current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: IDP91039 gene: hdeB; HdeB protein [Shigella dysenteriae 1012] Sd1012_5151 [Shigella dysenteriae 1012], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MNISSLRKAFIFMGAVAALSLVNAQSALAANESAKDMTCQEFIDLNPKAMTPVAWWMLHEETVYKGGDTVTLNETDLTQIPKVIEYCKKNPQKNLYTFKNQASNDLPNLast
1 -60.800IDP91039 gene: hdeB; HdeB protein [Shigella dysenteriae 1012] Sd1012_5151 [Shigella dysenteriae 1012]  ali  100  1MNISSLRKAFIFMGAVAALSLVNAQSALAANESAKDMTCQEFIDLNPKAMTPVAWWMLHEETVYKGGDTVTLNETDLTQIPKVIEYCKKNPQKNLYTFKNQASNDLPN 108
2 -9.570IDP05078 hypothetical protein lmo1340 [Listeria monocytogenes EGD-e] lmo1340 [Listeria monocytogenes EGD-e]  ali follow..  11  1MKKSNTFLLITILVGLVFISFGCSEEKETPKKTAKEVQ----VQIKTKEFQRVVGWLSKLQTKKSGVTYFEELNIYNEKKRPIFNT-QISPDYRNILLYSAESAEKAT 115
3 -8.610IDP95155 type 3 fimbrial protein mrkA precursor [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002921128 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  1MKKVLLSAAMATAFFGMTAAHAADTNVGGGQVNVTDVSCT--VSVNGQGSDANV----SPVTLTEVKAAAADTYLKPKSFTIDVSNCQAADGTK.............. 94
4 -8.360IDP91953 extracellular solute-binding lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002215 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  16  1MKFRKLACTVLASAAVLGLAACGNSGGSKDAGKSG----------GDGAKTEITWWAFPVFTQEKTGD-----GVGTYEKSIIEAFEKANPDVKV-SGPEKITTAIEA 100
5 -7.860IDP90177 gene: CPXV024 CDS; CPXV024 protein AAM13471.1 [Cowpox virus (Brighton Red)]  ali follow..  1MRILFLIAFMYGCVHSYVNADETKCPNLDIVTSSGEFHCSGCVEHMPDF--SYMYWLAKDMKSDEATKFIEHLGDGIKEDETVRTTDGGITTLRKVLHVTDTNKFAH. 105
6 -7.800IDP01771 hypothetical protein YPO1786 [Yersinia pestis CO92] YPO1786 [Yersinia pestis CO92]  ali follow..  1MRVIKMKGFVLMLSLLMLSANAMAAGKIITTREEVMLECRA................................................................... 53
7 -7.780IDP05674 hypothetical protein lmo0859 [Listeria monocytogenes EGD-e] lmo0859 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKIRKIAIAALSVVVAGSLLTA----------------CGG--KSDDNGKTKVTFWAAP------------NPTQVKYWDEMAKAYEKENPDVTI............. 68
8 -7.490IDP95105 fimbriae stability-associated protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002921124 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  4LPKNTIAWLLFCGSLAAPSAWGFETNYDRGRVDVTDISCS--VALNGGQHAGSGNVWLAPVSLAEVHDRGAGAFMKPQPFTLALSNCQLRHDGG.............. 99
9 -7.050IDP04392 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1500 [Clostridium perfringens ATCC 13124]  ali follow..  1MR-VLKGVILAIIPAFLFMGCGEFSKNDVAKVSFEKLSEKEVKNISKNKGYRIDLNYEVYKEGKEVKN........................................ 82
10 -7.040IDP93922 beta-fimbriae major subunit [Yersinia enterocolitica subsp. palearctica Y11] YP_006004996 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  1MKKQLAKITVLSSLIFGINAANAEAPTAELKVILTVPSCT.................................................................... 42

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.