current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP90101 gene: sseL; deubiquitinase [Salmonella typhimurium LT2] STM2287 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MSDEALTLLFSAVENGDQNCIDLLCNLALRNDDLGHRVEKFLFDLFSGKRTGSSDIDKKINQACLVLHQIANNDITKDNTEWKKLHAPSRLLYMAGSATTDLSKKIGIAHKIMGDQFAQTDQEQVGVENLWCGARMLSSDELAAATQGLVQESPLLSVNYPIGLIHPTTKENILSTQLLEKIAQSGLSHNEVFLVNTGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEVNFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQNDPATTLREFAENFLTLSVEEQALFNTQTRRQIYEYSLQLast
1 -136.000IDP90101 gene: sseL; deubiquitinase [Salmonella typhimurium LT2] STM2287 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali  100  1MSDEALTLLFSAVENGDQNCIDLLCNLALRNDDLGHRVEKFLFDLFSGKRTGSSDIDKKINQACLVLHQIANNDITKDNTEWKKLHAPSRLLYMAGSATTDLSKKIGIAHKIMGDQFAQTDQEQVGVENLWCGARMLSSDELAAATQGLVQESPLLSVNYPIGLIHPTTKENILSTQLLEKIAQSGLSHNEVFLVNTGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEVNFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQNDPATTLREFAENFLTLSVEEQALFNTQTRRQIYEYSLQ 317
2 -36.600IDP06461 gene: I7L; I7L [Monkeypox virus Zaire-96-I-16] NP_536495 [Monkeypox virus Zaire-96-I-16]  ali follow..  44.NGYVVEKYDKSTTAGKVSCIGMMLELVESGHLSRPNSSDEL--------DQKKELTDELTTRYHSIYDVFELPTSIPLAYFFKPQLREKVSKAIDFSQMDLKIDDLSRKGIHTGENPKVVKMKIEPE----RGAWMSNRSIKNLVSQFAYGSEVDYIGFDMRFLNSLAIHEKFDAFMNKHI-KSSTSRFVMFGFCYLSHWKCVIY--DKKQCLVSFYDSGGNIPTEFHHYNNFYFYSFSDGFNTNIGCINVEVNQLLESECGMFISLFMILCTRT---PPKSFKSLKKVYTFFKFLADKKMTLF--KSILFN.... 374
3 -19.100IDP00447 gene: yopJ; targeted effector protein YPCD1.71c [Yersinia pestis CO92]  ali follow..  1............................................................................................MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWFHKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMGGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCFSMVEMDIQRSSSECGIFSFALAKKLYIERD....................................... 188
4 -17.400IDP91474 putative targeted effector protein YopP [Vibrio parahaemolyticus RIMD 2210633] VPA1346 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  48........................................................................................................................................NDIALMDDFIAIANQKKEGLNAHF-------RSPLDMVNYVKSLIPSEDTTARFVVNMGSGGIHCIAVDCAIKNGKCSLIGIDPVTMNSLGASMLAIRLQSVCKRELPETSLVIMETDMQRSQGECLMFSLFLVKKMHKECD....................................... 183
5 -5.310IDP00844 acetyltransferase, GNAT family SACOL0519 [Staphylococcus aureus subsp. aureus COL]  ali follow..  1.....MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENNDVVGHVLLIEVEINSDDKTY----YGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVVVDHCFDYFE................................................................................................................................................................................... 129
6 -4.750IDP05137 hypothetical protein CD0227 [Clostridium difficile 630] CD0227 [Peptoclostridium difficile 630]  ali follow..  21  106..DNKLEDMTSKLLNEEKENIDIVSTVD--------MIQGLLIDMYR.............................................................................................................................................................................................................................................................................. 142
7 -4.340IDP95326 hypothetical protein A51_C0019 [Vibrio cholerae MZO-3] EAY41860 [Vibrio cholerae MZO-3]  ali follow..  10  177.SEAKLPYLKLAANQGYAPAMETLYYRMDTIGELGYEAARTLYLAYRVGEKDRDGNVILQPDPKKAYFYNRLTGALGGEEKLAHLITQEPVHDDDGIPLADENGEPVFEILVTEQEQAEMDKQVAEFVKDIKPNLFLDETSIDLF............................................................................................................................................................................ 333
8 -4.200IDP02233 hypothetical protein lmo0056 [Listeria monocytogenes EGD-e] lmo0056 [Listeria monocytogenes EGD-e]  ali follow..  16  7MSPSELRDRAKTYGQSGRDIEDILSRLSQLQEQLRSQAFMRFDDQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNF........................................................................................................................................................................................................................................ 95
9 -4.130IDP01166 hypothetical protein GBAA_pXO1_0190 GBAA_pXO1_0190 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  7VTPEQLEQAAKTVKNTRSSLEYIHQDLYIASQWSGASSDRF-YQMFNEAKPMMFNILQELDKIAVELERAAVKFREADE.............................................................................................................................................................................................................................................. 89
10 -4.050IDP01826 gene: zraP; zinc resistance protein [Salmonella typhimurium LT2] STM4172 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  44LTTEQQATAQKIYDDYYTQTSALRQQLISKRYE--------YNALLTASSPDTAKINAVAKEME-SLGQKLDEQRVKRDVAMAQAGIPRG................................................................................................................................................................................................................................... 124

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.