current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP90280 oocyst wall protein COWP, putative [Toxoplasma gondii ME49] TGME49_004420 [Toxoplasma gondii ME49], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .
# Score Template Links and tools%idFirst MKLVFPAVCVVALSSETLLKLALGNPGVPPVPSCPPGFSLEQRGCVRSRQVPPIMRCAKKSVLAGNECVTTEFAPSIEVCPEGFIEKNRKCRRVVNAQPQLGCKPGFTLQNGGDCIRVTEDDIITRCPPKSKHTSKGCVTVEKLDVVPSCPRGYELKKNACIMTQNIEPVPSCPQGFAFESGACVRTGAVPPRVSCPRGYKRQDNGCVLFEKHDLEAFCRDGEYDGKKHCRKTTTQPALPHCPAGFSFQNGECVRVQEDIARLECGKGFTLHEDRCVKEVTVAAELQCPPGATLMKDKCAILTSEKPAVTCPDKFIMADGVCKSADVRPAEFVCPKGYTMDRGTGGCVRSTTAKPALSCERGELKKGECSMIQTVPAETACILGGALTPDGCVFIDTAPLSHRCGANFKMDIKGQCATVETIDPEHICPPGFAPSGTKKATCERFLTSPAAIKCPAGFEPAGTKCMKTARIQAIASCPHGFVFHEGACIPYKANGKKKLLast
1 -98.000IDP90280 oocyst wall protein COWP, putative [Toxoplasma gondii ME49] TGME49_004420 [Toxoplasma gondii ME49]  ali  100  1MKLVFPAVCVVALSSETLLKLALGNPGVPPVPSCPPGFSLEQRGCVRSRQVPPIMRCAKKSVLAGNECVTTEFAPSIEVCPEGFIEKNRKCRRVVNAQPQLGCKPGFTLQNGGDCIRVTEDDIITRCPPKSKHTSKGCVTVEKLDVVPSCPRGYELKKNACIMTQNIEPVPSCPQGFAFESGACVRTGAVPPRVSCPRGYKRQDNGCVLFEKHDLEAFCRDGEYDGKKHCRKTTTQPALPHCPAGFSFQNGECVRVQEDIARLECGKGFTLHEDRCVKEVTVAAELQCPPGATLMKDKCAILTSEKPAVTCPDKFIMADGVCKSADVRPAEFVCPKGYTMDRGTGGCVRSTTAKPALSCERGELKKGECSMIQTVPAETACILGGALTPDGCVFIDTAPLSHRCGANFKMDIKGQCATVETIDPEHICPPGFAPSGTKKATCERFLTSPAAIKCPAGFEPAGTKCMKTARIQAIASCPHGFVFHEGACIPYKANGKKKL 499
2 -24.300IDP91691 gene: EFEMP1; EGF-containing fibulin-like extracellular matrix protein 1 precursor [Homo sapiens] NP_001034438 [Homo sapiens]  ali follow..  10  4................................ALFLTMLTALVKSQDTEETITYTQCTDGYEWDRQQCKDIDECDIVPACKGG-----MKCVNHY-GGYLCLPKTAQIIVNNEQP-----QQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNP-SHRIQCAAGYEQSEHVCQDIDECTAG----THNCRADQVCI-NLRGSFACQCPPGYQKRGEQCVDIDECTIPPYC-------HQRCV-NTPGSFYCQCSPGFQLAANTCVDINECDASNQC-------AQQCYNIL-GSFICQCNQGYELSSDRLNCEDIDE------CRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSR-----TCQDINECETTNECREDEMCW-NYHGGFRCYPRNPYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNEN-GEFYLRQTSPVSAMLVLVKSLSGP..... 458
3 -22.000IDP91701 gene: SLIT3; slit homolog 3 protein precursor [Homo sapiens] NP_003053 [Homo sapiens]  ali follow..  14  917CNACLSSPCKNN-------GTCTQDPVELYRCACPYSY--KGKDCTVPIN-----TCIQNPCQHGGTCHLSDSHKDSCSCPLGF--EGQRCEINPDDCEDNDCENNATCVDGINNYVC-------ICPPNYCQHEAKCIPLDK-GFSCECVPGY--SGKLC-----ETDNDDCVAHKCRHGAQCVDTIN-GYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVV--QEPTCRCPPGF--AGPRCEKLITVNVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGW--TGPLC-----DQEARDPCLGHRCHHGKCVATG-TSYMCKCAEGYGGDLCDNKNDSAN------ACSAFKCHHGQCHISDQGEPYCLCQPGF--SGEHCQQENPC-LGQVVREVIRRQKGYASCATASKVPIMECRGGC---GPQCCQPTRSKRRKYVFQCTDG-----SSFVEEVERHLECGCLA--------C........... 1522
4 -18.800CPX_91689_91672 Complex of C4BPA_HUMAN with ARP4_STRPY [Undefined organism]  ali follow..  11  18................................AAWPFSRLWKVSLFQMTLIAALLNCGPPPTLSFAAPMDITGTTLKYTCLPGYVRSHS--------TQTLTCNSDGEWVYNTFCIYK-------RCRHPGELRNGQVEIKTDSQIEFSCSEGFFLIGSTCEVQDRGVGIVKCKPPPDIRNGRHSGEEGFSVTYSCDPRFSLLGHACTVENERPSPPTCSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSS---------VIHCDADSKWNPSACEPN-------SCINLPDIPHASWETYPRTVLRYRCHPGYKPTTDICQKNLRWTPYQGC--------EALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCAHGHYKQSSSYSFFKEEIIY--ECDKGYILVGQAKLSCSYSHWSAPAPQCKVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQCSG......... 527
5 -18.700IDP91694 gene: FBLN2; fibulin-2 isoform b precursor [Homo sapiens] NP_001989 [Homo sapiens]  ali follow..  16  607.......ECLLLPGELCQHLCI--NTVGSYHCACFPGFSLDGRTCRPEGHPPQPSNTIPLPLPQPNTCKDNG------PC-------KQVCST-VGGSAICSCFPGYAIMADGV-----SCEDINECVTDLCSRGEHCVNTLGSYKALTCEPGYALKDGECEDVD------ECAMGTCQPGFLCQNTKGCQARQRCMDGFLQDPGNCVDINEC----TSLSEPCRPGFSCINTTCQRNPLICARGYHADGTKCVDVNECETGVRCGEGQVCHN------LPGSYRCDCKAGFQRDGRGCIDVNECWASPGR-----LCQHTCENTL-GSYRCSCASGFLLAADGKRCEDVNE------CEAQRC--SQECANIYGSYQCYCRQGYQLAEDG----HTCTDIDECAQGAGILCTFRCLNVP-GSYQCACPEQGYTMTANGRSCKDVDECALGTHCSEAETCHNIRCL-------RFECPPNYVCERTTCHDFLECQNS.. 1082
6 -15.000IDP90102 TNF-alpha-receptor-like protein [Monkeypox virus] MPXV_ZAI1979_005_002 [Monkeypox virus]  ali follow..  11  23...............................................APHAPSNGKCKDNEYRSRNLC--------CLSCPPGTYATNTQCT---------PCGSDTFTSHNNHLQACLSCN---GRCDSNQVETRSC--NTTHNRICECSPGYYCLLKGSSGCRTCISKTKCGIGYGVGDVICSP---------CGPGTYSHTVS--STDKCEPVTSNTFNYIDVEINLYPVNDT----SCTTTGLSESISTSELTITMNHKDCDPVF...................................................................................................................................................................................................................................... 223
7 -14.800IDP91689 gene: C4BPA; C4b-binding protein alpha chain precursor [Homo sapiens] NP_000706 [Homo sapiens]  ali follow..  13  18................................AAWPFSRLWKVSLFQMTLIAALLNCGPPPTLSFAAPMDITLTETKYTCLPGYVRSHS--------TQTLTCNSDGEWVYNTFCIYK-------RCRHPGELRNGQVEIKTDSQIEFSCSEGFFLIGSTCEVQDRQCEIVKCKPPPDIRNGRHSGEEGFSVTYSCDPRFSLLGHACTVENERPSPPTCSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSCDADSKACEPNSCINLPDIPHASWETYPRTVLRYRCHPGYKPTTDECQKNLRWTPYQGCEALCCRPANHCVYFYGDEISFSCHETSRFSA---ICQGDGTSPRTPSCAHGHYKQSSSYSFFKEEIIYECDKGYILVGQA---------KLSCSYSHWSAPAPQCKALCRENVTIQCDSGYGVVGPQSITCSGNRTKCEWETPEGCEQVLTGKRLMQCPEDVKMALEVYKLSLEIELQR......... 585
8 -14.100IDP91731 gene: EGFL7; epidermal growth factor-like protein 7 [Homo sapiens] NP_958854 [Homo sapiens]  ali follow..  11  17...........................................................................................................................................................................VGGTEHAYRPGRRVCAVR-AHGDPVSESFVQRVYQ-PFLTTCDGHRACSTYRTIYRTAYRRLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQ---------PGRCRCPAGW--RGDTC-----QSDVDECSARRGGCPQRCVNTA-GSYWCQCWEGHSLSADGTLCVPKGGPP-------------RVAPNPTGVDSAMKEEVQRLQSRV----------DLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS................................ 273
9 -12.200IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  12  766................................SCPPG----REKCDGVGTASSETDCGEEPINE----AHAGASVLEASCPDETVVVGGFGISVRGGSDGLSCTTGQTICTKAPTRGSEKNFLWMMCVDKQYPGLRELVNVAELGSHGNANKRAVNSDGNVDV--------KCPANSSIVLGYVMEAHTNLQFVQCPEN----------------ASECKMTGKGVDHGMLWLFDRHALFGCKTVNEPAMHVATDVGKAKGN---------GKKRKGKKGKNKTNAPNEVEEGQQLGADSPSQVSVPADA---------GPTSKTMSS-----LK.................................................................................................................................................................... 1045
10 -11.000IDP91660 LAMA5_HUMAN [Homo sapiens]  ali follow..  15  319.....RLQCT-----------CQHNTCGGTCDRCCPGFN-SANECQSCNCYGHATDCYYDPEVDRRRASQSQGGGVCIDCQHHT--TGVNCER---------CLPGFYLDSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCELCAPGFYGPGQPCQCSSPGVADDRCDPDT--GQCRCRVGFEGATCDRCAPGYF-HFPLCQLCGCSPAGTLPEGCDEAGRCLCQPEFAGPHCDRCRPGYHGFPNACTCDPRGALDQLCGAGGLCR---CRPGYTGTACQECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQ--SCRPRVTGLRCDTCVPGAYCEAGSCHPAGLAPVDPALPEAQVPC---MCRAHVEGPSCDRCKPGFWSNPEGCTRCSCDLRGTLGGVAECQPGTGQCFCKPHVCGQACASCKDGFFCRSCRC........... 831
11 -10.400IDP91688 gene: CD55; complement decay-accelerating factor isoform 1 preproprotein [Homo sapiens] NP_000565 [Homo sapiens]  ali follow..  13  7................................SVPAALPLLGELLLLVLLCLPAVDCGLPPDVPNAQPALEGDTVITYKCEESFVKIPGE-------KDSVICKGSQWSDIEEFCNR--------SCEVPTRLNSASLKQPYGTVVEYECRPGYRREPSL-------SPKLTCLQNLKWSTAFCKKK-------SCPNPGEIRNGQIDVPGGILFGATI-------------------SFSCNTGYKLFGST---------SSFCLISGS-------SVQWSDPLPECRE------------------IYCPAPPQIDNGIIQGERDQSVTYACNKGFTMIGEHSI-----------YCTVNNDEGE------------------------------SGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTRSTPVSRTTKHFHETTPNKGS-GTTSGTTRLLSGHTCFTLTGLLVTM......... 377
12 -9.230IDP06013 LCCL-related multimodular protein CCp1C [Toxoplasma gondii] ACJ45039 [Toxoplasma gondii]  ali follow..  13 1422....................CLTNVHILHRRDECVKEPSFRQIACAQD--------C--------SEC-----------CNYNTSLLPAQCEK--------KCRRN---DPLASLLASGMITRLSTCLKELGDAAAHCKKGNMACQKEACE---------C-----------CISWSPAGSEEC--------KFQCAKHFVPREN...................................................................................................................................................................................................................................................................................................... 1566
13 -9.200IDP90175 gene: VGF; CPXV021 protein or CPXV VGF protein AAM13468.1 [Cowpox virus (Brighton Red)]  ali follow..  20  20............................................................................................................................................................................................................................................................................................................................................................................................................................................DSGNAIETTSPEITNATTDIPAIRLCGPGYCLHGDCIHARDIDGMYCRCFHGYI--GIRC........... 80
14 -9.190IDP90190 gene: CrmC; CrmC or CPXV191 protein AAM13631.1 [Cowpox virus (Brighton Red)]  ali follow..  15  51..............................CNRCPPGEFAK-IRCSGSDN-TKCERCPPHTYTTVPN--YSNGCHQCRKCPTGSFDKVK----TGTQNSKCSCLPGWFCATSSKTEDCRDCIPKRKCPCGYFGGI----DELGNPLCKSCCVGEYCDDIRNH---------RVGPFPPCKLSKC........................................................................................................................................................................................................................................................................................................................... 185
15 -9.150IDP90106 secreted epidermal growth factor-like protein [Monkeypox virus] MPXV_ZAI1979_005_011 [Monkeypox virus]  ali follow..  16  7...............................................................................................................................................................................................................................................................................................................................................................................................................................MLLFAAMIIRSLADSGNAIETTSPEITNATTDIPAIRLCGPGYCLHGDCIHARDIDGMYCRCSHGYT--GIRC........... 80

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.