; biopolymer transport protein [Helicobacter pylori J99] NP_223774 [Helicobacter pylori J99]  ali follow..  20  13..............................................................................................................................................................................................................................................................................................ELNITPLVDVMLVL-LAILMVTTPTL............ 37

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.